F436019

General Info

Members Datasets Scaffolds Average Seq Length
405 244 388 286

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0216313|Ga0466963_0216313_333_1250
Length 305
Sequence MSARLLVTGREGQVARSLVERGRRSDVEIVPLGRPELDLTAPEQMIASAIAAARPDVVVSAAAYTQVDKAESEPELAFAVNEAGARAVARAARRLGVPLIHLSTDYVFDGSKSSPYLEDDAPNPTGIYGSSKLAGEQAVLAEHDGSVILRTAWVYSPFGANFVKTMLRLAGDRNEIGVVSDQRGNPTSALDIADGIIAVAANLLAGSDPAQRGIFHMTATADASWAEVAEAIFAVSANSGGPTAFVRPITTADYPTPAKRPANSCLDCAKLERVHGVRLPSWRSSLPQIVKRLVSQSIQSKVSQE

Samples

Sample ID Description Type Environment
1 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
2 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
3 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
4 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
5 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
6 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
7 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
8 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
9 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
10 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
11 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
12 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
13 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
14 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
15 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
153 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
154 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
155 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
156 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
157 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
162 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
184 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
187 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
227 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
234 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
235 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
236 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
237 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
238 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
239 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
243 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
244 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.8
Metatranscriptomes 0
Isolates 4.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.84
Nodule 1.73
Rhizoplane 3.7
Rhizosphere 74.81
Stem 0
Stem Tuber 0
Unclassified 6.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000463 3300001915 Bacteria 12346
2 JGI24740J21852_10000050 3300001979 Bacteria 37983
3 JGI24737J22298_10000977 3300001990 Bacteria 10155
4 rootH1_10079580 3300003316 Unclassified 1518
5 rootL2_10079323 3300003322 Bacteria 1840
6 rootH1_10228218 3300003323 Bacteria 1384
7 JGI25407J50210_10015599 3300003373 Bacteria 1963
8 Ga0055526_1005081 3300003771 Bacteria 7680
9 Ga0055526_1011642 3300003771 Bacteria 3937
10 Ga0055528_1001812 3300003790 Bacteria 12218
11 Ga0065165_1036067 3300005262 Bacteria 1512
12 Ga0065704_10001414 3300005289 Bacteria 9375
13 Ga0070658_10050088 3300005327 Bacteria 3385
14 Ga0070658_10165363 3300005327 Bacteria 1857
15 Ga0070683_100005689 3300005329 Bacteria 10410
16 Ga0070690_100004148 3300005330 Bacteria 8014
17 Ga0070680_100310995 3300005336 Bacteria 1337
18 Ga0068868_100231165 3300005338 Bacteria 1551
19 Ga0068868_100254368 3300005338 Bacteria 1479
20 Ga0070660_100205713 3300005339 Bacteria 1597
21 Ga0070660_100422118 3300005339 Bacteria 1104
22 Ga0070661_100000519 3300005344 Bacteria 29559
23 Ga0070661_100013408 3300005344 Bacteria 5753
24 Ga0070661_100226280 3300005344 Bacteria 1436
25 Ga0070661_100256293 3300005344 Bacteria 1351
26 Ga0070668_100084131 3300005347 Bacteria 2498
27 Ga0070671_100001971 3300005355 Bacteria 15750
28 Ga0070671_100010620 3300005355 Bacteria 7391
29 Ga0070671_100170962 3300005355 Bacteria 1838
30 Ga0070671_100232214 3300005355 Bacteria 1565
31 Ga0070671_100477380 3300005355 Bacteria 1071
32 Ga0070674_100069450 3300005356 Bacteria 2485
33 Ga0070673_100006674 3300005364 Bacteria 7524
34 Ga0070673_100059429 3300005364 Bacteria 3026
35 Ga0070659_100002642 3300005366 Bacteria 12752
36 Ga0070659_100039584 3300005366 Bacteria 3681
37 Ga0070659_100051918 3300005366 Bacteria 3224
38 Ga0070667_100018182 3300005367 Bacteria 5828
39 Ga0070714_100046210 3300005435 Bacteria 3692
40 Ga0070713_100111486 3300005436 Bacteria 2386
41 Ga0070663_100153181 3300005455 Bacteria 1769
42 Ga0070663_100316214 3300005455 Bacteria 1254
43 Ga0070662_100025629 3300005457 Bacteria 4074
44 Ga0070684_100009982 3300005535 Bacteria 7505
45 Ga0068853_100086103 3300005539 Bacteria 2755
46 Ga0068853_100158086 3300005539 Bacteria 2043
47 Ga0070665_100109890 3300005548 Bacteria 2759
48 Ga0068855_100058594 3300005563 Bacteria 4509
49 Ga0068855_100108302 3300005563 Bacteria 3191
50 Ga0068855_100290264 3300005563 Bacteria 1813
51 Ga0068855_100429519 3300005563 Bacteria 1444
52 Ga0070664_100075996 3300005564 Bacteria 2885
53 Ga0068857_100051465 3300005577 Bacteria 3654
54 Ga0068854_100003242 3300005578 Bacteria 10145
55 Ga0068854_100292282 3300005578 Bacteria 1315
56 Ga0068856_100018424 3300005614 Bacteria 6767
57 Ga0068852_100049230 3300005616 Bacteria 3604
58 Ga0068852_100052698 3300005616 Bacteria 3498
59 Ga0068852_100058760 3300005616 Bacteria 3332
60 Ga0068852_100085065 3300005616 Bacteria 2816
61 Ga0068852_100616468 3300005616 Bacteria 1090
62 Ga0068858_100010547 3300005842 Bacteria 8750
63 Ga0081455_10000361 3300005937 Bacteria 59979
64 Ga0081538_10000031 3300005981 Bacteria 122458
65 Ga0081539_10006789 3300005985 Bacteria 10738
66 Ga0081539_10023787 3300005985 Bacteria 3999
67 Ga0075365_10004636 3300006038 Bacteria 7317
68 Ga0075368_10022468 3300006042 Bacteria 2402
69 Ga0075368_10024149 3300006042 Bacteria 2326
70 Ga0075363_100000047 3300006048 Bacteria 23631
71 Ga0075363_100032463 3300006048 Bacteria 2712
72 Ga0075364_10000613 3300006051 Bacteria 18376
73 Ga0075364_10003587 3300006051 Bacteria 8840
74 Ga0075364_10382289 3300006051 Bacteria 960
75 Ga0070715_10060895 3300006163 Bacteria 1656
76 Ga0070712_100007994 3300006175 Bacteria 6632
77 Ga0075362_10057825 3300006177 Bacteria 1748
78 Ga0075367_10001290 3300006178 Bacteria 10599
79 Ga0075367_10001424 3300006178 Bacteria 10255
80 Ga0075367_10033534 3300006178 Bacteria 2960
81 Ga0075369_10115637 3300006186 Bacteria 1211
82 Ga0075366_10002027 3300006195 Bacteria 10280
83 Ga0097621_100423995 3300006237 Bacteria 1195
84 Ga0068871_100001517 3300006358 Bacteria 15555
85 Ga0075428_100006220 3300006844 Bacteria 13281
86 Ga0075428_100195124 3300006844 Bacteria 2190
87 Ga0075430_100110503 3300006846 Bacteria 2292
88 Ga0075431_100044816 3300006847 Bacteria 4561
89 Ga0075433_10011373 3300006852 Bacteria 7165
90 Ga0075434_100015854 3300006871 Bacteria 7235
91 Ga0068865_100021058 3300006881 Bacteria 4237
92 Ga0105240_10001987 3300009093 Bacteria 33795
93 Ga0105240_10006155 3300009093 Bacteria 17688
94 Ga0105240_10456939 3300009093 Bacteria 1428
95 Ga0105245_10122833 3300009098 Bacteria 2427
96 Ga0114129_10022163 3300009147 Bacteria 9017
97 Ga0114129_10034696 3300009147 Bacteria 7127
98 Ga0105242_10015892 3300009176 Bacteria 5848
99 Ga0105248_10001316 3300009177 Bacteria 27684
100 Ga0105248_10019864 3300009177 Bacteria 7440
101 Ga0105248_10166660 3300009177 Bacteria 2483
102 Ga0105237_10001260 3300009545 Bacteria 33817
103 Ga0105238_10000628 3300009551 Bacteria 37060
104 Ga0105238_10367743 3300009551 Bacteria 1428
105 Ga0105239_10325447 3300010375 Bacteria 1734
106 Ga0157373_10063587 3300013100 Bacteria 2612
107 Ga0157371_10200595 3300013102 Bacteria 1430
108 Ga0157370_10001572 3300013104 Bacteria 28243
109 Ga0157370_10064074 3300013104 Bacteria 3480
110 Ga0157369_10001785 3300013105 Bacteria 26034
111 Ga0157378_10351856 3300013297 Bacteria 1439
112 Ga0163162_10273042 3300013306 Bacteria 1823
113 Ga0157372_10029038 3300013307 Bacteria 6034
114 Ga0157372_10080036 3300013307 Bacteria 3696
115 Ga0157375_10024795 3300013308 Bacteria 5558
116 Ga0157375_10343415 3300013308 Bacteria 1658
117 Ga0157375_10858584 3300013308 Bacteria 1054
118 Ga0157376_10252848 3300014969 Bacteria 1647
119 Ga0213872_10013102 3300021361 Bacteria 3887
120 Ga0213875_10039725 3300021388 Bacteria 2217
121 Ga0209677_115237 3300025253 Bacteria 1020
122 Ga0209673_1000068 3300025273 Bacteria 245891
123 Ga0209676_1025449 3300025292 Bacteria 1898
124 Ga0209025_1002438 3300025294 Bacteria 19722
125 Ga0209025_1004041 3300025294 Bacteria 13137
126 Ga0209564_1000929 3300025295 Bacteria 38046
127 Ga0209564_1010769 3300025295 Bacteria 4170
128 Ga0209256_1002847 3300025299 Bacteria 13193
129 Ga0209256_1005660 3300025299 Bacteria 7038
130 Ga0209257_1006866 3300025304 Bacteria 7147
131 Ga0209257_1025821 3300025304 Bacteria 1997
132 Ga0209257_1055238 3300025304 Bacteria 1102
133 Ga0207656_10000160 3300025321 Bacteria 25036
134 Ga0207647_10026214 3300025904 Bacteria 3816
135 Ga0207699_10022296 3300025906 Bacteria 3429
136 Ga0207705_10000183 3300025909 Bacteria 65457
137 Ga0207705_10048578 3300025909 Bacteria 3053
138 Ga0207705_10053741 3300025909 Bacteria 2902
139 Ga0207695_10001511 3300025913 Bacteria 38653
140 Ga0207695_10027643 3300025913 Bacteria 6312
141 Ga0207695_10288169 3300025913 Bacteria 1535
142 Ga0207693_10001738 3300025915 Bacteria 19113
143 Ga0207657_10000140 3300025919 Bacteria 74094
144 Ga0207657_10017196 3300025919 Bacteria 6947
145 Ga0207657_10017378 3300025919 Bacteria 6900
146 Ga0207657_10540983 3300025919 Bacteria 911
147 Ga0207649_10000130 3300025920 Bacteria 64246
148 Ga0207649_10134852 3300025920 Bacteria 1682
149 Ga0207649_10182336 3300025920 Bacteria 1470
150 Ga0207694_10002686 3300025924 Bacteria 14385
151 Ga0207694_10375214 3300025924 Bacteria 1180
152 Ga0207650_10416056 3300025925 Bacteria 1115
153 Ga0207644_10001358 3300025931 Bacteria 15739
154 Ga0207644_10002290 3300025931 Bacteria 12422
155 Ga0207644_10006222 3300025931 Bacteria 7780
156 Ga0207690_10000063 3300025932 Bacteria 95620
157 Ga0207690_10011957 3300025932 Bacteria 5189
158 Ga0207690_10128886 3300025932 Bacteria 1849
159 Ga0207706_10020872 3300025933 Bacteria 5882
160 Ga0207706_10106416 3300025933 Bacteria 2468
161 Ga0207704_10025500 3300025938 Bacteria 3227
162 Ga0207711_10000943 3300025941 Bacteria 27943
163 Ga0207711_10001666 3300025941 Bacteria 20482
164 Ga0207711_10011389 3300025941 Bacteria 7392
165 Ga0207711_10144330 3300025941 Bacteria 2144
166 Ga0207661_10000290 3300025944 Bacteria 31735
167 Ga0207679_10045055 3300025945 Bacteria 3188
168 Ga0207679_10135011 3300025945 Bacteria 1986
169 Ga0207667_10000006 3300025949 Bacteria 679876
170 Ga0207667_10000499 3300025949 Bacteria 51798
171 Ga0207667_10014082 3300025949 Bacteria 9131
172 Ga0207667_10268474 3300025949 Bacteria 1744
173 Ga0207667_10344425 3300025949 Bacteria 1520
174 Ga0207651_10002784 3300025960 Bacteria 8400
175 Ga0207651_10031657 3300025960 Bacteria 3385
176 Ga0207651_10214772 3300025960 Bacteria 1551
177 Ga0207668_10110015 3300025972 Bacteria 2065
178 Ga0207668_10226694 3300025972 Bacteria 1504
179 Ga0207640_10000798 3300025981 Bacteria 17927
180 Ga0207640_10004032 3300025981 Bacteria 7934
181 Ga0207640_10420556 3300025981 Bacteria 1094
182 Ga0207658_10153441 3300025986 Bacteria 1879
183 Ga0207677_10002466 3300026023 Bacteria 9726
184 Ga0207677_10028341 3300026023 Bacteria 3539
185 Ga0207703_10118321 3300026035 Bacteria 2271
186 Ga0207639_10000193 3300026041 Bacteria 47121
187 Ga0207639_10027575 3300026041 Bacteria 4139
188 Ga0207639_10056895 3300026041 Bacteria 2999
189 Ga0207678_10000261 3300026067 Bacteria 47649
190 Ga0207678_10000743 3300026067 Bacteria 29830
191 Ga0207678_10401633 3300026067 Bacteria 1187
192 Ga0207702_10001036 3300026078 Bacteria 28486
193 Ga0207702_10015741 3300026078 Bacteria 6262
194 Ga0207674_10001742 3300026116 Bacteria 27825
195 Ga0207674_10013765 3300026116 Bacteria 8952
196 Ga0207675_100180700 3300026118 Bacteria 2020
197 Ga0207683_10028493 3300026121 Bacteria 4829
198 Ga0207698_10000530 3300026142 Bacteria 22187
199 Ga0207698_10013395 3300026142 Bacteria 5409
200 Ga0207698_10031359 3300026142 Bacteria 3835
201 Ga0207698_10531082 3300026142 Bacteria 1150
202 Ga0209371_1004915 3300027312 Bacteria 5568
203 Ga0209813_10000325 3300027866 Bacteria 12570
204 Ga0207428_10032108 3300027907 Bacteria 4322
205 Ga0268266_10085284 3300028379 Bacteria 2759
206 Ga0268266_10364707 3300028379 Bacteria 1360
207 Ga0268266_10434720 3300028379 Bacteria 1246
208 Ga0268265_10062795 3300028380 Bacteria 2855
209 Ga0307515_10028618 3300028794 Bacteria 9465
210 Ga0268256_1004700 3300030500 Bacteria 5568
211 Ga0265327_10001459 3300031251 Bacteria 29685
212 Ga0265327_10007722 3300031251 Bacteria 8227
213 Ga0307513_10122889 3300031456 Bacteria 2559
214 Ga0307408_100052118 3300031548 Bacteria 2950
215 Ga0307516_10225254 3300031730 Bacteria 1582
216 Ga0307405_10012978 3300031731 Bacteria 4432
217 Ga0307405_10055395 3300031731 Bacteria 2481
218 Ga0307413_10005953 3300031824 Bacteria 5513
219 Ga0307410_10009435 3300031852 Bacteria 5473
220 Ga0307410_10025379 3300031852 Bacteria 3717
221 Ga0307410_10044363 3300031852 Bacteria 2953
222 Ga0307410_10122085 3300031852 Bacteria 1901
223 Ga0307410_10284654 3300031852 Bacteria 1298
224 Ga0307406_10008683 3300031901 Bacteria 5677
225 Ga0307406_10149659 3300031901 Bacteria 1663
226 Ga0307412_10014715 3300031911 Bacteria 4624
227 Ga0307412_10143715 3300031911 Bacteria 1751
228 Ga0307412_10148080 3300031911 Bacteria 1728
229 Ga0307412_10349705 3300031911 Bacteria 1186
230 Ga0307409_100007209 3300031995 Bacteria 6628
231 Ga0307409_100011420 3300031995 Bacteria 5599
232 Ga0307409_100196563 3300031995 Bacteria 1800
233 Ga0307409_100200105 3300031995 Bacteria 1786
234 Ga0307416_100636242 3300032002 Bacteria 1150
235 Ga0307414_10135358 3300032004 Bacteria 1920
236 Ga0307411_10063931 3300032005 Bacteria 2461
237 Ga0307411_10350998 3300032005 Bacteria 1202
238 Ga0307411_10436080 3300032005 Bacteria 1092
239 Ga0307415_100005296 3300032126 Bacteria 6832
240 Ga0307415_100116010 3300032126 Bacteria 1997
241 Ga0307415_100148153 3300032126 Bacteria 1802
242 Ga0307415_100301466 3300032126 Bacteria 1328
243 Ga0373950_0002256 3300034818 Bacteria 2636
244 Ga0373958_0016301 3300034819 Bacteria 1323
245 Ga0373940_0003405 3300035088 Bacteria 3244
246 Ga0373944_0063907 3300035089 Bacteria 1186
247 Ga0373949_0012308 3300035090 Bacteria 1891
248 Ga0373939_0001493 3300035114 Bacteria 5671
249 Ga0373960_0001579 3300035121 Bacteria 5083
250 Ga0373943_0023604 3300035170 Bacteria 2861
251 Ga0373946_0012062 3300035171 Bacteria 3232
252 Ga0373961_0010368 3300035241 Bacteria 2295
253 Ga0373962_0004782 3300035242 Bacteria 3269
254 Ga0373931_0009107 3300035691 Bacteria 4737
255 Ga0373927_0001302 3300035695 Bacteria 18864
256 Ga0373925_0012243 3300037068 Bacteria 6207
257 Ga0373925_0204784 3300037068 Bacteria 1570
258 Ga0395899_0000943 3300037312 Bacteria 27277
259 Ga0395899_0016723 3300037312 Bacteria 5592
260 Ga0395899_0059047 3300037312 Bacteria 2827
261 Ga0395899_0125989 3300037312 Bacteria 1832
262 Ga0395899_0147189 3300037312 Bacteria 1671
263 Ga0395900_0008329 3300037418 Bacteria 10675
264 Ga0395900_0022267 3300037418 Bacteria 6483
265 Ga0395900_0042428 3300037418 Bacteria 4688
266 Ga0395900_0134717 3300037418 Bacteria 2530
267 Ga0395900_0249998 3300037418 Bacteria 1775
268 Ga0395900_0459100 3300037418 Bacteria 1229
269 Ga0395898_0001771 3300037466 Bacteria 28186
270 Ga0395898_0041023 3300037466 Bacteria 4574
271 Ga0395898_0087639 3300037466 Bacteria 2998
272 Ga0395898_0111978 3300037466 Bacteria 2616
273 Ga0395898_0204661 3300037466 Bacteria 1883
274 Ga0395905_0001250 3300037471 Bacteria 31475
275 Ga0395905_0018160 3300037471 Bacteria 6675
276 Ga0395905_0079336 3300037471 Bacteria 3077
277 Ga0395905_0151141 3300037471 Bacteria 2184
278 Ga0395905_0159555 3300037471 Bacteria 2120
279 Ga0395905_0200459 3300037471 Bacteria 1871
280 Ga0436364_0339517 3300037853 Bacteria 5759
281 Ga0395901_0000372 3300038443 Bacteria 53814
282 Ga0395901_0000640 3300038443 Bacteria 40526
283 Ga0395901_0258290 3300038443 Bacteria 1813
284 Ga0395901_0318936 3300038443 Bacteria 1608
285 Ga0395901_0627715 3300038443 Bacteria 1080
286 Ga0436360_0513255 3300039438 Bacteria 3519
287 Ga0436361_0095513 3300039447 Bacteria 1411
288 Ga0436361_0153864 3300039447 Bacteria 2215
289 Ga0436363_0019689 3300039450 Bacteria 1596
290 Ga0436363_1414145 3300039450 Bacteria 1797
291 Ga0466965_0066226 3300044683 Bacteria 1811
292 Ga0466961_0013763 3300044693 Bacteria 5185
293 Ga0466963_0216313 3300044694 Bacteria 1341
294 Ga0466964_0006073 3300044706 Bacteria 4502
295 Ga0466968_0028429 3300044735 Bacteria 2305
296 Ga0466959_0024004 3300045049 Bacteria 4515
297 Ga0466958_0017127 3300045836 Bacteria 4183
298 Ga0466958_0163898 3300045836 Bacteria 1406
299 Ga0466967_0021195 3300045976 Bacteria 5271
300 Ga0466967_0182498 3300045976 Bacteria 1980
301 Ga0466967_0198655 3300045976 Bacteria 1898
302 Ga0466967_0234687 3300045976 Bacteria 1747
303 Ga0495583_0022926 3300046506 Bacteria 3172
304 Ga0495620_0020894 3300046515 Bacteria 3188
305 Ga0495630_0025113 3300046517 Bacteria 4405
306 Ga0495632_0014505 3300046519 Bacteria 4453
307 Ga0495654_0000016 3300046530 Bacteria 306416
308 Ga0495668_0050390 3300046616 Bacteria 2308
309 Ga0495611_0031512 3300046648 Bacteria 2334
310 Ga0495625_0000034 3300046660 Bacteria 225120
311 Ga0495625_0046381 3300046660 Bacteria 3136
312 Ga0495669_0005530 3300046684 Bacteria 5271
313 Ga0495672_0000303 3300047320 Bacteria 66366
314 Ga0495672_0041855 3300047320 Bacteria 2767
315 Ga0496106_0036094 3300048909 Bacteria 3698
316 Ga0496106_0068709 3300048909 Bacteria 2703
317 Ga0496107_0141889 3300048910 Bacteria 1776
318 Ga0496108_0044709 3300048911 Bacteria 3697
319 Ga0496109_0006970 3300048912 Bacteria 9537
320 Ga0496109_0057529 3300048912 Bacteria 3549
321 Ga0496109_0362509 3300048912 Bacteria 1369
322 Ga0496110_0120577 3300048913 Bacteria 2362
323 Ga0496111_0005403 3300048914 Bacteria 8181
324 Ga0496111_0005862 3300048914 Bacteria 7923
325 Ga0496112_0001054 3300048915 Bacteria 20330
326 Ga0496113_0049502 3300048916 Bacteria 3129
327 Ga0496113_0052191 3300048916 Bacteria 3053
328 Ga0496113_0164435 3300048916 Bacteria 1755
329 Ga0496115_0399185 3300048918 Bacteria 1116
330 Ga0496117_0000083 3300048920 Bacteria 218945
331 Ga0496118_0020665 3300048921 Bacteria 5831
332 Ga0496119_0002362 3300048922 Bacteria 20781
333 Ga0496120_0000030 3300048923 Bacteria 226066
334 Ga0496121_0013911 3300048924 Bacteria 8601
335 Ga0496122_0000050 3300048925 Bacteria 267874
336 Ga0496122_0064157 3300048925 Bacteria 2674
337 Ga0496122_0137975 3300048925 Bacteria 1532
338 Ga0496123_0000052 3300048926 Bacteria 236409
339 Ga0496123_0038326 3300048926 Bacteria 3370
340 Ga0496124_0001127 3300048927 Bacteria 42030
341 Ga0496125_0003514 3300048928 Bacteria 18911
342 Ga0496125_0124739 3300048928 Bacteria 1827
343 Ga0496126_0097633 3300048929 Bacteria 2574
344 Ga0496126_0131377 3300048929 Bacteria 2163
345 Ga0501033_0117730 3300049570 Bacteria 1930
346 Ga0501036_0076835 3300049572 Bacteria 2825
347 Ga0501043_0199762 3300049579 Bacteria 1552
348 Ga0501067_0151413 3300049583 Bacteria 1292
349 Ga0501071_0616963 3300049587 Bacteria 834
350 Ga0501072_0082089 3300049588 Bacteria 2555
351 Ga0501073_0254502 3300049589 Bacteria 1212
352 Ga0501077_0135942 3300049593 Bacteria 1559
353 Ga0501080_0168576 3300049742 Bacteria 2020
354 Ga0501080_0207774 3300049742 Bacteria 1795
355 Ga0501080_0285526 3300049742 Bacteria 1499
356 Ga0501083_0288931 3300049744 Bacteria 1066
357 Ga0501035_0104511 3300049822 Bacteria 2483
358 nmdc:mga03n38_3406_c1 3300050490 Bacteria 5100
359 nmdc:mga03n38_63_c1 3300050490 Bacteria 22403
360 nmdc:mga00v17_32551_c1 3300050491 Bacteria 3083
361 nmdc:mga00v17_34_c1 3300050491 Bacteria 85919
362 nmdc:mga0yw44_146_c1 3300050492 Bacteria 24410
363 nmdc:mga0yw44_157798_c1 3300050492 Bacteria 1483
364 nmdc:mga0yw44_7707_c1 3300050492 Bacteria 5315
365 nmdc:mga06z11_11763_c1 3300050494 Bacteria 3785
366 nmdc:mga06z11_12138_c1 3300050494 Bacteria 3738
367 nmdc:mga06z11_18813_c1 3300050494 Bacteria 3164
368 nmdc:mga06z11_4865_c2 3300050494 Bacteria 3033
369 nmdc:mga06z11_877_c1 3300050494 Bacteria 10978
370 nmdc:mga04h51_297_c1 3300050495 Bacteria 12708
371 nmdc:mga05p37_125122_c1 3300050507 Bacteria 3157
372 nmdc:mga05p37_393189_c1 3300050507 Bacteria 1621
373 nmdc:mga05p37_85292_c1 3300050507 Bacteria 3891
374 nmdc:mga0qj67_23599_c1 3300050509 Bacteria 4733
375 nmdc:mga06r32_37039_c1 3300050510 Bacteria 4614
376 nmdc:mga0n895_5910_c1 3300050512 Bacteria 10288
377 nmdc:mga0a205_24978_c1 3300050515 Bacteria 5689
378 nmdc:mga0sz30_130115_c1 3300050516 Bacteria 1109
379 nmdc:mga0sz30_352_c1 3300050516 Bacteria 17482
380 Ga0500643_000008 3300053087 Bacteria 457931
381 Ga0500651_0232460 3300053093 Bacteria 1078
382 Ga0500568_0015272 3300053139 Bacteria 3441
383 Ga0500616_0014124 3300053153 Bacteria 4601
384 Ga0500624_000363 3300053157 Bacteria 14583
385 Ga0500645_000003 3300053730 Bacteria 305887
386 Ga0501084_0042305 3300054114 Bacteria 3811
387 Ga0501082_0025918 3300060353 Bacteria 5053
388 Ga0501082_0068764 3300060353 Bacteria 3049

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006844 Ga0075428_100006220 Ga0075428_1000062205 209
2 3300050507 nmdc:mga05p37_393189_c1 nmdc:mga05p37_393189_c1_870_1574 209
3 3300006846 Ga0075430_100110503 Ga0075430_1001105032 211
4 3300006847 Ga0075431_100044816 Ga0075431_1000448162 221
5 3300021388 Ga0213875_10039725 Ga0213875_100397252 224
6 3300037853 Ga0436364_0339517 Ga0436364_0339517_959_1729 224
7 3300039450 Ga0436363_1414145 Ga0436363_1414145_508_1278 224
8 3300049587 Ga0501071_0616963 Ga0501071_0616963_28_774 225
9 3300048916 Ga0496113_0052191 Ga0496113_0052191_2298_3038 226
10 3300048913 Ga0496110_0120577 Ga0496110_0120577_60_812 227
11 3300047320 Ga0495672_0041855 Ga0495672_0041855_2017_2754 229
12 3300039438 Ga0436360_0513255 Ga0436360_0513255_2289_3083 231
13 3300037418 Ga0395900_0249998 Ga0395900_0249998_308_1210 232
14 3300025304 Ga0209257_1055238 Ga0209257_10552381 234
15 3300013308 Ga0157375_10858584 Ga0157375_108585842 235
16 3300025941 Ga0207711_10144330 Ga0207711_101443302 235
17 3300046517 Ga0495630_0025113 Ga0495630_0025113_707_1531 236
18 3300005355 Ga0070671_100477380 Ga0070671_1004773801 237
19 3300050509 nmdc:mga0qj67_23599_c1 nmdc:mga0qj67_23599_c1_2562_3431 238
20 3300037471 Ga0395905_0200459 Ga0395905_0200459_16_828 240
21 3300039450 Ga0436363_0019689 Ga0436363_0019689_711_1535 240
22 3300045976 Ga0466967_0234687 Ga0466967_0234687_735_1601 240
23 3300005262 Ga0065165_1036067 Ga0065165_10360671 241
24 3300025294 Ga0209025_1002438 Ga0209025_100243820 241
25 3300025924 Ga0207694_10375214 Ga0207694_103752141 241
26 3300003771 Ga0055526_1011642 Ga0055526_10116424 242
27 3300003790 Ga0055528_1001812 Ga0055528_10018127 242
28 3300005436 Ga0070713_100111486 Ga0070713_1001114862 242
29 3300025273 Ga0209673_1000068 Ga0209673_1000068109 242
30 3300025294 Ga0209025_1004041 Ga0209025_10040419 242
31 3300025295 Ga0209564_1010769 Ga0209564_10107693 242
32 3300025299 Ga0209256_1005660 Ga0209256_10056604 242
33 3300037466 Ga0395898_0041023 Ga0395898_0041023_247_1065 242
34 3300050492 nmdc:mga0yw44_157798_c1 nmdc:mga0yw44_157798_c1_368_1261 242
35 3300031731 Ga0307405_10012978 Ga0307405_100129783 243
36 3300031911 Ga0307412_10349705 Ga0307412_103497052 243
37 3300031995 Ga0307409_100196563 Ga0307409_1001965632 243
38 3300032005 Ga0307411_10350998 Ga0307411_103509982 243
39 3300006038 Ga0075365_10004636 Ga0075365_100046364 244
40 3300006048 Ga0075363_100032463 Ga0075363_1000324634 244
41 3300006051 Ga0075364_10003587 Ga0075364_1000358711 244
42 3300006178 Ga0075367_10001290 Ga0075367_100012902 244
43 3300025972 Ga0207668_10226694 Ga0207668_102266942 244
44 3300046616 Ga0495668_0050390 Ga0495668_0050390_346_1215 244
45 3300050490 nmdc:mga03n38_3406_c1 nmdc:mga03n38_3406_c1_3592_4461 244
46 3300050491 nmdc:mga00v17_32551_c1 nmdc:mga00v17_32551_c1_1183_2052 244
47 3300050492 nmdc:mga0yw44_7707_c1 nmdc:mga0yw44_7707_c1_1745_2614 244
48 3300050494 nmdc:mga06z11_12138_c1 nmdc:mga06z11_12138_c1_1309_2178 244
49 3300025972 Ga0207668_10110015 Ga0207668_101100152 246
50 3300037312 Ga0395899_0125989 Ga0395899_0125989_826_1716 246
51 3300027866 Ga0209813_10000325 Ga0209813_100003255 247
52 3300037312 Ga0395899_0016723 Ga0395899_0016723_1180_2070 247
53 3300037418 Ga0395900_0134717 Ga0395900_0134717_1436_2326 247
54 3300037466 Ga0395898_0204661 Ga0395898_0204661_890_1780 247
55 3300038443 Ga0395901_0627715 Ga0395901_0627715_133_1023 247
56 3300050494 nmdc:mga06z11_11763_c1 nmdc:mga06z11_11763_c1_66_935 247
57 3300050495 nmdc:mga04h51_297_c1 nmdc:mga04h51_297_c1_4663_5532 247
58 3300009147 Ga0114129_10022163 Ga0114129_100221638 248
59 3300050510 nmdc:mga06r32_37039_c1 nmdc:mga06r32_37039_c1_757_1626 248
60 3300005355 Ga0070671_100232214 Ga0070671_1002322142 249
61 3300005364 Ga0070673_100006674 Ga0070673_1000066746 249
62 3300005367 Ga0070667_100018182 Ga0070667_1000181822 249
63 3300005457 Ga0070662_100025629 Ga0070662_1000256294 249
64 3300006237 Ga0097621_100423995 Ga0097621_1004239952 249
65 3300006358 Ga0068871_100001517 Ga0068871_10000151710 249
66 3300006881 Ga0068865_100021058 Ga0068865_1000210585 249
67 3300009177 Ga0105248_10019864 Ga0105248_100198642 249
68 3300013297 Ga0157378_10351856 Ga0157378_103518562 249
69 3300013308 Ga0157375_10024795 Ga0157375_100247951 249
70 3300025931 Ga0207644_10006222 Ga0207644_100062222 249
71 3300025933 Ga0207706_10020872 Ga0207706_100208726 249
72 3300025938 Ga0207704_10025500 Ga0207704_100255002 249
73 3300025941 Ga0207711_10011389 Ga0207711_100113897 249
74 3300025960 Ga0207651_10002784 Ga0207651_100027843 249
75 3300025986 Ga0207658_10153441 Ga0207658_101534412 249
76 3300026023 Ga0207677_10002466 Ga0207677_100024662 249
77 3300048909 Ga0496106_0036094 Ga0496106_0036094_156_1064 249
78 3300048912 Ga0496109_0362509 Ga0496109_0362509_133_1041 249
79 3300003373 JGI25407J50210_10015599 JGI25407J50210_100155992 251
80 3300005981 Ga0081538_10000031 Ga0081538_1000003143 251
81 3300025253 Ga0209677_115237 Ga0209677_1152371 251
82 3300021361 Ga0213872_10013102 Ga0213872_100131023 252
83 3300039447 Ga0436361_0153864 Ga0436361_0153864_916_1764 252
84 3300005339 Ga0070660_100422118 Ga0070660_1004221181 253
85 3300005614 Ga0068856_100018424 Ga0068856_1000184242 253
86 3300026142 Ga0207698_10531082 Ga0207698_105310822 253
87 3300037471 Ga0395905_0151141 Ga0395905_0151141_1297_2157 253
88 3300038443 Ga0395901_0318936 Ga0395901_0318936_352_1212 253
89 3300005289 Ga0065704_10001414 Ga0065704_100014146 254
90 3300025909 Ga0207705_10048578 Ga0207705_100485782 254
91 3300005338 Ga0068868_100231165 Ga0068868_1002311652 256
92 3300009177 Ga0105248_10166660 Ga0105248_101666602 256
93 3300025941 Ga0207711_10001666 Ga0207711_1000166610 256
94 3300025960 Ga0207651_10214772 Ga0207651_102147722 256
95 3300035089 Ga0373944_0063907 Ga0373944_0063907_130_1017 256
96 3300035695 Ga0373927_0001302 Ga0373927_0001302_14195_15082 256
97 3300037068 Ga0373925_0012243 Ga0373925_0012243_3791_4678 256
98 3300049589 Ga0501073_0254502 Ga0501073_0254502_330_1193 256
99 3300049742 Ga0501080_0285526 Ga0501080_0285526_534_1397 256
100 3300053087 Ga0500643_000008 Ga0500643_000008_300204_301067 256
101 3300053139 Ga0500568_0015272 Ga0500568_0015272_1646_2509 256
102 3300054114 Ga0501084_0042305 Ga0501084_0042305_598_1461 256
103 3300060353 Ga0501082_0025918 Ga0501082_0025918_4086_4949 256
104 3300005985 Ga0081539_10023787 Ga0081539_100237873 258
105 3300005347 Ga0070668_100084131 Ga0070668_1000841312 259
106 3300006042 Ga0075368_10022468 Ga0075368_100224683 259
107 3300006178 Ga0075367_10033534 Ga0075367_100335342 259
108 3300013308 Ga0157375_10343415 Ga0157375_103434152 259
109 3300026023 Ga0207677_10028341 Ga0207677_100283411 259
110 3300026118 Ga0207675_100180700 Ga0207675_1001807002 259
111 3300028379 Ga0268266_10434720 Ga0268266_104347202 259
112 3300028380 Ga0268265_10062795 Ga0268265_100627952 259
113 3300028794 Ga0307515_10028618 Ga0307515_100286187 259
114 3300046660 Ga0495625_0000034 Ga0495625_0000034_107732_108610 259
115 3300048912 Ga0496109_0006970 Ga0496109_0006970_7988_8881 259
116 3300048914 Ga0496111_0005862 Ga0496111_0005862_6196_7089 259
117 3300048916 Ga0496113_0164435 Ga0496113_0164435_508_1401 259
118 3300050494 nmdc:mga06z11_4865_c2 nmdc:mga06z11_4865_c2_365_1234 259
119 3300046515 Ga0495620_0020894 Ga0495620_0020894_1630_2511 260
120 3300046519 Ga0495632_0014505 Ga0495632_0014505_2588_3469 260
121 3300046530 Ga0495654_0000016 Ga0495654_0000016_35563_36444 260
122 3300046660 Ga0495625_0046381 Ga0495625_0046381_955_1836 260
123 3300047320 Ga0495672_0000303 Ga0495672_0000303_37128_38009 260
124 3300053153 Ga0500616_0014124 Ga0500616_0014124_885_1766 260
125 3300009098 Ga0105245_10122833 Ga0105245_101228333 261
126 3300046506 Ga0495583_0022926 Ga0495583_0022926_511_1413 261
127 3300003771 Ga0055526_1005081 Ga0055526_10050816 262
128 3300005355 Ga0070671_100001971 Ga0070671_10000197110 262
129 3300005364 Ga0070673_100059429 Ga0070673_1000594292 262
130 3300009177 Ga0105248_10001316 Ga0105248_1000131619 262
131 3300025292 Ga0209676_1025449 Ga0209676_10254492 262
132 3300025295 Ga0209564_1000929 Ga0209564_100092941 262
133 3300025299 Ga0209256_1002847 Ga0209256_100284712 262
134 3300025304 Ga0209257_1006866 Ga0209257_10068666 262
135 3300025960 Ga0207651_10031657 Ga0207651_100316572 262
136 3300031548 Ga0307408_100052118 Ga0307408_1000521183 262
137 3300031731 Ga0307405_10055395 Ga0307405_100553952 262
138 3300031824 Ga0307413_10005953 Ga0307413_100059535 262
139 3300031852 Ga0307410_10122085 Ga0307410_101220852 262
140 3300031901 Ga0307406_10008683 Ga0307406_100086832 262
141 3300031911 Ga0307412_10014715 Ga0307412_100147155 262
142 3300032004 Ga0307414_10135358 Ga0307414_101353582 262
143 3300032126 Ga0307415_100148153 Ga0307415_1001481532 262
144 3300048909 Ga0496106_0068709 Ga0496106_0068709_884_1774 262
145 3300048910 Ga0496107_0141889 Ga0496107_0141889_238_1119 262
146 3300048911 Ga0496108_0044709 Ga0496108_0044709_1543_2421 262
147 3300048912 Ga0496109_0057529 Ga0496109_0057529_1338_2216 262
148 3300048914 Ga0496111_0005403 Ga0496111_0005403_4058_4936 262
149 3300048915 Ga0496112_0001054 Ga0496112_0001054_12663_13541 262
150 3300048916 Ga0496113_0049502 Ga0496113_0049502_1076_1954 262
151 3300048924 Ga0496121_0013911 Ga0496121_0013911_3077_3958 262
152 3300049570 Ga0501033_0117730 Ga0501033_0117730_10_885 262
153 iso_pu_bacteria 2842454564 2842457929 262
154 iso_pu_bacteria 8005301065 8005304665 262
155 iso_pu_bacteria 8005688590 8005691090 262
156 3300005435 Ga0070714_100046210 Ga0070714_1000462101 263
157 3300037312 Ga0395899_0059047 Ga0395899_0059047_1213_2094 263
158 3300005985 Ga0081539_10006789 Ga0081539_100067899 264
159 3300006042 Ga0075368_10024149 Ga0075368_100241492 264
160 3300006175 Ga0070712_100007994 Ga0070712_1000079942 264
161 3300013306 Ga0163162_10273042 Ga0163162_102730422 264
162 3300014969 Ga0157376_10252848 Ga0157376_102528482 264
163 3300025906 Ga0207699_10022296 Ga0207699_100222962 264
164 3300025915 Ga0207693_10001738 Ga0207693_100017383 264
165 3300025919 Ga0207657_10540983 Ga0207657_105409831 264
166 3300025931 Ga0207644_10001358 Ga0207644_100013589 264
167 3300025941 Ga0207711_10000943 Ga0207711_1000094319 264
168 3300026035 Ga0207703_10118321 Ga0207703_101183213 264
169 3300028379 Ga0268266_10364707 Ga0268266_103647072 264
170 3300031251 Ga0265327_10007722 Ga0265327_100077224 264
171 3300037418 Ga0395900_0459100 Ga0395900_0459100_121_1005 264
172 3300048928 Ga0496125_0124739 Ga0496125_0124739_21_905 264
173 3300049572 Ga0501036_0076835 Ga0501036_0076835_1377_2258 264
174 3300049579 Ga0501043_0199762 Ga0501043_0199762_84_965 264
175 3300049593 Ga0501077_0135942 Ga0501077_0135942_585_1466 264
176 3300049742 Ga0501080_0168576 Ga0501080_0168576_351_1232 264
177 3300049822 Ga0501035_0104511 Ga0501035_0104511_371_1252 264
178 3300050494 nmdc:mga06z11_18813_c1 nmdc:mga06z11_18813_c1_1671_2555 264
179 3300050507 nmdc:mga05p37_125122_c1 nmdc:mga05p37_125122_c1_1962_2843 264
180 3300060353 Ga0501082_0068764 Ga0501082_0068764_1851_2732 264
181 iso_pu_bacteria 2558860242 2559297761 264
182 iso_pu_bacteria 2808606387 2808989241 264
183 iso_pu_bacteria 2841846520 2841850097 264
184 iso_pu_bacteria 2842124991 2842128569 264
185 iso_pu_bacteria 2919138771 2919143069 264
186 iso_pu_bacteria 2926760298 2926764701 264
187 iso_pu_bacteria 2933594066 2933597148 264
188 iso_pu_bacteria 2979089926 2979090184 264
189 iso_pu_bacteria 2979095461 2979095717 264
190 iso_pu_bacteria 650716007 650842511 264
191 3300003316 rootH1_10079580 rootH1_100795802 265
192 3300005327 Ga0070658_10165363 Ga0070658_101653632 265
193 3300005329 Ga0070683_100005689 Ga0070683_1000056895 265
194 3300005338 Ga0068868_100254368 Ga0068868_1002543681 265
195 3300005339 Ga0070660_100205713 Ga0070660_1002057132 265
196 3300005344 Ga0070661_100013408 Ga0070661_1000134085 265
197 3300005344 Ga0070661_100226280 Ga0070661_1002262802 265
198 3300005355 Ga0070671_100170962 Ga0070671_1001709622 265
199 3300005366 Ga0070659_100039584 Ga0070659_1000395842 265
200 3300005366 Ga0070659_100051918 Ga0070659_1000519182 265
201 3300005455 Ga0070663_100316214 Ga0070663_1003162141 265
202 3300005535 Ga0070684_100009982 Ga0070684_1000099826 265
203 3300005539 Ga0068853_100086103 Ga0068853_1000861033 265
204 3300005563 Ga0068855_100058594 Ga0068855_1000585944 265
205 3300005564 Ga0070664_100075996 Ga0070664_1000759963 265
206 3300005577 Ga0068857_100051465 Ga0068857_1000514655 265
207 3300005578 Ga0068854_100003242 Ga0068854_1000032427 265
208 3300005616 Ga0068852_100052698 Ga0068852_1000526984 265
209 3300005616 Ga0068852_100085065 Ga0068852_1000850653 265
210 3300009551 Ga0105238_10367743 Ga0105238_103677432 265
211 3300013100 Ga0157373_10063587 Ga0157373_100635872 265
212 3300013102 Ga0157371_10200595 Ga0157371_102005952 265
213 3300013104 Ga0157370_10064074 Ga0157370_100640742 265
214 3300013307 Ga0157372_10029038 Ga0157372_100290382 265
215 3300013307 Ga0157372_10080036 Ga0157372_100800363 265
216 3300025913 Ga0207695_10288169 Ga0207695_102881692 265
217 3300025919 Ga0207657_10017378 Ga0207657_100173782 265
218 3300025920 Ga0207649_10134852 Ga0207649_101348522 265
219 3300025920 Ga0207649_10182336 Ga0207649_101823362 265
220 3300025932 Ga0207690_10011957 Ga0207690_100119575 265
221 3300025932 Ga0207690_10128886 Ga0207690_101288861 265
222 3300025933 Ga0207706_10106416 Ga0207706_101064162 265
223 3300025944 Ga0207661_10000290 Ga0207661_1000029023 265
224 3300025945 Ga0207679_10135011 Ga0207679_101350112 265
225 3300025949 Ga0207667_10014082 Ga0207667_100140824 265
226 3300025949 Ga0207667_10268474 Ga0207667_102684742 265
227 3300025949 Ga0207667_10344425 Ga0207667_103444252 265
228 3300025981 Ga0207640_10004032 Ga0207640_100040325 265
229 3300026041 Ga0207639_10027575 Ga0207639_100275752 265
230 3300026041 Ga0207639_10056895 Ga0207639_100568952 265
231 3300026067 Ga0207678_10000743 Ga0207678_1000074317 265
232 3300026067 Ga0207678_10401633 Ga0207678_104016331 265
233 3300026078 Ga0207702_10001036 Ga0207702_100010362 265
234 3300026116 Ga0207674_10013765 Ga0207674_100137652 265
235 3300026142 Ga0207698_10013395 Ga0207698_100133952 265
236 3300026142 Ga0207698_10031359 Ga0207698_100313592 265
237 3300031251 Ga0265327_10001459 Ga0265327_1000145919 265
238 3300032126 Ga0307415_100301466 Ga0307415_1003014662 265
239 3300039447 Ga0436361_0095513 Ga0436361_0095513_397_1284 265
240 3300044683 Ga0466965_0066226 Ga0466965_0066226_375_1262 265
241 3300044693 Ga0466961_0013763 Ga0466961_0013763_232_1119 265
242 3300044706 Ga0466964_0006073 Ga0466964_0006073_2191_3078 265
243 3300044735 Ga0466968_0028429 Ga0466968_0028429_989_1876 265
244 3300045836 Ga0466958_0017127 Ga0466958_0017127_755_1642 265
245 3300045976 Ga0466967_0021195 Ga0466967_0021195_3454_4341 265
246 3300045976 Ga0466967_0182498 Ga0466967_0182498_918_1805 265
247 3300045976 Ga0466967_0198655 Ga0466967_0198655_377_1264 265
248 3300046684 Ga0495669_0005530 Ga0495669_0005530_2401_3288 265
249 3300048925 Ga0496122_0137975 Ga0496122_0137975_29_919 265
250 iso_pu_bacteria 2522572158 2523105035 265
251 iso_pu_bacteria 2558860100 2558861236 265
252 iso_pu_bacteria 3005409236 3005413243 265
253 3300005563 Ga0068855_100108302 Ga0068855_1001083022 266
254 3300005616 Ga0068852_100058760 Ga0068852_1000587602 266
255 3300013105 Ga0157369_10001785 Ga0157369_100017857 266
256 3300025304 Ga0209257_1025821 Ga0209257_10258212 266
257 3300025909 Ga0207705_10053741 Ga0207705_100537412 266
258 3300025919 Ga0207657_10017196 Ga0207657_100171963 266
259 3300031456 Ga0307513_10122889 Ga0307513_101228892 266
260 3300031730 Ga0307516_10225254 Ga0307516_102252542 266
261 3300031852 Ga0307410_10009435 Ga0307410_100094353 266
262 3300031852 Ga0307410_10044363 Ga0307410_100443632 266
263 3300031995 Ga0307409_100200105 Ga0307409_1002001052 266
264 3300032005 Ga0307411_10436080 Ga0307411_104360802 266
265 3300032126 Ga0307415_100005296 Ga0307415_1000052963 266
266 3300037312 Ga0395899_0000943 Ga0395899_0000943_12471_13361 266
267 3300037418 Ga0395900_0042428 Ga0395900_0042428_2661_3551 266
268 3300037466 Ga0395898_0001771 Ga0395898_0001771_8418_9308 266
269 3300037471 Ga0395905_0001250 Ga0395905_0001250_8418_9308 266
270 3300037471 Ga0395905_0079336 Ga0395905_0079336_642_1532 266
271 3300037471 Ga0395905_0159555 Ga0395905_0159555_1182_2072 266
272 3300038443 Ga0395901_0000640 Ga0395901_0000640_5152_6042 266
273 3300053093 Ga0500651_0232460 Ga0500651_0232460_154_1047 266
274 iso_pu_bacteria 2891088606 2891092648 266
275 3300003323 rootH1_10228218 rootH1_102282181 267
276 3300005330 Ga0070690_100004148 Ga0070690_1000041485 267
277 3300005355 Ga0070671_100010620 Ga0070671_1000106202 267
278 3300005356 Ga0070674_100069450 Ga0070674_1000694502 267
279 3300005842 Ga0068858_100010547 Ga0068858_1000105474 267
280 3300006163 Ga0070715_10060895 Ga0070715_100608952 267
281 3300006844 Ga0075428_100195124 Ga0075428_1001951242 267
282 3300009147 Ga0114129_10034696 Ga0114129_100346966 267
283 3300009176 Ga0105242_10015892 Ga0105242_100158926 267
284 3300025925 Ga0207650_10416056 Ga0207650_104160562 267
285 3300025931 Ga0207644_10002290 Ga0207644_100022902 267
286 3300026121 Ga0207683_10028493 Ga0207683_100284932 267
287 3300037471 Ga0395905_0018160 Ga0395905_0018160_892_1785 267
288 3300048918 Ga0496115_0399185 Ga0496115_0399185_115_1008 267
289 3300049588 Ga0501072_0082089 Ga0501072_0082089_468_1367 267
290 3300049742 Ga0501080_0207774 Ga0501080_0207774_445_1344 267
291 3300049744 Ga0501083_0288931 Ga0501083_0288931_59_958 267
292 3300050507 nmdc:mga05p37_85292_c1 nmdc:mga05p37_85292_c1_1125_2018 267
293 3300005336 Ga0070680_100310995 Ga0070680_1003109952 268
294 3300005344 Ga0070661_100256293 Ga0070661_1002562932 268
295 3300005455 Ga0070663_100153181 Ga0070663_1001531812 268
296 3300005548 Ga0070665_100109890 Ga0070665_1001098902 268
297 3300005616 Ga0068852_100616468 Ga0068852_1006164682 268
298 3300005937 Ga0081455_10000361 Ga0081455_1000036132 268
299 3300006048 Ga0075363_100000047 Ga0075363_10000004715 268
300 3300006051 Ga0075364_10000613 Ga0075364_1000061315 268
301 3300006051 Ga0075364_10382289 Ga0075364_103822891 268
302 3300006177 Ga0075362_10057825 Ga0075362_100578252 268
303 3300006178 Ga0075367_10001424 Ga0075367_100014242 268
304 3300006186 Ga0075369_10115637 Ga0075369_101156371 268
305 3300006195 Ga0075366_10002027 Ga0075366_100020274 268
306 3300006852 Ga0075433_10011373 Ga0075433_100113733 268
307 3300006871 Ga0075434_100015854 Ga0075434_1000158541 268
308 3300009093 Ga0105240_10006155 Ga0105240_1000615515 268
309 3300009093 Ga0105240_10456939 Ga0105240_104569392 268
310 3300025321 Ga0207656_10000160 Ga0207656_1000016015 268
311 3300025913 Ga0207695_10001511 Ga0207695_1000151122 268
312 3300025913 Ga0207695_10027643 Ga0207695_100276435 268
313 3300025981 Ga0207640_10420556 Ga0207640_104205562 268
314 3300026067 Ga0207678_10000261 Ga0207678_1000026131 268
315 3300026078 Ga0207702_10015741 Ga0207702_100157417 268
316 3300027312 Ga0209371_1004915 Ga0209371_10049152 268
317 3300027907 Ga0207428_10032108 Ga0207428_100321082 268
318 3300028379 Ga0268266_10085284 Ga0268266_100852842 268
319 3300030500 Ga0268256_1004700 Ga0268256_10047007 268
320 3300034818 Ga0373950_0002256 Ga0373950_0002256_1171_2067 268
321 3300034819 Ga0373958_0016301 Ga0373958_0016301_195_1091 268
322 3300035088 Ga0373940_0003405 Ga0373940_0003405_1597_2493 268
323 3300035090 Ga0373949_0012308 Ga0373949_0012308_642_1538 268
324 3300035114 Ga0373939_0001493 Ga0373939_0001493_1093_1989 268
325 3300035121 Ga0373960_0001579 Ga0373960_0001579_3655_4551 268
326 3300035170 Ga0373943_0023604 Ga0373943_0023604_1160_2056 268
327 3300035171 Ga0373946_0012062 Ga0373946_0012062_2199_3095 268
328 3300035241 Ga0373961_0010368 Ga0373961_0010368_1220_2116 268
329 3300035242 Ga0373962_0004782 Ga0373962_0004782_868_1764 268
330 3300035691 Ga0373931_0009107 Ga0373931_0009107_3824_4720 268
331 3300037068 Ga0373925_0204784 Ga0373925_0204784_156_1052 268
332 3300037312 Ga0395899_0147189 Ga0395899_0147189_21_923 268
333 3300037418 Ga0395900_0008329 Ga0395900_0008329_2572_3468 268
334 3300037466 Ga0395898_0087639 Ga0395898_0087639_1446_2348 268
335 3300038443 Ga0395901_0000372 Ga0395901_0000372_34585_35481 268
336 3300038443 Ga0395901_0258290 Ga0395901_0258290_481_1383 268
337 3300048920 Ga0496117_0000083 Ga0496117_0000083_4757_5650 268
338 3300048921 Ga0496118_0020665 Ga0496118_0020665_395_1288 268
339 3300048922 Ga0496119_0002362 Ga0496119_0002362_2984_3877 268
340 3300048923 Ga0496120_0000030 Ga0496120_0000030_20579_21472 268
341 3300048925 Ga0496122_0000050 Ga0496122_0000050_159587_160480 268
342 3300048925 Ga0496122_0064157 Ga0496122_0064157_1717_2610 268
343 3300048926 Ga0496123_0000052 Ga0496123_0000052_204134_205027 268
344 3300048926 Ga0496123_0038326 Ga0496123_0038326_107_1000 268
345 3300048927 Ga0496124_0001127 Ga0496124_0001127_25543_26436 268
346 3300048928 Ga0496125_0003514 Ga0496125_0003514_9390_10283 268
347 3300048929 Ga0496126_0097633 Ga0496126_0097633_1547_2440 268
348 3300048929 Ga0496126_0131377 Ga0496126_0131377_14_907 268
349 3300050490 nmdc:mga03n38_63_c1 nmdc:mga03n38_63_c1_19059_19952 268
350 3300050491 nmdc:mga00v17_34_c1 nmdc:mga00v17_34_c1_28786_29679 268
351 3300050492 nmdc:mga0yw44_146_c1 nmdc:mga0yw44_146_c1_22792_23685 268
352 3300050494 nmdc:mga06z11_877_c1 nmdc:mga06z11_877_c1_8481_9374 268
353 3300050512 nmdc:mga0n895_5910_c1 nmdc:mga0n895_5910_c1_4543_5439 268
354 3300050515 nmdc:mga0a205_24978_c1 nmdc:mga0a205_24978_c1_1317_2213 268
355 3300050516 nmdc:mga0sz30_130115_c1 nmdc:mga0sz30_130115_c1_154_1047 268
356 3300050516 nmdc:mga0sz30_352_c1 nmdc:mga0sz30_352_c1_63_956 268
357 3300053157 Ga0500624_000363 Ga0500624_000363_3761_4654 268
358 3300001915 JGI24741J21665_1000463 JGI24741J21665_10004634 269
359 3300001979 JGI24740J21852_10000050 JGI24740J21852_1000005014 269
360 3300001990 JGI24737J22298_10000977 JGI24737J22298_1000097711 269
361 3300003322 rootL2_10079323 rootL2_100793232 269
362 3300005327 Ga0070658_10050088 Ga0070658_100500881 269
363 3300005344 Ga0070661_100000519 Ga0070661_10000051917 269
364 3300005366 Ga0070659_100002642 Ga0070659_10000264214 269
365 3300005539 Ga0068853_100158086 Ga0068853_1001580863 269
366 3300005563 Ga0068855_100290264 Ga0068855_1002902642 269
367 3300005563 Ga0068855_100429519 Ga0068855_1004295192 269
368 3300005578 Ga0068854_100292282 Ga0068854_1002922822 269
369 3300005616 Ga0068852_100049230 Ga0068852_1000492304 269
370 3300009093 Ga0105240_10001987 Ga0105240_100019872 269
371 3300009545 Ga0105237_10001260 Ga0105237_100012602 269
372 3300009551 Ga0105238_10000628 Ga0105238_100006283 269
373 3300010375 Ga0105239_10325447 Ga0105239_103254472 269
374 3300013104 Ga0157370_10001572 Ga0157370_1000157225 269
375 3300025904 Ga0207647_10026214 Ga0207647_100262146 269
376 3300025909 Ga0207705_10000183 Ga0207705_1000018311 269
377 3300025919 Ga0207657_10000140 Ga0207657_1000014016 269
378 3300025920 Ga0207649_10000130 Ga0207649_1000013032 269
379 3300025924 Ga0207694_10002686 Ga0207694_100026863 269
380 3300025932 Ga0207690_10000063 Ga0207690_1000006353 269
381 3300025945 Ga0207679_10045055 Ga0207679_100450552 269
382 3300025949 Ga0207667_10000006 Ga0207667_10000006104 269
383 3300025949 Ga0207667_10000499 Ga0207667_1000049930 269
384 3300025981 Ga0207640_10000798 Ga0207640_1000079817 269
385 3300026041 Ga0207639_10000193 Ga0207639_1000019311 269
386 3300026116 Ga0207674_10001742 Ga0207674_1000174224 269
387 3300026142 Ga0207698_10000530 Ga0207698_1000053010 269
388 3300031852 Ga0307410_10025379 Ga0307410_100253792 269
389 3300031852 Ga0307410_10284654 Ga0307410_102846542 269
390 3300031901 Ga0307406_10149659 Ga0307406_101496592 269
391 3300031911 Ga0307412_10143715 Ga0307412_101437152 269
392 3300031911 Ga0307412_10148080 Ga0307412_101480802 269
393 3300031995 Ga0307409_100007209 Ga0307409_1000072092 269
394 3300031995 Ga0307409_100011420 Ga0307409_1000114204 269
395 3300032002 Ga0307416_100636242 Ga0307416_1006362422 269
396 3300032005 Ga0307411_10063931 Ga0307411_100639312 269
397 3300032126 Ga0307415_100116010 Ga0307415_1001160102 269
398 3300037418 Ga0395900_0022267 Ga0395900_0022267_3583_4494 269
399 3300037466 Ga0395898_0111978 Ga0395898_0111978_324_1235 269
400 3300044694 Ga0466963_0216313 Ga0466963_0216313_333_1250 269
401 3300045049 Ga0466959_0024004 Ga0466959_0024004_3238_4155 269
402 3300045836 Ga0466958_0163898 Ga0466958_0163898_262_1179 269
403 3300046648 Ga0495611_0031512 Ga0495611_0031512_564_1466 269
404 3300049583 Ga0501067_0151413 Ga0501067_0151413_368_1267 269
405 3300053730 Ga0500645_000003 Ga0500645_000003_124641_125543 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

3

295

0.97

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

5

211

0.9

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

35

166

0.9

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

34

164

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ctr-assembly4.cif.gz_D crystal structure of dtdp-4-dehydrorhamnose reductase from klebsiella pneumoniae with bound nadp 0.9128 1 263
1kbz-assembly1.cif.gz_A crystal structure of apo-dtdp-6-deoxy-l-lyxo-4-hexulose reductase (rmld) from salmonella enterica serovar typhimurium 0.8964 1 262
8ctr-assembly4.cif.gz_D crystal structure of dtdp-4-dehydrorhamnose reductase from klebsiella pneumoniae with bound nadp 0.8899 1 263
1vl0-assembly1.cif.gz_B crystal structure of a dtdp-4-dehydrorhamnose reductase, rfbd ortholog (ca_c2315) from clostridium acetobutylicum atcc 824 at 2.05 a resolution 0.8895 1 261
3sc6-assembly6.cif.gz_F 2.65 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose reductase (rfbd) from bacillus anthracis str. ames in complex with nadp 0.8753 2 260
ID Description Score Start End Superfamily
1kc0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8956 1 262 3.40.50.720
1kc0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8703 1 262 3.40.50.720
af_A0A1D6HPY3_156_346_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8689 75 257 3.40.50.720
af_A0A1D6HPY3_156_346_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8306 75 257 3.40.50.720
4kttE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8296 2 266 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A529WQZ0-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.967 74 265 GO:0008831
GO:0019305
AF-A0A1I1BMY0-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.9657 1 261 GO:0008831
GO:0019305
AF-A0A1U9YKN3-F1-model_v4 deleted 0.9655 51 137
AF-A0A849GLE0-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.9652 49 261 GO:0016491
GO:0019305
AF-A0A4Q7T2V7-F1-model_v4 deleted 0.962 1 264

Feature Viewer

pLDDT pTM Quality
92.95 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map