F435903

General Info

Members Datasets Scaffolds Average Seq Length
405 213 810 307

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10077510|Ga0081455_100775102
Length 332
Sequence MPPAIEARHLTKTFSAKQTGPGLLGSLRAAVRPAYRETVAVDTVSFGVQAGEVVAFMGPNGAGKSTTIRVLLGLLRADSGDVTMLGGDPWRDAVALHRRLAYVPGDVNLWPNLSGGEVIDLLGNLRGGIDRHHRDELIDRFDLDPRKKARTYSKGNRQKVALVAALASDAELLILDEPTSGLDPLMETIFQDTVREITAGGSRTVLLSSHILAQVEALCDRVSIIRLGRTVESGTLAQLRHLTRTQITVEADRPLTGVADLPGVHDPKLDGARASFDVDTARLDDVVRYLATVGIRTLQSQPPTLEELFLRHYGDELAELEGAAGRGDGEAP

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
70 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
71 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
87 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
88 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
90 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
99 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
100 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
101 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
102 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
103 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
104 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
105 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
106 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
107 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
108 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
109 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
110 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
111 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
112 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
113 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
117 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
162 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
172 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
173 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
174 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
177 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
178 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
181 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
182 2582580736 Prauserella sp. Am3 Isolate Unclassified
183 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
184 2643221561 Nocardioides sp. Root151 Isolate Unclassified
185 2643221615 Nocardioides sp. Root224 Isolate Unclassified
186 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
187 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
188 2643221696 Nocardioides sp. Root140 Isolate Unclassified
189 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
190 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
191 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
192 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
193 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
194 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
195 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
196 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
197 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
198 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
199 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
200 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
201 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
202 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
203 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
204 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
205 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
206 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
207 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
208 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
209 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
210 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
211 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
212 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
213 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.85
Metatranscriptomes 0
Isolates 8.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.94
Nodule 0
Rhizoplane 6.67
Rhizosphere 80.99
Stem 0
Stem Tuber 0.25
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10077510 3300005937 Bacteria 2734
2 JGI25406J46586_10008345 3300003203 Bacteria 4696
3 JGI25406J46586_10018909 3300003203 Bacteria 2820
4 JGI25407J50210_10000456 3300003373 Bacteria 8070
5 JGI25407J50210_10029966 3300003373 Bacteria 1410
6 Ga0070683_100419339 3300005329 Bacteria 1277
7 Ga0070660_100477412 3300005339 Bacteria 1036
8 Ga0070689_100117375 3300005340 Bacteria 2122
9 Ga0070687_100024610 3300005343 Bacteria 2877
10 Ga0070671_100046746 3300005355 Bacteria 3599
11 Ga0070674_100335919 3300005356 Bacteria 1216
12 Ga0070667_100156754 3300005367 Bacteria 2003
13 Ga0070710_10000276 3300005437 Bacteria 24261
14 Ga0070705_100062939 3300005440 Bacteria 2211
15 Ga0070700_100095305 3300005441 Bacteria 1950
16 Ga0070685_10003920 3300005466 Bacteria 7519
17 Ga0070707_100004796 3300005468 Bacteria 12660
18 Ga0070672_100294103 3300005543 Bacteria 1375
19 Ga0070664_100186181 3300005564 Bacteria 1848
20 Ga0068852_100218136 3300005616 Bacteria 1813
21 Ga0068870_10009153 3300005840 Bacteria 4488
22 Ga0068863_100027886 3300005841 Bacteria 5390
23 Ga0081455_10000154 3300005937 Bacteria 82712
24 Ga0081455_10000318 3300005937 Bacteria 63202
25 Ga0081455_10000549 3300005937 Bacteria 48766
26 Ga0081455_10000578 3300005937 Bacteria 47746
27 Ga0081455_10002089 3300005937 Bacteria 23831
28 Ga0081455_10024877 3300005937 Bacteria 5534
29 Ga0081538_10000848 3300005981 Bacteria 33003
30 Ga0081538_10001797 3300005981 Bacteria 21655
31 Ga0081538_10003281 3300005981 Bacteria 15363
32 Ga0081538_10007921 3300005981 Bacteria 9100
33 Ga0081538_10009312 3300005981 Bacteria 8215
34 Ga0081538_10010203 3300005981 Bacteria 7718
35 Ga0081538_10017982 3300005981 Bacteria 5335
36 Ga0081538_10028642 3300005981 Bacteria 3824
37 Ga0081538_10032557 3300005981 Bacteria 3490
38 Ga0081538_10033565 3300005981 Bacteria 3413
39 Ga0081538_10035581 3300005981 Bacteria 3269
40 Ga0081538_10059160 3300005981 Bacteria 2216
41 Ga0081538_10128064 3300005981 Bacteria 1201
42 Ga0081539_10000116 3300005985 Bacteria 186861
43 Ga0081539_10000769 3300005985 Bacteria 63034
44 Ga0081539_10010634 3300005985 Bacteria 7429
45 Ga0081539_10144286 3300005985 Bacteria 1153
46 Ga0075365_10007484 3300006038 Bacteria 6120
47 Ga0075365_10037167 3300006038 Bacteria 3160
48 Ga0075365_10044765 3300006038 Bacteria 2902
49 Ga0075365_10115916 3300006038 Bacteria 1844
50 Ga0075365_10219751 3300006038 Bacteria 1333
51 Ga0075363_100014656 3300006048 Bacteria 3838
52 Ga0075364_10022447 3300006051 Bacteria 3985
53 Ga0075432_10000306 3300006058 Bacteria 13791
54 Ga0070716_100026515 3300006173 Bacteria 3104
55 Ga0075367_10086442 3300006178 Bacteria 1903
56 Ga0075370_10026682 3300006353 Bacteria 3201
57 Ga0075370_10037512 3300006353 Bacteria 2726
58 Ga0075428_100008842 3300006844 Bacteria 11174
59 Ga0075428_100056107 3300006844 Bacteria 4315
60 Ga0075428_100081950 3300006844 Bacteria 3520
61 Ga0075428_100126406 3300006844 Bacteria 2782
62 Ga0075428_100165780 3300006844 Bacteria 2397
63 Ga0075430_100002021 3300006846 Bacteria 16727
64 Ga0075430_100038040 3300006846 Bacteria 4078
65 Ga0075430_100040122 3300006846 Bacteria 3963
66 Ga0075430_100053045 3300006846 Bacteria 3415
67 Ga0075430_100337586 3300006846 Bacteria 1245
68 Ga0075430_100345418 3300006846 Bacteria 1229
69 Ga0075431_100004645 3300006847 Bacteria 13486
70 Ga0075431_100004705 3300006847 Bacteria 13403
71 Ga0075431_100022237 3300006847 Bacteria 6484
72 Ga0075431_100061944 3300006847 Bacteria 3860
73 Ga0075433_10027141 3300006852 Bacteria 4855
74 Ga0075433_10042725 3300006852 Bacteria 3934
75 Ga0075433_10171551 3300006852 Bacteria 1930
76 Ga0075434_100074594 3300006871 Bacteria 3385
77 Ga0075434_100710081 3300006871 Bacteria 1023
78 Ga0075429_100016734 3300006880 Bacteria 6351
79 Ga0075429_100035256 3300006880 Bacteria 4351
80 Ga0075429_100083123 3300006880 Bacteria 2791
81 Ga0075429_100244763 3300006880 Bacteria 1570
82 Ga0111539_10005663 3300009094 Bacteria 16159
83 Ga0111539_10010490 3300009094 Bacteria 11659
84 Ga0111539_10068834 3300009094 Bacteria 4179
85 Ga0111539_10204674 3300009094 Bacteria 2301
86 Ga0111539_10459175 3300009094 Bacteria 1483
87 Ga0114129_10000469 3300009147 Bacteria 48422
88 Ga0114129_10003869 3300009147 Bacteria 21113
89 Ga0114129_10004236 3300009147 Bacteria 20256
90 Ga0114129_10014985 3300009147 Bacteria 11041
91 Ga0114129_10038323 3300009147 Bacteria 6762
92 Ga0114129_10068734 3300009147 Bacteria 4939
93 Ga0105243_10082234 3300009148 Bacteria 2631
94 Ga0105243_10319094 3300009148 Bacteria 1415
95 Ga0105242_10099806 3300009176 Bacteria 2458
96 Ga0105242_10193751 3300009176 Bacteria 1801
97 Ga0105239_10759000 3300010375 Bacteria 1110
98 Ga0163162_10022551 3300013306 Bacteria 6206
99 Ga0163162_10046424 3300013306 Bacteria 4354
100 Ga0157372_10252881 3300013307 Bacteria 2046
101 Ga0157375_10007341 3300013308 Bacteria 9651
102 Ga0163163_10066475 3300014325 Bacteria 3581
103 Ga0207699_10085282 3300025906 Bacteria 1969
104 Ga0207643_10046580 3300025908 Bacteria 2452
105 Ga0207693_10009441 3300025915 Bacteria 7949
106 Ga0207660_10193621 3300025917 Bacteria 1585
107 Ga0207646_10383194 3300025922 Bacteria 1270
108 Ga0207700_10068218 3300025928 Bacteria 2725
109 Ga0207644_10063436 3300025931 Bacteria 2683
110 Ga0207709_10000403 3300025935 Bacteria 42327
111 Ga0207709_10193516 3300025935 Bacteria 1447
112 Ga0207669_10211771 3300025937 Bacteria 1415
113 Ga0207704_10054367 3300025938 Bacteria 2441
114 Ga0207665_10003309 3300025939 Bacteria 10799
115 Ga0207711_10247249 3300025941 Bacteria 1637
116 Ga0207661_10416461 3300025944 Bacteria 1220
117 Ga0207640_10135262 3300025981 Bacteria 1788
118 Ga0207703_10333805 3300026035 Bacteria 1391
119 Ga0207678_10060237 3300026067 Bacteria 3265
120 Ga0207708_10006572 3300026075 Bacteria 8605
121 Ga0207702_10144039 3300026078 Bacteria 2160
122 Ga0207641_10030229 3300026088 Bacteria 4485
123 Ga0207676_10070054 3300026095 Bacteria 2811
124 Ga0207675_100041049 3300026118 Bacteria 4321
125 Ga0207683_10040303 3300026121 Bacteria 4074
126 Ga0207428_10001795 3300027907 Bacteria 21973
127 Ga0207428_10002393 3300027907 Bacteria 18744
128 Ga0207428_10007533 3300027907 Bacteria 9920
129 Ga0207428_10081083 3300027907 Bacteria 2534
130 Ga0268266_10143916 3300028379 Bacteria 2142
131 Ga0307515_10015066 3300028794 Bacteria 14280
132 Ga0307512_10015720 3300030522 Bacteria 7004
133 Ga0316176_1085110 3300030732 Bacteria 7546
134 Ga0307513_10108409 3300031456 Bacteria 2778
135 Ga0307408_100032823 3300031548 Bacteria 3622
136 Ga0316575_10000005 3300031665 Bacteria 88266
137 Ga0307405_10005764 3300031731 Bacteria 6022
138 Ga0307405_10061315 3300031731 Bacteria 2377
139 Ga0307405_10254187 3300031731 Bacteria 1309
140 Ga0307413_10000815 3300031824 Bacteria 10889
141 Ga0307518_10000616 3300031838 Bacteria 26780
142 Ga0307410_10018898 3300031852 Bacteria 4177
143 Ga0307410_10029822 3300031852 Bacteria 3479
144 Ga0307410_10349017 3300031852 Bacteria 1182
145 Ga0307406_10037712 3300031901 Bacteria 2987
146 Ga0307406_10077375 3300031901 Bacteria 2201
147 Ga0307406_10233844 3300031901 Bacteria 1374
148 Ga0307407_10006749 3300031903 Bacteria 5136
149 Ga0307407_10023800 3300031903 Bacteria 3201
150 Ga0307407_10182226 3300031903 Bacteria 1393
151 Ga0307407_10221060 3300031903 Bacteria 1281
152 Ga0307409_100214593 3300031995 Bacteria 1732
153 Ga0307409_100389699 3300031995 Bacteria 1327
154 Ga0307416_100021850 3300032002 Bacteria 4604
155 Ga0307416_100029305 3300032002 Bacteria 4109
156 Ga0307416_100034122 3300032002 Bacteria 3868
157 Ga0307416_100081021 3300032002 Bacteria 2743
158 Ga0307416_100254669 3300032002 Bacteria 1711
159 Ga0307414_10212121 3300032004 Bacteria 1583
160 Ga0307411_10024035 3300032005 Bacteria 3624
161 Ga0307415_100005064 3300032126 Bacteria 6937
162 Ga0307415_100005858 3300032126 Bacteria 6571
163 Ga0307415_100044601 3300032126 Bacteria 2966
164 Ga0307415_100136995 3300032126 Bacteria 1863
165 Ga0307415_100205496 3300032126 Bacteria 1566
166 Ga0307415_100346462 3300032126 Bacteria 1249
167 Ga0307507_10048792 3300033179 Bacteria 4113
168 Ga0373926_0037502 3300035083 Bacteria 1724
169 Ga0373923_0174113 3300035111 Bacteria 987
170 Ga0373945_0125436 3300035116 Bacteria 1024
171 Ga0316574_0235614 3300035398 Bacteria 1171
172 Ga0373935_0005046 3300035692 Bacteria 7776
173 Ga0373927_0177563 3300035695 Bacteria 1396
174 Ga0373947_0000012 3300035725 Bacteria 155188
175 Ga0373925_0008882 3300037068 Bacteria 7323
176 Ga0395900_0058325 3300037418 Bacteria 3974
177 Ga0395900_0265206 3300037418 Bacteria 1714
178 Ga0395900_0365333 3300037418 Bacteria 1414
179 Ga0395900_0592746 3300037418 Bacteria 1049
180 Ga0395898_0048912 3300037466 Bacteria 4145
181 Ga0395898_0139902 3300037466 Bacteria 2317
182 Ga0395901_0019198 3300038443 Bacteria 6989
183 Ga0395901_0131840 3300038443 Bacteria 2626
184 Ga0395901_0137974 3300038443 Bacteria 2563
185 Ga0395901_0368837 3300038443 Bacteria 1479
186 Ga0400485_12971 3300038735 Bacteria 36771
187 Ga0400486_16210 3300038742 Bacteria 35753
188 Ga0451789_0547912 3300041443 Bacteria 1764
189 Ga0451795_1363179 3300041456 Bacteria 2952
190 Ga0451833_1382903 3300041491 Bacteria 1673
191 Ga0451843_0309423 3300041509 Bacteria 1420
192 Ga0451853_2526805 3300041512 Bacteria 3782
193 Ga0439448_0006504 3300042005 Bacteria 3364
194 Ga0439448_0028820 3300042005 Bacteria 1755
195 Ga0439448_0035959 3300042005 Bacteria 1587
196 Ga0439448_0037342 3300042005 Bacteria 1560
197 Ga0439450_000808 3300042008 Bacteria 4304
198 Ga0439451_015407 3300042009 Bacteria 1541
199 Ga0439463_013221 3300042016 Bacteria 2031
200 Ga0439460_0000674 3300042461 Bacteria 7532
201 Ga0439440_0014577 3300042993 Bacteria 1698
202 Ga0466965_0000347 3300044683 Bacteria 15673
203 Ga0466965_0031207 3300044683 Bacteria 2598
204 Ga0466965_0108508 3300044683 Bacteria 1425
205 Ga0466968_0018528 3300044735 Bacteria 2793
206 Ga0466970_0002090 3300044765 Bacteria 9652
207 Ga0466970_0004938 3300044765 Bacteria 6587
208 Ga0466967_0051845 3300045976 Bacteria 3598
209 Ga0495662_0018712 3300046476 Bacteria 3354
210 Ga0495640_0033540 3300046533 Bacteria 3646
211 Ga0495659_0072943 3300046664 Bacteria 1290
212 Ga0495613_0241739 3300046689 Bacteria 1262
213 Ga0495672_0064100 3300047320 Bacteria 2105
214 Ga0496102_0056959 3300048905 Bacteria 3567
215 Ga0496102_0101052 3300048905 Bacteria 2679
216 Ga0496102_0280594 3300048905 Bacteria 1570
217 Ga0496104_0073254 3300048907 Bacteria 3258
218 Ga0496105_0032590 3300048908 Bacteria 4278
219 Ga0496105_0117864 3300048908 Bacteria 2190
220 Ga0496105_0273072 3300048908 Bacteria 1365
221 Ga0496105_0381227 3300048908 Bacteria 1122
222 Ga0496106_0316223 3300048909 Bacteria 1253
223 Ga0496107_0081688 3300048910 Bacteria 2357
224 Ga0496107_0199860 3300048910 Bacteria 1486
225 Ga0496107_0403095 3300048910 Bacteria 1017
226 Ga0496108_0023422 3300048911 Bacteria 5082
227 Ga0496108_0106388 3300048911 Bacteria 2395
228 Ga0496108_0179364 3300048911 Bacteria 1834
229 Ga0496109_0059012 3300048912 Bacteria 3505
230 Ga0496109_0074796 3300048912 Bacteria 3114
231 Ga0496110_0029044 3300048913 Bacteria 4754
232 Ga0496111_0002757 3300048914 Bacteria 10687
233 Ga0496112_0018754 3300048915 Bacteria 6521
234 Ga0496112_0038669 3300048915 Bacteria 4659
235 Ga0496112_0180232 3300048915 Bacteria 2076
236 Ga0496113_0006981 3300048916 Bacteria 7221
237 Ga0496114_0005708 3300048917 Bacteria 9759
238 Ga0496115_0117352 3300048918 Bacteria 2189
239 Ga0501031_0003204 3300049568 Bacteria 10503
240 Ga0501031_0020495 3300049568 Bacteria 4311
241 Ga0501031_0036058 3300049568 Bacteria 3226
242 Ga0501031_0113694 3300049568 Bacteria 1768
243 Ga0501032_0021406 3300049569 Bacteria 4495
244 Ga0501033_0028225 3300049570 Bacteria 4218
245 Ga0501033_0028442 3300049570 Bacteria 4199
246 Ga0501033_0157035 3300049570 Bacteria 1639
247 Ga0501036_0044387 3300049572 Bacteria 3765
248 Ga0501036_0108605 3300049572 Bacteria 2345
249 Ga0501036_0118613 3300049572 Bacteria 2234
250 Ga0501037_0016124 3300049573 Bacteria 5500
251 Ga0501037_0030888 3300049573 Bacteria 3957
252 Ga0501037_0117914 3300049573 Bacteria 1910
253 Ga0501038_0002126 3300049574 Bacteria 18378
254 Ga0501039_0006814 3300049575 Bacteria 8692
255 Ga0501039_0029641 3300049575 Bacteria 4215
256 Ga0501039_0094829 3300049575 Bacteria 2326
257 Ga0501040_0001273 3300049576 Bacteria 16024
258 Ga0501040_0034851 3300049576 Bacteria 3411
259 Ga0501040_0051870 3300049576 Bacteria 2806
260 Ga0501040_0056970 3300049576 Bacteria 2682
261 Ga0501041_0007374 3300049577 Bacteria 6458
262 Ga0501041_0028108 3300049577 Bacteria 3391
263 Ga0501042_0000623 3300049578 Bacteria 18899
264 Ga0501042_0004743 3300049578 Bacteria 8679
265 Ga0501042_0091769 3300049578 Bacteria 2180
266 Ga0501042_0099925 3300049578 Bacteria 2086
267 Ga0501042_0258497 3300049578 Bacteria 1257
268 Ga0501043_0074848 3300049579 Bacteria 2660
269 Ga0501043_0093423 3300049579 Bacteria 2365
270 Ga0501046_0011317 3300049580 Bacteria 7634
271 Ga0501046_0014014 3300049580 Bacteria 6771
272 Ga0501046_0030017 3300049580 Bacteria 4416
273 Ga0501046_0099490 3300049580 Bacteria 2232
274 Ga0501047_0151805 3300049581 Bacteria 2192
275 Ga0501047_0296397 3300049581 Bacteria 1460
276 Ga0501048_0000383 3300049582 Bacteria 30700
277 Ga0501048_0048603 3300049582 Bacteria 3025
278 Ga0501048_0058055 3300049582 Bacteria 2744
279 Ga0501048_0198228 3300049582 Bacteria 1423
280 Ga0501048_0277004 3300049582 Bacteria 1193
281 Ga0501070_0032877 3300049586 Bacteria 4339
282 Ga0501070_0078810 3300049586 Bacteria 2726
283 Ga0501071_0029077 3300049587 Bacteria 3898
284 Ga0501071_0065666 3300049587 Bacteria 2635
285 Ga0501072_0006220 3300049588 Bacteria 9092
286 Ga0501072_0021471 3300049588 Bacteria 5006
287 Ga0501072_0078479 3300049588 Bacteria 2614
288 Ga0501073_0311220 3300049589 Bacteria 1086
289 Ga0501074_0009676 3300049590 Bacteria 6999
290 Ga0501074_0010034 3300049590 Bacteria 6874
291 Ga0501074_0136427 3300049590 Bacteria 1755
292 Ga0501075_0008280 3300049591 Bacteria 7247
293 Ga0501075_0019410 3300049591 Bacteria 4931
294 Ga0501075_0022384 3300049591 Bacteria 4616
295 Ga0501075_0124741 3300049591 Bacteria 1960
296 Ga0501075_0127499 3300049591 Bacteria 1938
297 Ga0501076_0000311 3300049592 Bacteria 30285
298 Ga0501076_0013991 3300049592 Bacteria 6029
299 Ga0501076_0018178 3300049592 Bacteria 5354
300 Ga0501076_0051118 3300049592 Bacteria 3271
301 Ga0501077_0001132 3300049593 Bacteria 16096
302 Ga0501077_0073460 3300049593 Bacteria 2167
303 Ga0501077_0121231 3300049593 Bacteria 1657
304 Ga0501079_0012814 3300049741 Bacteria 6401
305 Ga0501079_0017411 3300049741 Bacteria 5488
306 Ga0501079_0053745 3300049741 Bacteria 3107
307 Ga0501080_0040470 3300049742 Bacteria 4347
308 Ga0501080_0125763 3300049742 Bacteria 2375
309 Ga0501080_0533541 3300049742 Bacteria 1046
310 Ga0501081_0084891 3300049743 Bacteria 2221
311 Ga0501035_0293114 3300049822 Bacteria 1373
312 Ga0501045_0000265 3300049824 Bacteria 30446
313 Ga0501045_0087769 3300049824 Bacteria 2297
314 nmdc:mga0yw44_132368_c1 3300050492 Bacteria 1615
315 nmdc:mga0yw44_14822_c1 3300050492 Bacteria 4153
316 nmdc:mga0yw44_154411_c1 3300050492 Bacteria 1499
317 nmdc:mga0yw44_251610_c1 3300050492 Bacteria 1176
318 nmdc:mga06z11_23220_c1 3300050494 Bacteria 2910
319 nmdc:mga07m45_4446_c1 3300050496 Bacteria 6861
320 nmdc:mga05p37_16381_c1 3300050507 Bacteria 8929
321 nmdc:mga05p37_255859_c1 3300050507 Bacteria 2098
322 nmdc:mga05p37_2751_c1 3300050507 Bacteria 20441
323 nmdc:mga05p37_2907_c1 3300050507 Bacteria 19878
324 nmdc:mga05p37_40418_c1 3300050507 Bacteria 5728
325 nmdc:mga05p37_7251_c1 3300050507 Bacteria 13078
326 nmdc:mga09592_12092_c1 3300050508 Bacteria 7025
327 nmdc:mga09592_194741_c1 3300050508 Bacteria 1755
328 nmdc:mga09592_212397_c1 3300050508 Bacteria 1677
329 nmdc:mga09592_249_c1 3300050508 Bacteria 39234
330 nmdc:mga0qj67_108705_c1 3300050509 Bacteria 2238
331 nmdc:mga0qj67_201153_c1 3300050509 Bacteria 1619
332 nmdc:mga0qj67_314537_c1 3300050509 Bacteria 1268
333 nmdc:mga0qj67_3175_c1 3300050509 Bacteria 11837
334 nmdc:mga0qj67_3370_c1 3300050509 Bacteria 11525
335 nmdc:mga0qj67_53188_c1 3300050509 Bacteria 3205
336 nmdc:mga06r32_151507_c1 3300050510 Bacteria 2298
337 nmdc:mga06r32_224011_c1 3300050510 Bacteria 1869
338 nmdc:mga06r32_266_c1 3300050510 Bacteria 43245
339 nmdc:mga06r32_335184_c1 3300050510 Bacteria 1498
340 nmdc:mga06r32_509968_c1 3300050510 Bacteria 1179
341 nmdc:mga06r32_535906_c1 3300050510 Bacteria 1146
342 nmdc:mga06r32_82547_c1 3300050510 Bacteria 3131
343 nmdc:mga06r32_9643_c1 3300050510 Bacteria 8721
344 nmdc:mga08y16_30501_c1 3300050511 Bacteria 5675
345 nmdc:mga08y16_4862_c1 3300050511 Bacteria 14028
346 nmdc:mga08y16_583089_c1 3300050511 Bacteria 1129
347 nmdc:mga08y16_60135_c1 3300050511 Bacteria 3969
348 nmdc:mga08y16_68022_c1 3300050511 Bacteria 3715
349 nmdc:mga0n895_119797_c1 3300050512 Bacteria 2653
350 nmdc:mga0n895_641667_c1 3300050512 Bacteria 1061
351 nmdc:mga0a205_11926_c1 3300050515 Bacteria 8025
352 nmdc:mga0a205_1691_c1 3300050515 Bacteria 19053
353 nmdc:mga0a205_257692_c1 3300050515 Bacteria 1622
354 Ga0495601_0021556 3300053077 Bacteria 3947
355 Ga0500644_0036951 3300053088 Bacteria 1593
356 Ga0500641_0003952 3300053096 Bacteria 5240
357 Ga0500593_000432 3300053117 Bacteria 16544
358 Ga0500589_053221 3300053147 Bacteria 1874
359 Ga0501084_0002430 3300054114 Bacteria 14996
360 Ga0501084_0003951 3300054114 Bacteria 12076
361 Ga0501084_0097038 3300054114 Bacteria 2475
362 Ga0590071_011489 3300059421 Bacteria 2072
363 Ga0590074_011253 3300059423 Bacteria 1499
364 Ga0590077_001910 3300059426 Bacteria 4607
365 Ga0501082_0031421 3300060353 Bacteria 4578
366 Ga0501082_0060919 3300060353 Bacteria 3249
367 Ga0501082_0068050 3300060353 Bacteria 3067
368 Ga0501082_0163009 3300060353 Bacteria 1937
369 Ga0530510_0006516 3300061734 Bacteria 8129
370 Ga0530510_0007211 3300061734 Bacteria 7736
371 Ga0530510_0011978 3300061734 Bacteria 6084
372 Ga0530510_0033135 3300061734 Bacteria 3719
373 2515852722 2515154155 Bacteria 7985436
374 2583151921 2582580736 Bacteria 5325865
375 2586057693 2585427649 Bacteria 9053857
376 2643826582 2643221561 Bacteria 4984412
377 2644089025 2643221615 Bacteria 5487866
378 2644318870 2643221657 Bacteria 5490246
379 2644505212 2643221690 Bacteria 4654705
380 2644535618 2643221696 Bacteria 5431823
381 2645722294 2643221961 Bacteria 3919167
382 2645725172 2643221962 Bacteria 3874254
383 2676477864 2675903058 Bacteria 6822861
384 2676484200 2675903059 Bacteria 8644972
385 2739240369 2738543011 Bacteria 5731169
386 2795780575 2795385470 Bacteria 8317180
387 2795792235 2795385472 Bacteria 6627535
388 2809585861 2808606522 Bacteria 9488490
389 2827629188 2827628540 Bacteria 6858585
390 2837274305 2837268691 Bacteria 7850704
391 2839987287 2839986021 Bacteria 3685650
392 2855387116 2855386786 Bacteria 4752232
393 2861520831 2861520306 Bacteria 8348283
394 2866616397 2866612099 Bacteria 7543886
395 2873155139 2873151551 Bacteria 8625867
396 2887484897 2887478801 Bacteria 8972725
397 2889303494 2889300758 Bacteria 5690814
398 2891328540 2891326441 Bacteria 6439512
399 2899373638 2899370129 Bacteria 6781179
400 2915771380 2915768154 Bacteria 8424322
401 2935392828 2935390628 Bacteria 7043367
402 2939748669 2939743619 Bacteria 5762299
403 3003008771 3002998708 Bacteria 11715108
404 8001783432 8001781756 Bacteria 9586736
405 8033688546 8033684223 Bacteria 6906479
406 Ga0081455_10077510
407 JGI25406J46586_10008345
408 JGI25406J46586_10018909
409 JGI25407J50210_10000456
410 JGI25407J50210_10029966
411 Ga0070683_100419339
412 Ga0070660_100477412
413 Ga0070689_100117375
414 Ga0070687_100024610
415 Ga0070671_100046746
416 Ga0070674_100335919
417 Ga0070667_100156754
418 Ga0070710_10000276
419 Ga0070705_100062939
420 Ga0070700_100095305
421 Ga0070685_10003920
422 Ga0070707_100004796
423 Ga0070672_100294103
424 Ga0070664_100186181
425 Ga0068852_100218136
426 Ga0068870_10009153
427 Ga0068863_100027886
428 Ga0081455_10000154
429 Ga0081455_10000318
430 Ga0081455_10000549
431 Ga0081455_10000578
432 Ga0081455_10002089
433 Ga0081455_10024877
434 Ga0081538_10000848
435 Ga0081538_10001797
436 Ga0081538_10003281
437 Ga0081538_10007921
438 Ga0081538_10009312
439 Ga0081538_10010203
440 Ga0081538_10017982
441 Ga0081538_10028642
442 Ga0081538_10032557
443 Ga0081538_10033565
444 Ga0081538_10035581
445 Ga0081538_10059160
446 Ga0081538_10128064
447 Ga0081539_10000116
448 Ga0081539_10000769
449 Ga0081539_10010634
450 Ga0081539_10144286
451 Ga0075365_10007484
452 Ga0075365_10037167
453 Ga0075365_10044765
454 Ga0075365_10115916
455 Ga0075365_10219751
456 Ga0075363_100014656
457 Ga0075364_10022447
458 Ga0075432_10000306
459 Ga0070716_100026515
460 Ga0075367_10086442
461 Ga0075370_10026682
462 Ga0075370_10037512
463 Ga0075428_100008842
464 Ga0075428_100056107
465 Ga0075428_100081950
466 Ga0075428_100126406
467 Ga0075428_100165780
468 Ga0075430_100002021
469 Ga0075430_100038040
470 Ga0075430_100040122
471 Ga0075430_100053045
472 Ga0075430_100337586
473 Ga0075430_100345418
474 Ga0075431_100004645
475 Ga0075431_100004705
476 Ga0075431_100022237
477 Ga0075431_100061944
478 Ga0075433_10027141
479 Ga0075433_10042725
480 Ga0075433_10171551
481 Ga0075434_100074594
482 Ga0075434_100710081
483 Ga0075429_100016734
484 Ga0075429_100035256
485 Ga0075429_100083123
486 Ga0075429_100244763
487 Ga0111539_10005663
488 Ga0111539_10010490
489 Ga0111539_10068834
490 Ga0111539_10204674
491 Ga0111539_10459175
492 Ga0114129_10000469
493 Ga0114129_10003869
494 Ga0114129_10004236
495 Ga0114129_10014985
496 Ga0114129_10038323
497 Ga0114129_10068734
498 Ga0105243_10082234
499 Ga0105243_10319094
500 Ga0105242_10099806
501 Ga0105242_10193751
502 Ga0105239_10759000
503 Ga0163162_10022551
504 Ga0163162_10046424
505 Ga0157372_10252881
506 Ga0157375_10007341
507 Ga0163163_10066475
508 Ga0207699_10085282
509 Ga0207643_10046580
510 Ga0207693_10009441
511 Ga0207660_10193621
512 Ga0207646_10383194
513 Ga0207700_10068218
514 Ga0207644_10063436
515 Ga0207709_10000403
516 Ga0207709_10193516
517 Ga0207669_10211771
518 Ga0207704_10054367
519 Ga0207665_10003309
520 Ga0207711_10247249
521 Ga0207661_10416461
522 Ga0207640_10135262
523 Ga0207703_10333805
524 Ga0207678_10060237
525 Ga0207708_10006572
526 Ga0207702_10144039
527 Ga0207641_10030229
528 Ga0207676_10070054
529 Ga0207675_100041049
530 Ga0207683_10040303
531 Ga0207428_10001795
532 Ga0207428_10002393
533 Ga0207428_10007533
534 Ga0207428_10081083
535 Ga0268266_10143916
536 Ga0307515_10015066
537 Ga0307512_10015720
538 Ga0316176_1085110
539 Ga0307513_10108409
540 Ga0307408_100032823
541 Ga0316575_10000005
542 Ga0307405_10005764
543 Ga0307405_10061315
544 Ga0307405_10254187
545 Ga0307413_10000815
546 Ga0307518_10000616
547 Ga0307410_10018898
548 Ga0307410_10029822
549 Ga0307410_10349017
550 Ga0307406_10037712
551 Ga0307406_10077375
552 Ga0307406_10233844
553 Ga0307407_10006749
554 Ga0307407_10023800
555 Ga0307407_10182226
556 Ga0307407_10221060
557 Ga0307409_100214593
558 Ga0307409_100389699
559 Ga0307416_100021850
560 Ga0307416_100029305
561 Ga0307416_100034122
562 Ga0307416_100081021
563 Ga0307416_100254669
564 Ga0307414_10212121
565 Ga0307411_10024035
566 Ga0307415_100005064
567 Ga0307415_100005858
568 Ga0307415_100044601
569 Ga0307415_100136995
570 Ga0307415_100205496
571 Ga0307415_100346462
572 Ga0307507_10048792
573 Ga0373926_0037502
574 Ga0373923_0174113
575 Ga0373945_0125436
576 Ga0316574_0235614
577 Ga0373935_0005046
578 Ga0373927_0177563
579 Ga0373947_0000012
580 Ga0373925_0008882
581 Ga0395900_0058325
582 Ga0395900_0265206
583 Ga0395900_0365333
584 Ga0395900_0592746
585 Ga0395898_0048912
586 Ga0395898_0139902
587 Ga0395901_0019198
588 Ga0395901_0131840
589 Ga0395901_0137974
590 Ga0395901_0368837
591 Ga0400485_12971
592 Ga0400486_16210
593 Ga0451789_0547912
594 Ga0451795_1363179
595 Ga0451833_1382903
596 Ga0451843_0309423
597 Ga0451853_2526805
598 Ga0439448_0006504
599 Ga0439448_0028820
600 Ga0439448_0035959
601 Ga0439448_0037342
602 Ga0439450_000808
603 Ga0439451_015407
604 Ga0439463_013221
605 Ga0439460_0000674
606 Ga0439440_0014577
607 Ga0466965_0000347
608 Ga0466965_0031207
609 Ga0466965_0108508
610 Ga0466968_0018528
611 Ga0466970_0002090
612 Ga0466970_0004938
613 Ga0466967_0051845
614 Ga0495662_0018712
615 Ga0495640_0033540
616 Ga0495659_0072943
617 Ga0495613_0241739
618 Ga0495672_0064100
619 Ga0496102_0056959
620 Ga0496102_0101052
621 Ga0496102_0280594
622 Ga0496104_0073254
623 Ga0496105_0032590
624 Ga0496105_0117864
625 Ga0496105_0273072
626 Ga0496105_0381227
627 Ga0496106_0316223
628 Ga0496107_0081688
629 Ga0496107_0199860
630 Ga0496107_0403095
631 Ga0496108_0023422
632 Ga0496108_0106388
633 Ga0496108_0179364
634 Ga0496109_0059012
635 Ga0496109_0074796
636 Ga0496110_0029044
637 Ga0496111_0002757
638 Ga0496112_0018754
639 Ga0496112_0038669
640 Ga0496112_0180232
641 Ga0496113_0006981
642 Ga0496114_0005708
643 Ga0496115_0117352
644 Ga0501031_0003204
645 Ga0501031_0020495
646 Ga0501031_0036058
647 Ga0501031_0113694
648 Ga0501032_0021406
649 Ga0501033_0028225
650 Ga0501033_0028442
651 Ga0501033_0157035
652 Ga0501036_0044387
653 Ga0501036_0108605
654 Ga0501036_0118613
655 Ga0501037_0016124
656 Ga0501037_0030888
657 Ga0501037_0117914
658 Ga0501038_0002126
659 Ga0501039_0006814
660 Ga0501039_0029641
661 Ga0501039_0094829
662 Ga0501040_0001273
663 Ga0501040_0034851
664 Ga0501040_0051870
665 Ga0501040_0056970
666 Ga0501041_0007374
667 Ga0501041_0028108
668 Ga0501042_0000623
669 Ga0501042_0004743
670 Ga0501042_0091769
671 Ga0501042_0099925
672 Ga0501042_0258497
673 Ga0501043_0074848
674 Ga0501043_0093423
675 Ga0501046_0011317
676 Ga0501046_0014014
677 Ga0501046_0030017
678 Ga0501046_0099490
679 Ga0501047_0151805
680 Ga0501047_0296397
681 Ga0501048_0000383
682 Ga0501048_0048603
683 Ga0501048_0058055
684 Ga0501048_0198228
685 Ga0501048_0277004
686 Ga0501070_0032877
687 Ga0501070_0078810
688 Ga0501071_0029077
689 Ga0501071_0065666
690 Ga0501072_0006220
691 Ga0501072_0021471
692 Ga0501072_0078479
693 Ga0501073_0311220
694 Ga0501074_0009676
695 Ga0501074_0010034
696 Ga0501074_0136427
697 Ga0501075_0008280
698 Ga0501075_0019410
699 Ga0501075_0022384
700 Ga0501075_0124741
701 Ga0501075_0127499
702 Ga0501076_0000311
703 Ga0501076_0013991
704 Ga0501076_0018178
705 Ga0501076_0051118
706 Ga0501077_0001132
707 Ga0501077_0073460
708 Ga0501077_0121231
709 Ga0501079_0012814
710 Ga0501079_0017411
711 Ga0501079_0053745
712 Ga0501080_0040470
713 Ga0501080_0125763
714 Ga0501080_0533541
715 Ga0501081_0084891
716 Ga0501035_0293114
717 Ga0501045_0000265
718 Ga0501045_0087769
719 nmdc:mga0yw44_132368_c1
720 nmdc:mga0yw44_14822_c1
721 nmdc:mga0yw44_154411_c1
722 nmdc:mga0yw44_251610_c1
723 nmdc:mga06z11_23220_c1
724 nmdc:mga07m45_4446_c1
725 nmdc:mga05p37_16381_c1
726 nmdc:mga05p37_255859_c1
727 nmdc:mga05p37_2751_c1
728 nmdc:mga05p37_2907_c1
729 nmdc:mga05p37_40418_c1
730 nmdc:mga05p37_7251_c1
731 nmdc:mga09592_12092_c1
732 nmdc:mga09592_194741_c1
733 nmdc:mga09592_212397_c1
734 nmdc:mga09592_249_c1
735 nmdc:mga0qj67_108705_c1
736 nmdc:mga0qj67_201153_c1
737 nmdc:mga0qj67_314537_c1
738 nmdc:mga0qj67_3175_c1
739 nmdc:mga0qj67_3370_c1
740 nmdc:mga0qj67_53188_c1
741 nmdc:mga06r32_151507_c1
742 nmdc:mga06r32_224011_c1
743 nmdc:mga06r32_266_c1
744 nmdc:mga06r32_335184_c1
745 nmdc:mga06r32_509968_c1
746 nmdc:mga06r32_535906_c1
747 nmdc:mga06r32_82547_c1
748 nmdc:mga06r32_9643_c1
749 nmdc:mga08y16_30501_c1
750 nmdc:mga08y16_4862_c1
751 nmdc:mga08y16_583089_c1
752 nmdc:mga08y16_60135_c1
753 nmdc:mga08y16_68022_c1
754 nmdc:mga0n895_119797_c1
755 nmdc:mga0n895_641667_c1
756 nmdc:mga0a205_11926_c1
757 nmdc:mga0a205_1691_c1
758 nmdc:mga0a205_257692_c1
759 Ga0495601_0021556
760 Ga0500644_0036951
761 Ga0500641_0003952
762 Ga0500593_000432
763 Ga0500589_053221
764 Ga0501084_0002430
765 Ga0501084_0003951
766 Ga0501084_0097038
767 Ga0590071_011489
768 Ga0590074_011253
769 Ga0590077_001910
770 Ga0501082_0031421
771 Ga0501082_0060919
772 Ga0501082_0068050
773 Ga0501082_0163009
774 Ga0530510_0006516
775 Ga0530510_0007211
776 Ga0530510_0011978
777 Ga0530510_0033135
778 2515852722
779 2583151921
780 2586057693
781 2643826582
782 2644089025
783 2644318870
784 2644505212
785 2644535618
786 2645722294
787 2645725172
788 2676477864
789 2676484200
790 2739240369
791 2795780575
792 2795792235
793 2809585861
794 2827629188
795 2837274305
796 2839987287
797 2855387116
798 2861520831
799 2866616397
800 2873155139
801 2887484897
802 2889303494
803 2891328540
804 2899373638
805 2915771380
806 2935392828
807 2939748669
808 3003008771
809 8001783432
810 8033688546

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

41

180

0.94

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

130

215

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rvc-assembly1.cif.gz_A structure of atp binding subunit of abc transporter 0.9092 3 220
8eop-assembly1.cif.gz_A cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state 0.8914 4 219
7ch0-assembly1.cif.gz_E the overall structure of the mlafedb complex in atp-bound eqclose conformation (mutation of e170q on mlaf) 0.8867 1 217
6xgz-assembly4.cif.gz_G crystal structure of e. coli mlafb abc transport subunits in the monomeric state 0.8801 1 219
8bms-assembly1.cif.gz_B cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation 0.8782 4 217
ID Description Score Start End Superfamily
af_O86311_2_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9541 3 222 3.40.50.300
af_O53149_2_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9111 2 220 3.40.50.300
4rvcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9092 3 220 3.40.50.300
af_E7F3Y5_15_267_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9027 1 221 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8992 1 217 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A258H969-F1-model_v4 ABC transporter ATP-binding protein 0.9445 5 220 GO:0005524
GO:0016887
AF-A0A800BAR4-F1-model_v4 deleted 0.9168 2 220
AF-S2QSM0-F1-model_v4 ABC transporter ATP-binding protein 0.9154 25 215 GO:0005524
GO:0016887
AF-A0A2N5N442-F1-model_v4 ABC transporter, ATP-binding protein EcsA 0.9153 2 218 GO:0005524
GO:0016887
AF-A0A1G6BNS4-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9152 5 217 GO:0005524
GO:0016887

Map