F435682

General Info

Members Datasets Scaffolds Average Seq Length
404 257 808 178

Family's Representative Sequence

Representative Sequence 3300025905|Ga0207685_10046877|Ga0207685_100468773
Length 210
Sequence MYHELRKRGTRTRRGPLTPFKAGRKPFGDHRSPNLRRRYLMHRTPAIIALTTLALAGCTGADLPSQPSFYQSLAAPNAEVDAAAAQSMISGYRKNNGLGPVAVDPALMRLAGEQSRAMAQRDKLDHNAARSFTDRIRSAGFPVKAAVENVGAGYHTLAEAFSGWRDSPPHRANMLKPGVTRMGIAAVYAPNSKYKVFWTLIMASPDDREG

Samples

Sample ID Description Type Environment
1 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
116 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
117 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
124 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
125 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
126 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
127 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
128 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
129 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
131 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
132 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
136 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
137 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
158 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
159 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
160 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
161 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
162 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
182 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
183 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
184 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
239 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
240 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
249 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
250 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
251 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
254 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.97
Nodule 0.25
Rhizoplane 7.43
Rhizosphere 89.11
Stem 0
Stem Tuber 0
Unclassified 1.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207685_10046877 3300025905 Bacteria 1647
2 Ga0065715_10509561 3300005293 Bacteria 772
3 Ga0070676_10143618 3300005328 Bacteria 1522
4 Ga0070690_100136867 3300005330 Bacteria 1659
5 Ga0070670_100267276 3300005331 Bacteria 1492
6 Ga0070689_100027863 3300005340 Bacteria 4263
7 Ga0070661_100070586 3300005344 Bacteria 2569
8 Ga0070669_100024530 3300005353 Bacteria 4323
9 Ga0070669_100461011 3300005353 Bacteria 1049
10 Ga0070671_100276446 3300005355 Bacteria 1428
11 Ga0070671_100279906 3300005355 Bacteria 1419
12 Ga0070674_100240905 3300005356 Bacteria 1416
13 Ga0070674_100397805 3300005356 Bacteria 1125
14 Ga0070673_100893236 3300005364 Bacteria 824
15 Ga0070659_100077073 3300005366 Bacteria 2658
16 Ga0070659_100756466 3300005366 Bacteria 843
17 Ga0070713_100164835 3300005436 Bacteria 1981
18 Ga0070713_100586872 3300005436 Bacteria 1058
19 Ga0070710_10128952 3300005437 Bacteria 1540
20 Ga0070710_10383641 3300005437 Bacteria 938
21 Ga0070711_100202878 3300005439 Bacteria 1531
22 Ga0070700_100265468 3300005441 Bacteria 1238
23 Ga0070708_100077027 3300005445 Bacteria 3013
24 Ga0070663_100576775 3300005455 Bacteria 943
25 Ga0070662_100057653 3300005457 Bacteria 2823
26 Ga0070662_100841552 3300005457 Bacteria 781
27 Ga0068867_100608892 3300005459 Bacteria 954
28 Ga0070679_100396893 3300005530 Bacteria 1325
29 Ga0068853_100796901 3300005539 Bacteria 905
30 Ga0070672_100250781 3300005543 Bacteria 1491
31 Ga0070672_100334374 3300005543 Bacteria 1289
32 Ga0070686_100638744 3300005544 Bacteria 843
33 Ga0070665_100303472 3300005548 Bacteria 1600
34 Ga0070704_100471983 3300005549 Bacteria 1084
35 Ga0068855_100086862 3300005563 Bacteria 3616
36 Ga0070664_100217104 3300005564 Bacteria 1710
37 Ga0068857_100458981 3300005577 Bacteria 1192
38 Ga0068854_100057046 3300005578 Bacteria 2817
39 Ga0068856_100963247 3300005614 Bacteria 872
40 Ga0068859_100634504 3300005617 Bacteria 1161
41 Ga0068859_101590698 3300005617 Bacteria 722
42 Ga0068864_100027938 3300005618 Bacteria 4768
43 Ga0068864_100202559 3300005618 Bacteria 1824
44 Ga0068861_100397716 3300005719 Bacteria 1222
45 Ga0068861_101648582 3300005719 Bacteria 633
46 Ga0068870_10356867 3300005840 Bacteria 940
47 Ga0068863_100523738 3300005841 Bacteria 1169
48 Ga0068863_100568318 3300005841 Bacteria 1121
49 Ga0068860_100401277 3300005843 Bacteria 1356
50 Ga0068862_100769944 3300005844 Bacteria 938
51 Ga0081455_10001150 3300005937 Bacteria 33155
52 Ga0081455_10009694 3300005937 Bacteria 9879
53 Ga0081538_10017871 3300005981 Bacteria 5357
54 Ga0081540_1000612 3300005983 Bacteria 33991
55 Ga0070717_10601039 3300006028 Bacteria 998
56 Ga0070717_10810829 3300006028 Bacteria 851
57 Ga0075432_10172100 3300006058 Bacteria 843
58 Ga0070715_10056489 3300006163 Bacteria 1708
59 Ga0070715_10071888 3300006163 Bacteria 1547
60 Ga0070716_100551068 3300006173 Bacteria 860
61 Ga0070712_100060058 3300006175 Unclassified 2680
62 Ga0075367_10196562 3300006178 Bacteria 1260
63 Ga0097621_100303314 3300006237 Bacteria 1411
64 Ga0097621_100733393 3300006237 Bacteria 912
65 Ga0097621_101399014 3300006237 Bacteria 662
66 Ga0075370_10066342 3300006353 Bacteria 2059
67 Ga0075428_100099134 3300006844 Bacteria 3177
68 Ga0075430_100091908 3300006846 Bacteria 2538
69 Ga0075431_100471285 3300006847 Bacteria 1249
70 Ga0075433_10043343 3300006852 Bacteria 3905
71 Ga0075434_100010662 3300006871 Bacteria 8628
72 Ga0075434_100138548 3300006871 Bacteria 2453
73 Ga0075429_100102775 3300006880 Bacteria 2495
74 Ga0068865_100659867 3300006881 Bacteria 890
75 Ga0075436_100719986 3300006914 Bacteria 740
76 Ga0097620_100634546 3300006931 Bacteria 1161
77 Ga0097620_101590737 3300006931 Bacteria 722
78 Ga0099795_10000194 3300007788 Bacteria 10253
79 Ga0105240_10733513 3300009093 Bacteria 1075
80 Ga0111539_10078159 3300009094 Bacteria 3893
81 Ga0111539_10332491 3300009094 Bacteria 1768
82 Ga0105245_10180220 3300009098 Bacteria 2018
83 Ga0105247_10072274 3300009101 Bacteria 2159
84 Ga0114129_10140095 3300009147 Bacteria 3316
85 Ga0099796_10003325 3300010159 Bacteria 3711
86 Ga0105239_10487707 3300010375 Bacteria 1400
87 Ga0105239_11064159 3300010375 Bacteria 931
88 Ga0157370_10141954 3300013104 Bacteria 2238
89 Ga0157378_10128433 3300013297 Bacteria 2343
90 Ga0163162_10282786 3300013306 Bacteria 1791
91 Ga0157372_11549065 3300013307 Bacteria 763
92 Ga0163163_10003932 3300014325 Bacteria 12675
93 Ga0163163_10448306 3300014325 Bacteria 1350
94 Ga0163163_10576450 3300014325 Bacteria 1188
95 Ga0157380_10033401 3300014326 Bacteria 3961
96 Ga0157380_10479983 3300014326 Bacteria 1202
97 Ga0157380_10521673 3300014326 Bacteria 1159
98 Ga0209758_1001016 3300025297 Bacteria 37152
99 Ga0207642_10126108 3300025899 Bacteria 1328
100 Ga0207710_10249929 3300025900 Bacteria 886
101 Ga0207688_10095975 3300025901 Bacteria 1707
102 Ga0207645_10118412 3300025907 Bacteria 1718
103 Ga0207705_10093996 3300025909 Bacteria 2198
104 Ga0207693_10007481 3300025915 Bacteria 8981
105 Ga0207660_10282793 3300025917 Bacteria 1317
106 Ga0207657_10004349 3300025919 Bacteria 15004
107 Ga0207649_10500931 3300025920 Bacteria 924
108 Ga0207652_10128444 3300025921 Bacteria 2259
109 Ga0207652_10172127 3300025921 Bacteria 1943
110 Ga0207681_10007584 3300025923 Bacteria 6649
111 Ga0207681_10414580 3300025923 Bacteria 1090
112 Ga0207650_10271561 3300025925 Bacteria 1378
113 Ga0207650_10632360 3300025925 Bacteria 901
114 Ga0207700_10083592 3300025928 Bacteria 2500
115 Ga0207700_10144164 3300025928 Bacteria 1961
116 Ga0207700_10266709 3300025928 Bacteria 1468
117 Ga0207664_10067197 3300025929 Bacteria 2876
118 Ga0207644_10492150 3300025931 Bacteria 1011
119 Ga0207706_10075757 3300025933 Bacteria 2959
120 Ga0207706_10732094 3300025933 Bacteria 843
121 Ga0207686_10690197 3300025934 Bacteria 811
122 Ga0207709_10075547 3300025935 Bacteria 2154
123 Ga0207670_10165688 3300025936 Bacteria 1653
124 Ga0207669_10300941 3300025937 Bacteria 1219
125 Ga0207669_10353256 3300025937 Bacteria 1136
126 Ga0207665_10410390 3300025939 Bacteria 1033
127 Ga0207691_10292285 3300025940 Bacteria 1401
128 Ga0207691_10765928 3300025940 Bacteria 812
129 Ga0207711_10351703 3300025941 Bacteria 1364
130 Ga0207667_10143542 3300025949 Bacteria 2457
131 Ga0207668_10284659 3300025972 Bacteria 1357
132 Ga0207677_10713239 3300026023 Bacteria 891
133 Ga0207703_10123859 3300026035 Bacteria 2223
134 Ga0207639_10092780 3300026041 Bacteria 2420
135 Ga0207708_10083882 3300026075 Bacteria 2450
136 Ga0207708_10208634 3300026075 Bacteria 1561
137 Ga0207702_10575105 3300026078 Bacteria 1104
138 Ga0207641_10338147 3300026088 Bacteria 1432
139 Ga0207641_10916971 3300026088 Bacteria 870
140 Ga0207648_10056756 3300026089 Bacteria 3417
141 Ga0207676_10008703 3300026095 Bacteria 7218
142 Ga0207676_10323197 3300026095 Bacteria 1417
143 Ga0207683_10013277 3300026121 Bacteria 7022
144 Ga0207683_10044762 3300026121 Bacteria 3869
145 Ga0209179_1006757 3300027512 Bacteria 1865
146 Ga0207428_10039931 3300027907 Bacteria 3809
147 Ga0207428_10113797 3300027907 Bacteria 2079
148 Ga0268266_10121413 3300028379 Bacteria 2326
149 Ga0268266_10489535 3300028379 Bacteria 1173
150 Ga0268265_10107041 3300028380 Bacteria 2273
151 Ga0268264_10429626 3300028381 Bacteria 1275
152 Ga0265332_10000658 3300031238 Bacteria 22422
153 Ga0265325_10043254 3300031241 Bacteria 2351
154 Ga0265325_10080315 3300031241 Bacteria 1622
155 Ga0265325_10082264 3300031241 Bacteria 1598
156 Ga0265340_10035077 3300031247 Bacteria 2492
157 Ga0265340_10072824 3300031247 Bacteria 1626
158 Ga0265340_10126934 3300031247 Unclassified 1172
159 Ga0265339_10011086 3300031249 Bacteria 5565
160 Ga0265339_10159303 3300031249 Bacteria 1137
161 Ga0265331_10222385 3300031250 Bacteria 848
162 Ga0265316_10042057 3300031344 Bacteria 3654
163 Ga0265316_10128266 3300031344 Bacteria 1911
164 Ga0307408_101084215 3300031548 Bacteria 742
165 Ga0265314_10092167 3300031711 Bacteria 1970
166 Ga0265342_10000354 3300031712 Bacteria 51330
167 Ga0307416_100189044 3300032002 Bacteria 1940
168 Ga0373930_0012613 3300034816 Bacteria 1545
169 Ga0373930_0090504 3300034816 Bacteria 717
170 Ga0373958_0103063 3300034819 Bacteria 672
171 Ga0373938_0035973 3300034957 Bacteria 1082
172 Ga0373926_0115455 3300035083 Bacteria 1010
173 Ga0373926_0165838 3300035083 Bacteria 844
174 Ga0373940_0088642 3300035088 Bacteria 924
175 Ga0373952_0016503 3300035092 Bacteria 1503
176 Ga0373936_0010766 3300035113 Bacteria 3454
177 Ga0373941_0013702 3300035115 Bacteria 2150
178 Ga0373954_0078112 3300035118 Unclassified 1579
179 Ga0373960_0023542 3300035121 Bacteria 1659
180 Ga0373943_0000343 3300035170 Bacteria 19547
181 Ga0373943_0045190 3300035170 Bacteria 2146
182 Ga0373946_0021082 3300035171 Bacteria 2523
183 Ga0373946_0044028 3300035171 Bacteria 1842
184 Ga0373942_0015558 3300035207 Bacteria 1856
185 Ga0373961_0002362 3300035241 Bacteria 4925
186 Ga0373961_0038846 3300035241 Bacteria 1365
187 Ga0373924_0091986 3300035410 Bacteria 1299
188 Ga0373931_0002687 3300035691 Bacteria 7911
189 Ga0373931_0122860 3300035691 Bacteria 1486
190 Ga0373935_0005752 3300035692 Bacteria 7328
191 Ga0373935_0326782 3300035692 Bacteria 1089
192 Ga0373927_0012158 3300035695 Bacteria 5726
193 Ga0373927_0112855 3300035695 Unclassified 1771
194 Ga0373947_0000156 3300035725 Bacteria 36048
195 Ga0373947_0070107 3300035725 Bacteria 2147
196 Ga0373947_0320830 3300035725 Bacteria 1036
197 Ga0373937_0654232 3300036401 Bacteria 996
198 Ga0373925_0000628 3300037068 Bacteria 33530
199 Ga0373925_0064969 3300037068 Bacteria 2748
200 Ga0395900_0135032 3300037418 Bacteria 2527
201 Ga0395900_1399157 3300037418 Bacteria 612
202 Ga0395898_0172672 3300037466 Bacteria 2066
203 Ga0395901_0829517 3300038443 Bacteria 911
204 Ga0439441_071532 3300042001 Bacteria 745
205 Ga0466963_0238534 3300044694 Bacteria 1275
206 Ga0466957_0234020 3300044842 Bacteria 1217
207 Ga0495592_0202673 3300046454 Bacteria 1338
208 Ga0495603_0193749 3300046455 Bacteria 1175
209 Ga0495629_0027518 3300046459 Bacteria 4037
210 Ga0495629_0152834 3300046459 Bacteria 1604
211 Ga0495629_0845227 3300046459 Unclassified 602
212 Ga0495638_0016027 3300046460 Bacteria 5023
213 Ga0495638_0020575 3300046460 Bacteria 4358
214 Ga0495651_0110533 3300046462 Bacteria 2033
215 Ga0495653_0266510 3300046463 Bacteria 1130
216 Ga0495653_0656577 3300046463 Bacteria 640
217 Ga0495580_0003218 3300046472 Bacteria 13976
218 Ga0495580_0268759 3300046472 Bacteria 1165
219 Ga0495582_0036208 3300046473 Bacteria 2715
220 Ga0495582_0057946 3300046473 Bacteria 2136
221 Ga0495639_0012071 3300046475 Bacteria 3724
222 Ga0495639_0122353 3300046475 Unclassified 1242
223 Ga0495662_0035022 3300046476 Bacteria 2423
224 Ga0495664_0228219 3300046477 Bacteria 1127
225 Ga0495584_0058564 3300046491 Bacteria 1938
226 Ga0495584_0069194 3300046491 Bacteria 1774
227 Ga0495585_0292602 3300046492 Bacteria 802
228 Ga0495594_0524841 3300046499 Unclassified 672
229 Ga0495608_0163579 3300046511 Bacteria 1414
230 Ga0495618_0165494 3300046514 Bacteria 1408
231 Ga0495628_0093015 3300046516 Bacteria 2332
232 Ga0495630_0067506 3300046517 Bacteria 2688
233 Ga0495663_0114143 3300046525 Bacteria 900
234 Ga0495665_0023685 3300046531 Bacteria 3298
235 Ga0495665_0030485 3300046531 Bacteria 2887
236 Ga0495665_0220014 3300046531 Bacteria 982
237 Ga0495640_0270565 3300046533 Bacteria 1060
238 Ga0495609_0134668 3300046538 Bacteria 1057
239 Ga0495645_0235605 3300046543 Bacteria 1224
240 Ga0495656_0030601 3300046615 Bacteria 2177
241 Ga0495668_0080918 3300046616 Bacteria 1783
242 Ga0495634_0024063 3300046642 Bacteria 4276
243 Ga0495634_0188041 3300046642 Bacteria 1290
244 Ga0495635_0116656 3300046663 Bacteria 1822
245 Ga0495659_0029394 3300046664 Bacteria 1908
246 Ga0495658_0025079 3300046683 Bacteria 3184
247 Ga0495658_0378780 3300046683 Bacteria 901
248 Ga0495658_0561008 3300046683 Bacteria 731
249 Ga0495669_0394702 3300046684 Bacteria 670
250 Ga0495613_0013787 3300046689 Bacteria 5995
251 Ga0495624_0004184 3300046690 Bacteria 10606
252 Ga0495671_0316495 3300046692 Bacteria 750
253 Ga0495581_0012758 3300047315 Bacteria 4867
254 Ga0495581_0057556 3300047315 Bacteria 2243
255 Ga0495604_0299086 3300047317 Bacteria 1081
256 Ga0495676_0063902 3300047321 Bacteria 2866
257 Ga0495676_0681552 3300047321 Unclassified 666
258 Ga0495680_0777449 3300047322 Bacteria 627
259 Ga0495684_0001554 3300047471 Bacteria 18387
260 Ga0495593_0014241 3300047673 Bacteria 4522
261 Ga0496100_0016689 3300048903 Bacteria 4317
262 Ga0496100_0718283 3300048903 Bacteria 780
263 Ga0496101_0057376 3300048904 Bacteria 2816
264 Ga0496102_0010532 3300048905 Bacteria 7962
265 Ga0496103_0040577 3300048906 Bacteria 2860
266 Ga0496104_0079106 3300048907 Bacteria 3133
267 Ga0496104_0160514 3300048907 Bacteria 2156
268 Ga0496105_0005466 3300048908 Bacteria 9641
269 Ga0496105_0121686 3300048908 Bacteria 2152
270 Ga0496106_0014881 3300048909 Bacteria 5755
271 Ga0496106_0601245 3300048909 Bacteria 881
272 Ga0496107_0031775 3300048910 Bacteria 3769
273 Ga0496107_0363210 3300048910 Bacteria 1077
274 Ga0496107_0407540 3300048910 Bacteria 1011
275 Ga0496108_0017403 3300048911 Bacteria 5881
276 Ga0496108_0086436 3300048911 Bacteria 2662
277 Ga0496108_0327238 3300048911 Bacteria 1336
278 Ga0496109_0032050 3300048912 Bacteria 4721
279 Ga0496109_0315200 3300048912 Bacteria 1476
280 Ga0496109_0381055 3300048912 Bacteria 1332
281 Ga0496110_0018984 3300048913 Bacteria 5778
282 Ga0496110_0090747 3300048913 Bacteria 2732
283 Ga0496111_0021090 3300048914 Bacteria 4545
284 Ga0496111_0041799 3300048914 Bacteria 3291
285 Ga0496112_0130566 3300048915 Bacteria 2483
286 Ga0496112_0625370 3300048915 Bacteria 1007
287 Ga0496113_0024953 3300048916 Bacteria 4256
288 Ga0496113_0267050 3300048916 Bacteria 1367
289 Ga0496114_0003255 3300048917 Bacteria 12467
290 Ga0496114_0006114 3300048917 Bacteria 9472
291 Ga0496126_0928616 3300048929 Bacteria 658
292 Ga0501031_0118905 3300049568 Bacteria 1726
293 Ga0501032_0075755 3300049569 Bacteria 2240
294 Ga0501033_0052347 3300049570 Bacteria 3026
295 Ga0501033_0060378 3300049570 Bacteria 2797
296 Ga0501033_0464953 3300049570 Bacteria 877
297 Ga0501034_0030327 3300049571 Bacteria 5497
298 Ga0501034_0126475 3300049571 Bacteria 2541
299 Ga0501034_0420556 3300049571 Bacteria 1257
300 Ga0501034_0422283 3300049571 Bacteria 1254
301 Ga0501034_0482713 3300049571 Bacteria 1154
302 Ga0501036_0085523 3300049572 Bacteria 2666
303 Ga0501036_0215358 3300049572 Bacteria 1613
304 Ga0501036_0283410 3300049572 Bacteria 1386
305 Ga0501036_0714741 3300049572 Bacteria 827
306 Ga0501036_0791013 3300049572 Bacteria 781
307 Ga0501036_1147434 3300049572 Bacteria 634
308 Ga0501037_0029564 3300049573 Bacteria 4048
309 Ga0501037_0087008 3300049573 Bacteria 2261
310 Ga0501037_0110622 3300049573 Bacteria 1979
311 Ga0501038_0000630 3300049574 Bacteria 31329
312 Ga0501038_0020007 3300049574 Bacteria 6024
313 Ga0501038_0034493 3300049574 Bacteria 4448
314 Ga0501038_0099184 3300049574 Bacteria 2428
315 Ga0501038_0531460 3300049574 Bacteria 896
316 Ga0501039_0048542 3300049575 Bacteria 3281
317 Ga0501039_0059815 3300049575 Bacteria 2950
318 Ga0501039_0097910 3300049575 Bacteria 2288
319 Ga0501039_0323362 3300049575 Bacteria 1212
320 Ga0501040_0079686 3300049576 Bacteria 2267
321 Ga0501042_0014727 3300049578 Bacteria 5339
322 Ga0501043_0041530 3300049579 Bacteria 3614
323 Ga0501043_0060908 3300049579 Bacteria 2963
324 Ga0501043_0067449 3300049579 Bacteria 2809
325 Ga0501043_0091949 3300049579 Bacteria 2385
326 Ga0501043_0099370 3300049579 Bacteria 2287
327 Ga0501043_0101078 3300049579 Bacteria 2266
328 Ga0501043_0194198 3300049579 Bacteria 1578
329 Ga0501043_0279629 3300049579 Bacteria 1279
330 Ga0501046_0080608 3300049580 Bacteria 2515
331 Ga0501046_0906862 3300049580 Bacteria 614
332 Ga0501047_0026939 3300049581 Bacteria 5534
333 Ga0501047_0057626 3300049581 Bacteria 3756
334 Ga0501047_0141160 3300049581 Bacteria 2287
335 Ga0501047_0149216 3300049581 Bacteria 2214
336 Ga0501047_0176279 3300049581 Bacteria 2005
337 Ga0501047_0305034 3300049581 Bacteria 1434
338 Ga0501048_0006772 3300049582 Bacteria 8704
339 Ga0501048_0908721 3300049582 Bacteria 633
340 Ga0501067_0016289 3300049583 Bacteria 4107
341 Ga0501068_0249281 3300049584 Bacteria 1131
342 Ga0501069_0022658 3300049585 Bacteria 3419
343 Ga0501070_0087575 3300049586 Bacteria 2577
344 Ga0501070_0095123 3300049586 Bacteria 2465
345 Ga0501070_0105796 3300049586 Bacteria 2326
346 Ga0501070_0234973 3300049586 Bacteria 1501
347 Ga0501071_0057140 3300049587 Bacteria 2819
348 Ga0501071_0190781 3300049587 Bacteria 1537
349 Ga0501072_0024296 3300049588 Bacteria 4713
350 Ga0501073_0194258 3300049589 Bacteria 1404
351 Ga0501074_0013187 3300049590 Bacteria 6009
352 Ga0501074_0186501 3300049590 Bacteria 1479
353 Ga0501075_0543067 3300049591 Bacteria 887
354 Ga0501076_0094494 3300049592 Bacteria 2407
355 Ga0501076_0972059 3300049592 Bacteria 700
356 Ga0501077_0105555 3300049593 Bacteria 1785
357 Ga0501079_0410370 3300049741 Bacteria 1062
358 Ga0501079_1144929 3300049741 Bacteria 613
359 Ga0501080_0159708 3300049742 Bacteria 2082
360 Ga0501080_1319506 3300049742 Bacteria 617
361 Ga0501083_0007387 3300049744 Bacteria 7797
362 Ga0501083_0095019 3300049744 Bacteria 1967
363 Ga0501035_0072477 3300049822 Bacteria 3048
364 Ga0501035_0158528 3300049822 Bacteria 1960
365 Ga0501035_0352425 3300049822 Bacteria 1231
366 Ga0501035_0366215 3300049822 Bacteria 1204
367 Ga0501044_0032157 3300049823 Bacteria 5515
368 Ga0501044_0036241 3300049823 Bacteria 5161
369 Ga0501044_0151186 3300049823 Bacteria 2303
370 Ga0501044_0159794 3300049823 Bacteria 2231
371 Ga0501044_0207768 3300049823 Bacteria 1913
372 Ga0501044_0213125 3300049823 Bacteria 1885
373 Ga0501044_0299289 3300049823 Bacteria 1538
374 Ga0501044_0357395 3300049823 Bacteria 1379
375 Ga0501045_0027254 3300049824 Bacteria 4115
376 nmdc:mga03n38_19851_c1 3300050490 Bacteria 1567
377 nmdc:mga00v17_476859_c1 3300050491 Bacteria 809
378 nmdc:mga0k408_27115_c1 3300050493 Bacteria 3252
379 nmdc:mga06z11_12428_c1 3300050494 Bacteria 2599
380 nmdc:mga06z11_238260_c1 3300050494 Bacteria 1068
381 nmdc:mga07m45_65776_c1 3300050496 Bacteria 2059
382 nmdc:mga05p37_127437_c1 3300050507 Bacteria 3125
383 nmdc:mga05p37_3274_c1 3300050507 Bacteria 18872
384 nmdc:mga09592_1145517_c1 3300050508 Bacteria 645
385 nmdc:mga0qj67_129314_c1 3300050509 Bacteria 2045
386 nmdc:mga06r32_36932_c1 3300050510 Bacteria 4621
387 nmdc:mga08y16_335817_c1 3300050511 Bacteria 1554
388 nmdc:mga08y16_61267_c1 3300050511 Bacteria 3929
389 nmdc:mga0n895_11790_c1 3300050512 Bacteria 7816
390 nmdc:mga0n895_137988_c1 3300050512 Bacteria 2466
391 nmdc:mga0a205_49470_c1 3300050515 Bacteria 4057
392 Ga0495601_0006441 3300053077 Bacteria 6868
393 Ga0495601_0368385 3300053077 Bacteria 933
394 Ga0495612_0080394 3300053078 Bacteria 1369
395 Ga0500610_0188406 3300053079 Bacteria 1004
396 Ga0495595_0042642 3300053084 Bacteria 2079
397 Ga0495619_0017202 3300053085 Bacteria 4579
398 Ga0495619_0056323 3300053085 Bacteria 2606
399 Ga0500650_0165680 3300053098 Bacteria 1018
400 Ga0500593_061414 3300053117 Bacteria 1650
401 Ga0501084_0124152 3300054114 Bacteria 2171
402 Ga0501082_0000002 3300060353 Bacteria 186546
403 Ga0501082_0879693 3300060353 Bacteria 784
404 2513590183 2513237087 Bacteria 5817514
405 Ga0207685_10046877
406 Ga0065715_10509561
407 Ga0070676_10143618
408 Ga0070690_100136867
409 Ga0070670_100267276
410 Ga0070689_100027863
411 Ga0070661_100070586
412 Ga0070669_100024530
413 Ga0070669_100461011
414 Ga0070671_100276446
415 Ga0070671_100279906
416 Ga0070674_100240905
417 Ga0070674_100397805
418 Ga0070673_100893236
419 Ga0070659_100077073
420 Ga0070659_100756466
421 Ga0070713_100164835
422 Ga0070713_100586872
423 Ga0070710_10128952
424 Ga0070710_10383641
425 Ga0070711_100202878
426 Ga0070700_100265468
427 Ga0070708_100077027
428 Ga0070663_100576775
429 Ga0070662_100057653
430 Ga0070662_100841552
431 Ga0068867_100608892
432 Ga0070679_100396893
433 Ga0068853_100796901
434 Ga0070672_100250781
435 Ga0070672_100334374
436 Ga0070686_100638744
437 Ga0070665_100303472
438 Ga0070704_100471983
439 Ga0068855_100086862
440 Ga0070664_100217104
441 Ga0068857_100458981
442 Ga0068854_100057046
443 Ga0068856_100963247
444 Ga0068859_100634504
445 Ga0068859_101590698
446 Ga0068864_100027938
447 Ga0068864_100202559
448 Ga0068861_100397716
449 Ga0068861_101648582
450 Ga0068870_10356867
451 Ga0068863_100523738
452 Ga0068863_100568318
453 Ga0068860_100401277
454 Ga0068862_100769944
455 Ga0081455_10001150
456 Ga0081455_10009694
457 Ga0081538_10017871
458 Ga0081540_1000612
459 Ga0070717_10601039
460 Ga0070717_10810829
461 Ga0075432_10172100
462 Ga0070715_10056489
463 Ga0070715_10071888
464 Ga0070716_100551068
465 Ga0070712_100060058
466 Ga0075367_10196562
467 Ga0097621_100303314
468 Ga0097621_100733393
469 Ga0097621_101399014
470 Ga0075370_10066342
471 Ga0075428_100099134
472 Ga0075430_100091908
473 Ga0075431_100471285
474 Ga0075433_10043343
475 Ga0075434_100010662
476 Ga0075434_100138548
477 Ga0075429_100102775
478 Ga0068865_100659867
479 Ga0075436_100719986
480 Ga0097620_100634546
481 Ga0097620_101590737
482 Ga0099795_10000194
483 Ga0105240_10733513
484 Ga0111539_10078159
485 Ga0111539_10332491
486 Ga0105245_10180220
487 Ga0105247_10072274
488 Ga0114129_10140095
489 Ga0099796_10003325
490 Ga0105239_10487707
491 Ga0105239_11064159
492 Ga0157370_10141954
493 Ga0157378_10128433
494 Ga0163162_10282786
495 Ga0157372_11549065
496 Ga0163163_10003932
497 Ga0163163_10448306
498 Ga0163163_10576450
499 Ga0157380_10033401
500 Ga0157380_10479983
501 Ga0157380_10521673
502 Ga0209758_1001016
503 Ga0207642_10126108
504 Ga0207710_10249929
505 Ga0207688_10095975
506 Ga0207645_10118412
507 Ga0207705_10093996
508 Ga0207693_10007481
509 Ga0207660_10282793
510 Ga0207657_10004349
511 Ga0207649_10500931
512 Ga0207652_10128444
513 Ga0207652_10172127
514 Ga0207681_10007584
515 Ga0207681_10414580
516 Ga0207650_10271561
517 Ga0207650_10632360
518 Ga0207700_10083592
519 Ga0207700_10144164
520 Ga0207700_10266709
521 Ga0207664_10067197
522 Ga0207644_10492150
523 Ga0207706_10075757
524 Ga0207706_10732094
525 Ga0207686_10690197
526 Ga0207709_10075547
527 Ga0207670_10165688
528 Ga0207669_10300941
529 Ga0207669_10353256
530 Ga0207665_10410390
531 Ga0207691_10292285
532 Ga0207691_10765928
533 Ga0207711_10351703
534 Ga0207667_10143542
535 Ga0207668_10284659
536 Ga0207677_10713239
537 Ga0207703_10123859
538 Ga0207639_10092780
539 Ga0207708_10083882
540 Ga0207708_10208634
541 Ga0207702_10575105
542 Ga0207641_10338147
543 Ga0207641_10916971
544 Ga0207648_10056756
545 Ga0207676_10008703
546 Ga0207676_10323197
547 Ga0207683_10013277
548 Ga0207683_10044762
549 Ga0209179_1006757
550 Ga0207428_10039931
551 Ga0207428_10113797
552 Ga0268266_10121413
553 Ga0268266_10489535
554 Ga0268265_10107041
555 Ga0268264_10429626
556 Ga0265332_10000658
557 Ga0265325_10043254
558 Ga0265325_10080315
559 Ga0265325_10082264
560 Ga0265340_10035077
561 Ga0265340_10072824
562 Ga0265340_10126934
563 Ga0265339_10011086
564 Ga0265339_10159303
565 Ga0265331_10222385
566 Ga0265316_10042057
567 Ga0265316_10128266
568 Ga0307408_101084215
569 Ga0265314_10092167
570 Ga0265342_10000354
571 Ga0307416_100189044
572 Ga0373930_0012613
573 Ga0373930_0090504
574 Ga0373958_0103063
575 Ga0373938_0035973
576 Ga0373926_0115455
577 Ga0373926_0165838
578 Ga0373940_0088642
579 Ga0373952_0016503
580 Ga0373936_0010766
581 Ga0373941_0013702
582 Ga0373954_0078112
583 Ga0373960_0023542
584 Ga0373943_0000343
585 Ga0373943_0045190
586 Ga0373946_0021082
587 Ga0373946_0044028
588 Ga0373942_0015558
589 Ga0373961_0002362
590 Ga0373961_0038846
591 Ga0373924_0091986
592 Ga0373931_0002687
593 Ga0373931_0122860
594 Ga0373935_0005752
595 Ga0373935_0326782
596 Ga0373927_0012158
597 Ga0373927_0112855
598 Ga0373947_0000156
599 Ga0373947_0070107
600 Ga0373947_0320830
601 Ga0373937_0654232
602 Ga0373925_0000628
603 Ga0373925_0064969
604 Ga0395900_0135032
605 Ga0395900_1399157
606 Ga0395898_0172672
607 Ga0395901_0829517
608 Ga0439441_071532
609 Ga0466963_0238534
610 Ga0466957_0234020
611 Ga0495592_0202673
612 Ga0495603_0193749
613 Ga0495629_0027518
614 Ga0495629_0152834
615 Ga0495629_0845227
616 Ga0495638_0016027
617 Ga0495638_0020575
618 Ga0495651_0110533
619 Ga0495653_0266510
620 Ga0495653_0656577
621 Ga0495580_0003218
622 Ga0495580_0268759
623 Ga0495582_0036208
624 Ga0495582_0057946
625 Ga0495639_0012071
626 Ga0495639_0122353
627 Ga0495662_0035022
628 Ga0495664_0228219
629 Ga0495584_0058564
630 Ga0495584_0069194
631 Ga0495585_0292602
632 Ga0495594_0524841
633 Ga0495608_0163579
634 Ga0495618_0165494
635 Ga0495628_0093015
636 Ga0495630_0067506
637 Ga0495663_0114143
638 Ga0495665_0023685
639 Ga0495665_0030485
640 Ga0495665_0220014
641 Ga0495640_0270565
642 Ga0495609_0134668
643 Ga0495645_0235605
644 Ga0495656_0030601
645 Ga0495668_0080918
646 Ga0495634_0024063
647 Ga0495634_0188041
648 Ga0495635_0116656
649 Ga0495659_0029394
650 Ga0495658_0025079
651 Ga0495658_0378780
652 Ga0495658_0561008
653 Ga0495669_0394702
654 Ga0495613_0013787
655 Ga0495624_0004184
656 Ga0495671_0316495
657 Ga0495581_0012758
658 Ga0495581_0057556
659 Ga0495604_0299086
660 Ga0495676_0063902
661 Ga0495676_0681552
662 Ga0495680_0777449
663 Ga0495684_0001554
664 Ga0495593_0014241
665 Ga0496100_0016689
666 Ga0496100_0718283
667 Ga0496101_0057376
668 Ga0496102_0010532
669 Ga0496103_0040577
670 Ga0496104_0079106
671 Ga0496104_0160514
672 Ga0496105_0005466
673 Ga0496105_0121686
674 Ga0496106_0014881
675 Ga0496106_0601245
676 Ga0496107_0031775
677 Ga0496107_0363210
678 Ga0496107_0407540
679 Ga0496108_0017403
680 Ga0496108_0086436
681 Ga0496108_0327238
682 Ga0496109_0032050
683 Ga0496109_0315200
684 Ga0496109_0381055
685 Ga0496110_0018984
686 Ga0496110_0090747
687 Ga0496111_0021090
688 Ga0496111_0041799
689 Ga0496112_0130566
690 Ga0496112_0625370
691 Ga0496113_0024953
692 Ga0496113_0267050
693 Ga0496114_0003255
694 Ga0496114_0006114
695 Ga0496126_0928616
696 Ga0501031_0118905
697 Ga0501032_0075755
698 Ga0501033_0052347
699 Ga0501033_0060378
700 Ga0501033_0464953
701 Ga0501034_0030327
702 Ga0501034_0126475
703 Ga0501034_0420556
704 Ga0501034_0422283
705 Ga0501034_0482713
706 Ga0501036_0085523
707 Ga0501036_0215358
708 Ga0501036_0283410
709 Ga0501036_0714741
710 Ga0501036_0791013
711 Ga0501036_1147434
712 Ga0501037_0029564
713 Ga0501037_0087008
714 Ga0501037_0110622
715 Ga0501038_0000630
716 Ga0501038_0020007
717 Ga0501038_0034493
718 Ga0501038_0099184
719 Ga0501038_0531460
720 Ga0501039_0048542
721 Ga0501039_0059815
722 Ga0501039_0097910
723 Ga0501039_0323362
724 Ga0501040_0079686
725 Ga0501042_0014727
726 Ga0501043_0041530
727 Ga0501043_0060908
728 Ga0501043_0067449
729 Ga0501043_0091949
730 Ga0501043_0099370
731 Ga0501043_0101078
732 Ga0501043_0194198
733 Ga0501043_0279629
734 Ga0501046_0080608
735 Ga0501046_0906862
736 Ga0501047_0026939
737 Ga0501047_0057626
738 Ga0501047_0141160
739 Ga0501047_0149216
740 Ga0501047_0176279
741 Ga0501047_0305034
742 Ga0501048_0006772
743 Ga0501048_0908721
744 Ga0501067_0016289
745 Ga0501068_0249281
746 Ga0501069_0022658
747 Ga0501070_0087575
748 Ga0501070_0095123
749 Ga0501070_0105796
750 Ga0501070_0234973
751 Ga0501071_0057140
752 Ga0501071_0190781
753 Ga0501072_0024296
754 Ga0501073_0194258
755 Ga0501074_0013187
756 Ga0501074_0186501
757 Ga0501075_0543067
758 Ga0501076_0094494
759 Ga0501076_0972059
760 Ga0501077_0105555
761 Ga0501079_0410370
762 Ga0501079_1144929
763 Ga0501080_0159708
764 Ga0501080_1319506
765 Ga0501083_0007387
766 Ga0501083_0095019
767 Ga0501035_0072477
768 Ga0501035_0158528
769 Ga0501035_0352425
770 Ga0501035_0366215
771 Ga0501044_0032157
772 Ga0501044_0036241
773 Ga0501044_0151186
774 Ga0501044_0159794
775 Ga0501044_0207768
776 Ga0501044_0213125
777 Ga0501044_0299289
778 Ga0501044_0357395
779 Ga0501045_0027254
780 nmdc:mga03n38_19851_c1
781 nmdc:mga00v17_476859_c1
782 nmdc:mga0k408_27115_c1
783 nmdc:mga06z11_12428_c1
784 nmdc:mga06z11_238260_c1
785 nmdc:mga07m45_65776_c1
786 nmdc:mga05p37_127437_c1
787 nmdc:mga05p37_3274_c1
788 nmdc:mga09592_1145517_c1
789 nmdc:mga0qj67_129314_c1
790 nmdc:mga06r32_36932_c1
791 nmdc:mga08y16_335817_c1
792 nmdc:mga08y16_61267_c1
793 nmdc:mga0n895_11790_c1
794 nmdc:mga0n895_137988_c1
795 nmdc:mga0a205_49470_c1
796 Ga0495601_0006441
797 Ga0495601_0368385
798 Ga0495612_0080394
799 Ga0500610_0188406
800 Ga0495595_0042642
801 Ga0495619_0017202
802 Ga0495619_0056323
803 Ga0500650_0165680
804 Ga0500593_061414
805 Ga0501084_0124152
806 Ga0501082_0000002
807 Ga0501082_0879693
808 2513590183

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00188

CAP

Cysteine-rich secretory protein family

86

202

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4d53-assembly2.cif.gz_B outer surface protein bb0689 from borrelia burgdorferi 0.8538 48 174
4ifa-assembly1.cif.gz_A 1.5 angstrom resolution crystal structure of an extracellular protein containing a scp domain from bacillus anthracis str. ames 0.8402 48 171
4h0a-assembly2.cif.gz_B crystal structure of a cysteine-rich secretory protein (sav1118) from staphylococcus aureus subsp. aureus mu50 at 1.90 a resolution 0.8341 51 171
4h0a-assembly1.cif.gz_A crystal structure of a cysteine-rich secretory protein (sav1118) from staphylococcus aureus subsp. aureus mu50 at 1.90 a resolution 0.8284 51 171
4d53-assembly2.cif.gz_B outer surface protein bb0689 from borrelia burgdorferi 0.8122 48 174
ID Description Score Start End Superfamily
af_Q54P01_23_197_3.40.33.10 Alpha Beta;3-Layer(aba) Sandwich;Pathogenesis-related Protein p14a;CAP 0.9091 66 169 3.40.33.10
af_Q2FYU2_2_286_3.40.33.10 Alpha Beta;3-Layer(aba) Sandwich;Pathogenesis-related Protein p14a;CAP 0.9081 51 170 3.40.33.10
4d53B00 Alpha Beta;3-Layer(aba) Sandwich;Pathogenesis-related Protein p14a;CAP 0.8538 48 174 3.40.33.10
af_O53976_28_160_3.40.33.10 Alpha Beta;3-Layer(aba) Sandwich;Pathogenesis-related Protein p14a;CAP 0.8467 53 174 3.40.33.10
4ifaA01 Alpha Beta;3-Layer(aba) Sandwich;Pathogenesis-related Protein p14a;CAP 0.8291 48 171 3.40.33.10
ID Description Score Start End GO Terms
AF-A0A2U0UF86-F1-model_v4 deleted 0.9853 51 172
AF-A0A1M6YAY6-F1-model_v4 Cysteine-rich secretory protein family protein 0.9842 53 172
AF-A0A2H9VJZ8-F1-model_v4 deleted 0.982 54 172
AF-A0A318TFR6-F1-model_v4 SCP domain-containing protein 0.9791 39 174
AF-A0A833D6D1-F1-model_v4 CAP domain-containing protein 0.9776 48 174

Map