F435591

General Info

Members Datasets Scaffolds Average Seq Length
404 214 808 308

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100009780|Ga0070680_1000097805
Length 349
Sequence VDAGRGRRHLRRRILGRRGARSLAAVGVLVLGAFGIYQAAFAGSGSKGRTIDYWVAAVPVVWNIAPNGHDALAMDMKMPSGSMPGMMGMVMGATLPTSQTVVRTVVYRRYSAHWKKPLPNADPSSADGLLIPGPLIQARVGDHLRIHFKNMDTLRRAPHSMHFHGVHYAPSSDGAYLPGFSGRDADVLPGQTYTYRLTAGADSAGVWPYHDHSPSMHASIDGGMYGMLSILGRHERAPDREFEVVFAPWGKFMTIDGRAYVGNTPVFRAKVGEVVQWDVMAMGSDFHTFHVHGHRWLGTGNVARDTQTVGPAESFRIRWKEDAPGTWLYHCHVEDHMMHGMIGIYRVST

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
145 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
146 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
154 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
155 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
156 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
162 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
163 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
164 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
165 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
166 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
167 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
168 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
196 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
209 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 6.68
Rhizosphere 92.33
Stem 0
Stem Tuber 0
Unclassified 1.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100009780 3300005336 Bacteria 7381
2 JGI24744J21845_10013957 3300002077 Bacteria 1618
3 JGI25407J50210_10015771 3300003373 Bacteria 1953
4 Ga0070658_10008889 3300005327 Bacteria 8075
5 Ga0070676_10021635 3300005328 Bacteria 3601
6 Ga0070683_100018085 3300005329 Bacteria 6237
7 Ga0070683_100029525 3300005329 Bacteria 4965
8 Ga0070683_100057650 3300005329 Bacteria 3608
9 Ga0070683_100076705 3300005329 Bacteria 3125
10 Ga0070683_100091768 3300005329 Bacteria 2852
11 Ga0070683_100187353 3300005329 Bacteria 1964
12 Ga0068869_100056433 3300005334 Bacteria 2864
13 Ga0068869_100143580 3300005334 Bacteria 1845
14 Ga0070680_100008767 3300005336 Bacteria 7757
15 Ga0070680_100113050 3300005336 Bacteria 2261
16 Ga0070680_100317547 3300005336 Bacteria 1322
17 Ga0070682_100033199 3300005337 Bacteria 3134
18 Ga0070682_100045832 3300005337 Bacteria 2712
19 Ga0070682_100123361 3300005337 Bacteria 1742
20 Ga0070682_100200052 3300005337 Bacteria 1409
21 Ga0068868_100011208 3300005338 Bacteria 6528
22 Ga0070660_100008444 3300005339 Bacteria 7202
23 Ga0070660_100017408 3300005339 Bacteria 5238
24 Ga0070660_100022533 3300005339 Bacteria 4659
25 Ga0070660_100168180 3300005339 Bacteria 1770
26 Ga0070689_100203945 3300005340 Bacteria 1616
27 Ga0070691_10015167 3300005341 Bacteria 3539
28 Ga0070661_100004432 3300005344 Bacteria 9677
29 Ga0070661_100006075 3300005344 Bacteria 8312
30 Ga0070661_100087541 3300005344 Bacteria 2304
31 Ga0070661_100102824 3300005344 Bacteria 2127
32 Ga0070692_10183560 3300005345 Bacteria 1214
33 Ga0070668_100018341 3300005347 Bacteria 5253
34 Ga0070668_100150779 3300005347 Bacteria 1880
35 Ga0070671_100233258 3300005355 Bacteria 1562
36 Ga0070674_100012477 3300005356 Bacteria 5219
37 Ga0070674_100017686 3300005356 Bacteria 4492
38 Ga0070674_100105714 3300005356 Bacteria 2059
39 Ga0070673_100008985 3300005364 Bacteria 6685
40 Ga0070659_100002454 3300005366 Bacteria 13181
41 Ga0070667_100009301 3300005367 Bacteria 8145
42 Ga0070701_10067205 3300005438 Bacteria 1907
43 Ga0070701_10209939 3300005438 Bacteria 1155
44 Ga0070700_100072113 3300005441 Bacteria 2207
45 Ga0070694_100033656 3300005444 Bacteria 3375
46 Ga0070708_100022835 3300005445 Bacteria 5312
47 Ga0070708_100324707 3300005445 Bacteria 1450
48 Ga0070678_100003876 3300005456 Bacteria 8404
49 Ga0070678_100045602 3300005456 Bacteria 3137
50 Ga0070678_100473766 3300005456 Bacteria 1100
51 Ga0070662_100000602 3300005457 Bacteria 21952
52 Ga0070662_100005945 3300005457 Bacteria 7826
53 Ga0070681_10004229 3300005458 Bacteria 13603
54 Ga0070681_10007854 3300005458 Bacteria 10435
55 Ga0070681_10022615 3300005458 Bacteria 6314
56 Ga0070681_10025036 3300005458 Bacteria 6005
57 Ga0070681_10029852 3300005458 Bacteria 5472
58 Ga0070681_10033673 3300005458 Bacteria 5143
59 Ga0068867_100012977 3300005459 Bacteria 5896
60 Ga0068867_100043599 3300005459 Bacteria 3284
61 Ga0068867_100247388 3300005459 Bacteria 1449
62 Ga0070685_10010663 3300005466 Bacteria 4783
63 Ga0070685_10122425 3300005466 Bacteria 1617
64 Ga0070685_10165772 3300005466 Bacteria 1412
65 Ga0070679_100006301 3300005530 Bacteria 11046
66 Ga0070679_100012009 3300005530 Bacteria 8265
67 Ga0070679_100024824 3300005530 Bacteria 5875
68 Ga0070679_100041966 3300005530 Bacteria 4555
69 Ga0070679_100067141 3300005530 Bacteria 3576
70 Ga0070679_100321215 3300005530 Bacteria 1497
71 Ga0070684_100014312 3300005535 Bacteria 6422
72 Ga0070684_100016044 3300005535 Bacteria 6117
73 Ga0070684_100021903 3300005535 Bacteria 5324
74 Ga0070684_100040625 3300005535 Bacteria 4007
75 Ga0068853_100041303 3300005539 Bacteria 3938
76 Ga0070672_100022918 3300005543 Bacteria 4596
77 Ga0070686_100042250 3300005544 Bacteria 2854
78 Ga0070695_100035880 3300005545 Bacteria 3117
79 Ga0070695_100150407 3300005545 Bacteria 1624
80 Ga0070696_100033504 3300005546 Bacteria 3530
81 Ga0070693_100003865 3300005547 Bacteria 7021
82 Ga0070665_100061813 3300005548 Bacteria 3755
83 Ga0068855_100350311 3300005563 Bacteria 1627
84 Ga0070664_100067285 3300005564 Bacteria 3062
85 Ga0070664_100171241 3300005564 Bacteria 1926
86 Ga0070664_100310000 3300005564 Bacteria 1428
87 Ga0068857_100008377 3300005577 Bacteria 8936
88 Ga0068854_100004552 3300005578 Bacteria 8744
89 Ga0068854_100061415 3300005578 Bacteria 2722
90 Ga0068854_100228250 3300005578 Bacteria 1476
91 Ga0068856_100025160 3300005614 Bacteria 5800
92 Ga0068856_100105083 3300005614 Bacteria 2818
93 Ga0070702_100201508 3300005615 Bacteria 1318
94 Ga0068852_100012097 3300005616 Bacteria 6534
95 Ga0068852_100050190 3300005616 Bacteria 3573
96 Ga0068852_100209234 3300005616 Bacteria 1850
97 Ga0068859_100056007 3300005617 Bacteria 3967
98 Ga0068861_100006898 3300005719 Bacteria 7759
99 Ga0068861_100137547 3300005719 Bacteria 1990
100 Ga0068851_10016448 3300005834 Bacteria 3539
101 Ga0068870_10032750 3300005840 Bacteria 2646
102 Ga0068858_100129683 3300005842 Bacteria 2363
103 Ga0068858_100129763 3300005842 Bacteria 2363
104 Ga0068860_100130010 3300005843 Bacteria 2416
105 Ga0068860_100258888 3300005843 Bacteria 1695
106 Ga0081455_10051793 3300005937 Bacteria 3519
107 Ga0081455_10242919 3300005937 Bacteria 1322
108 Ga0081538_10001771 3300005981 Bacteria 21857
109 Ga0081540_1065305 3300005983 Bacteria 1712
110 Ga0081539_10007159 3300005985 Bacteria 10287
111 Ga0075365_10221388 3300006038 Unclassified 1328
112 Ga0068871_100115469 3300006358 Bacteria 2263
113 Ga0075434_100029761 3300006871 Bacteria 5375
114 Ga0075434_100171007 3300006871 Bacteria 2193
115 Ga0075434_100383696 3300006871 Bacteria 1426
116 Ga0097620_100056013 3300006931 Bacteria 3967
117 Ga0105240_10054300 3300009093 Bacteria 5021
118 Ga0105240_10142719 3300009093 Bacteria 2862
119 Ga0105240_10452703 3300009093 Bacteria 1436
120 Ga0105240_10520803 3300009093 Bacteria 1319
121 Ga0111539_10060675 3300009094 Bacteria 4481
122 Ga0111539_10247783 3300009094 Unclassified 2074
123 Ga0111539_10465038 3300009094 Bacteria 1473
124 Ga0105245_10004507 3300009098 Bacteria 12308
125 Ga0105245_10071059 3300009098 Bacteria 3160
126 Ga0105245_10553810 3300009098 Bacteria 1172
127 Ga0114129_10009896 3300009147 Bacteria 13594
128 Ga0114129_10043928 3300009147 Bacteria 6287
129 Ga0114129_10107634 3300009147 Bacteria 3850
130 Ga0114129_10149128 3300009147 Bacteria 3201
131 Ga0114129_10196401 3300009147 Unclassified 2736
132 Ga0105243_10007651 3300009148 Bacteria 8303
133 Ga0105243_10032600 3300009148 Bacteria 4026
134 Ga0105243_10467569 3300009148 Bacteria 1187
135 Ga0105241_10121123 3300009174 Bacteria 2107
136 Ga0105242_10206141 3300009176 Bacteria 1749
137 Ga0105248_10089053 3300009177 Bacteria 3474
138 Ga0105248_10287431 3300009177 Bacteria 1851
139 Ga0105238_10014110 3300009551 Bacteria 8079
140 Ga0105238_10045461 3300009551 Bacteria 4435
141 Ga0105238_10208009 3300009551 Bacteria 1932
142 Ga0105249_10033488 3300009553 Bacteria 4652
143 Ga0105249_10292547 3300009553 Bacteria 1631
144 Ga0105239_10517638 3300010375 Bacteria 1357
145 Ga0157371_10005753 3300013102 Bacteria 10388
146 Ga0157370_10009475 3300013104 Bacteria 10397
147 Ga0157370_10051826 3300013104 Bacteria 3919
148 Ga0157369_10006391 3300013105 Bacteria 13662
149 Ga0157369_10273223 3300013105 Bacteria 1761
150 Ga0157374_10037013 3300013296 Bacteria 4475
151 Ga0157374_10686746 3300013296 Bacteria 1036
152 Ga0163162_10360490 3300013306 Bacteria 1587
153 Ga0157372_10007491 3300013307 Bacteria 11606
154 Ga0157372_10048605 3300013307 Bacteria 4716
155 Ga0157375_10006799 3300013308 Bacteria 9959
156 Ga0157375_10143641 3300013308 Bacteria 2516
157 Ga0157375_10374146 3300013308 Bacteria 1591
158 Ga0163163_10038562 3300014325 Bacteria 4658
159 Ga0157380_10139642 3300014326 Bacteria 2080
160 Ga0182008_10004665 3300014497 Bacteria 7965
161 Ga0182008_10062852 3300014497 Bacteria 1829
162 Ga0157377_10002866 3300014745 Bacteria 7702
163 Ga0157377_10094578 3300014745 Bacteria 1770
164 Ga0157379_10014351 3300014968 Bacteria 6952
165 Ga0157379_10048908 3300014968 Bacteria 3775
166 Ga0157376_10040889 3300014969 Bacteria 3792
167 Ga0206354_10392727 3300020081 Bacteria 6039
168 Ga0206353_10247300 3300020082 Bacteria 3924
169 Ga0206353_11225562 3300020082 Bacteria 3888
170 Ga0207656_10062521 3300025321 Bacteria 1637
171 Ga0207653_10011429 3300025885 Bacteria 2771
172 Ga0207642_10003155 3300025899 Bacteria 5171
173 Ga0207688_10002253 3300025901 Bacteria 10391
174 Ga0207645_10076462 3300025907 Bacteria 2144
175 Ga0207643_10036302 3300025908 Bacteria 2763
176 Ga0207643_10057234 3300025908 Bacteria 2219
177 Ga0207705_10011220 3300025909 Bacteria 6494
178 Ga0207707_10008376 3300025912 Bacteria 8973
179 Ga0207707_10019398 3300025912 Bacteria 5936
180 Ga0207707_10023583 3300025912 Bacteria 5382
181 Ga0207707_10042841 3300025912 Bacteria 3950
182 Ga0207707_10069739 3300025912 Bacteria 3064
183 Ga0207693_10041444 3300025915 Bacteria 3625
184 Ga0207660_10011768 3300025917 Bacteria 5704
185 Ga0207660_10019548 3300025917 Bacteria 4528
186 Ga0207662_10137373 3300025918 Bacteria 1546
187 Ga0207657_10005767 3300025919 Bacteria 12912
188 Ga0207657_10014232 3300025919 Bacteria 7776
189 Ga0207657_10084090 3300025919 Bacteria 2668
190 Ga0207657_10084960 3300025919 Bacteria 2652
191 Ga0207657_10134862 3300025919 Bacteria 2021
192 Ga0207649_10023529 3300025920 Bacteria 3569
193 Ga0207649_10026129 3300025920 Bacteria 3413
194 Ga0207649_10046667 3300025920 Bacteria 2663
195 Ga0207649_10066483 3300025920 Bacteria 2285
196 Ga0207652_10003637 3300025921 Bacteria 12695
197 Ga0207652_10024901 3300025921 Bacteria 4968
198 Ga0207652_10163876 3300025921 Bacteria 1993
199 Ga0207652_10191960 3300025921 Bacteria 1837
200 Ga0207652_10238575 3300025921 Bacteria 1639
201 Ga0207681_10035687 3300025923 Bacteria 3278
202 Ga0207694_10055352 3300025924 Bacteria 3080
203 Ga0207694_10194796 3300025924 Bacteria 1647
204 Ga0207687_10221723 3300025927 Bacteria 1489
205 Ga0207690_10004023 3300025932 Bacteria 8682
206 Ga0207690_10060881 3300025932 Bacteria 2564
207 Ga0207706_10001350 3300025933 Bacteria 24504
208 Ga0207706_10007657 3300025933 Bacteria 9979
209 Ga0207706_10034874 3300025933 Bacteria 4476
210 Ga0207706_10435778 3300025933 Bacteria 1135
211 Ga0207709_10021264 3300025935 Bacteria 3671
212 Ga0207709_10154741 3300025935 Bacteria 1592
213 Ga0207669_10013141 3300025937 Bacteria 4101
214 Ga0207669_10048331 3300025937 Bacteria 2527
215 Ga0207669_10177282 3300025937 Bacteria 1524
216 Ga0207669_10182843 3300025937 Bacteria 1505
217 Ga0207704_10258729 3300025938 Bacteria 1311
218 Ga0207691_10008998 3300025940 Bacteria 9575
219 Ga0207691_10012314 3300025940 Bacteria 8201
220 Ga0207691_10015174 3300025940 Bacteria 7330
221 Ga0207711_10178225 3300025941 Bacteria 1931
222 Ga0207689_10067412 3300025942 Bacteria 2941
223 Ga0207661_10000277 3300025944 Bacteria 32727
224 Ga0207661_10006195 3300025944 Bacteria 8458
225 Ga0207661_10051011 3300025944 Bacteria 3299
226 Ga0207661_10074993 3300025944 Bacteria 2774
227 Ga0207679_10093373 3300025945 Bacteria 2333
228 Ga0207679_10371343 3300025945 Bacteria 1252
229 Ga0207667_10037993 3300025949 Bacteria 5144
230 Ga0207651_10005607 3300025960 Bacteria 6464
231 Ga0207712_10111507 3300025961 Bacteria 2053
232 Ga0207668_10053126 3300025972 Bacteria 2806
233 Ga0207640_10002956 3300025981 Bacteria 9149
234 Ga0207640_10056204 3300025981 Bacteria 2582
235 Ga0207658_10006189 3300025986 Bacteria 8172
236 Ga0207658_10188913 3300025986 Bacteria 1711
237 Ga0207703_10513259 3300026035 Bacteria 1126
238 Ga0207639_10009827 3300026041 Bacteria 6612
239 Ga0207678_10053743 3300026067 Bacteria 3470
240 Ga0207678_10203573 3300026067 Bacteria 1693
241 Ga0207708_10019546 3300026075 Bacteria 5108
242 Ga0207708_10148633 3300026075 Bacteria 1843
243 Ga0207702_10032025 3300026078 Bacteria 4386
244 Ga0207702_10101189 3300026078 Bacteria 2544
245 Ga0207641_10457850 3300026088 Bacteria 1234
246 Ga0207648_10021051 3300026089 Bacteria 5867
247 Ga0207648_10091022 3300026089 Bacteria 2666
248 Ga0207648_10111354 3300026089 Bacteria 2403
249 Ga0207676_10362478 3300026095 Bacteria 1344
250 Ga0207674_10009581 3300026116 Bacteria 11049
251 Ga0207674_10046317 3300026116 Bacteria 4465
252 Ga0207675_100002331 3300026118 Bacteria 18815
253 Ga0207675_100036934 3300026118 Bacteria 4557
254 Ga0207675_100077224 3300026118 Bacteria 3119
255 Ga0207683_10034162 3300026121 Bacteria 4419
256 Ga0207683_10121494 3300026121 Bacteria 2345
257 Ga0207698_10006586 3300026142 Bacteria 7261
258 Ga0207698_10055872 3300026142 Bacteria 3045
259 Ga0207698_10226896 3300026142 Bacteria 1692
260 Ga0207428_10043646 3300027907 Bacteria 3620
261 Ga0207428_10061142 3300027907 Bacteria 2983
262 Ga0207428_10246742 3300027907 Bacteria 1332
263 Ga0268266_10093135 3300028379 Bacteria 2644
264 Ga0268265_10017754 3300028380 Bacteria 4919
265 Ga0307408_100216910 3300031548 Bacteria 1559
266 Ga0307405_10011954 3300031731 Bacteria 4574
267 Ga0307413_10010032 3300031824 Bacteria 4567
268 Ga0307410_10022657 3300031852 Bacteria 3887
269 Ga0307406_10017084 3300031901 Bacteria 4224
270 Ga0307412_10025978 3300031911 Bacteria 3635
271 Ga0307409_100007685 3300031995 Bacteria 6474
272 Ga0307416_100038543 3300032002 Bacteria 3688
273 Ga0307411_10016372 3300032005 Bacteria 4195
274 Ga0307415_100006552 3300032126 Bacteria 6294
275 Ga0373949_0008291 3300035090 Bacteria 2276
276 Ga0373952_0011529 3300035092 Bacteria 1726
277 Ga0373941_0005963 3300035115 Bacteria 2905
278 Ga0395899_0032349 3300037312 Bacteria 3929
279 Ga0395900_0082543 3300037418 Bacteria 3302
280 Ga0395898_0006560 3300037466 Bacteria 12414
281 Ga0395905_0150554 3300037471 Bacteria 2189
282 Ga0395901_0045178 3300038443 Bacteria 4570
283 Ga0395901_0155558 3300038443 Bacteria 2401
284 Ga0395901_0177601 3300038443 Bacteria 2233
285 Ga0436363_1555292 3300039450 Bacteria 4689
286 Ga0439448_0041904 3300042005 Bacteria 1483
287 Ga0439450_021652 3300042008 Bacteria 1382
288 Ga0439463_041480 3300042016 Bacteria 1170
289 Ga0439444_0035520 3300042437 Bacteria 956
290 Ga0466965_0041773 3300044683 Bacteria 2260
291 Ga0466966_0003005 3300044684 Bacteria 11120
292 Ga0466966_0151761 3300044684 Bacteria 1413
293 Ga0466961_0003562 3300044693 Bacteria 9713
294 Ga0466961_0281198 3300044693 Bacteria 1018
295 Ga0466963_0004189 3300044694 Bacteria 8354
296 Ga0466963_0007785 3300044694 Bacteria 6405
297 Ga0466963_0017171 3300044694 Bacteria 4508
298 Ga0466963_0024965 3300044694 Bacteria 3807
299 Ga0466963_0030836 3300044694 Bacteria 3463
300 Ga0466963_0037970 3300044694 Bacteria 3148
301 Ga0466963_0043409 3300044694 Bacteria 2956
302 Ga0466963_0220493 3300044694 Bacteria 1328
303 Ga0466964_0022790 3300044706 Bacteria 2432
304 Ga0466971_0009248 3300044719 Bacteria 4305
305 Ga0466971_0103395 3300044719 Bacteria 1310
306 Ga0466968_0106314 3300044735 Bacteria 1258
307 Ga0466970_0098139 3300044765 Bacteria 1594
308 Ga0466970_0122003 3300044765 Bacteria 1428
309 Ga0466957_0010073 3300044842 Bacteria 5409
310 Ga0466957_0012752 3300044842 Bacteria 4870
311 Ga0466957_0081429 3300044842 Bacteria 2016
312 Ga0466957_0146754 3300044842 Bacteria 1523
313 Ga0466960_0195716 3300044901 Bacteria 1102
314 Ga0466959_0019093 3300045049 Bacteria 5039
315 Ga0466959_0062825 3300045049 Bacteria 2698
316 Ga0466958_0003660 3300045836 Bacteria 8026
317 Ga0466958_0008962 3300045836 Bacteria 5559
318 Ga0466958_0037230 3300045836 Bacteria 2915
319 Ga0466958_0072447 3300045836 Bacteria 2110
320 Ga0466958_0073507 3300045836 Bacteria 2094
321 Ga0466958_0080150 3300045836 Bacteria 2008
322 Ga0466958_0091615 3300045836 Bacteria 1882
323 Ga0466967_0008259 3300045976 Bacteria 7604
324 Ga0466967_0011490 3300045976 Bacteria 6711
325 Ga0466967_0013193 3300045976 Bacteria 6371
326 Ga0466967_0014112 3300045976 Bacteria 6207
327 Ga0466967_0016585 3300045976 Bacteria 5816
328 Ga0466967_0024486 3300045976 Bacteria 4964
329 Ga0466967_0034103 3300045976 Bacteria 4316
330 Ga0466967_0038929 3300045976 Bacteria 4082
331 Ga0466967_0073623 3300045976 Bacteria 3065
332 Ga0466967_0078685 3300045976 Bacteria 2971
333 Ga0466967_0139912 3300045976 Bacteria 2254
334 Ga0466967_0172210 3300045976 Bacteria 2037
335 Ga0495603_0069167 3300046455 Bacteria 2077
336 Ga0495603_0073608 3300046455 Bacteria 2007
337 Ga0495596_0047566 3300046500 Unclassified 1683
338 Ga0495630_0320785 3300046517 Bacteria 1184
339 Ga0495630_0348378 3300046517 Bacteria 1134
340 Ga0495586_0077156 3300046535 Bacteria 1826
341 Ga0495656_0084789 3300046615 Bacteria 1438
342 Ga0495634_0068124 3300046642 Bacteria 2352
343 Ga0495657_0200171 3300046675 Bacteria 1218
344 Ga0495658_0050379 3300046683 Bacteria 2356
345 Ga0495613_0134283 3300046689 Bacteria 1771
346 Ga0495613_0378793 3300046689 Bacteria 968
347 Ga0495674_0166264 3300047319 Bacteria 1843
348 Ga0495676_0342578 3300047321 Bacteria 1000
349 Ga0495680_0076289 3300047322 Bacteria 2542
350 Ga0496100_0025448 3300048903 Bacteria 3620
351 Ga0496102_0015088 3300048905 Bacteria 6726
352 Ga0496102_0152639 3300048905 Bacteria 2171
353 Ga0496104_0015094 3300048907 Bacteria 6991
354 Ga0496104_0222668 3300048907 Bacteria 1799
355 Ga0496104_0267061 3300048907 Bacteria 1623
356 Ga0496105_0043097 3300048908 Bacteria 3722
357 Ga0496106_0035334 3300048909 Bacteria 3737
358 Ga0496106_0057029 3300048909 Bacteria 2953
359 Ga0496107_0008097 3300048910 Bacteria 7261
360 Ga0496108_0000617 3300048911 Bacteria 27930
361 Ga0496108_0025511 3300048911 Bacteria 4871
362 Ga0496108_0200347 3300048911 Bacteria 1732
363 Ga0496109_0001083 3300048912 Bacteria 22621
364 Ga0496109_0024884 3300048912 Bacteria 5329
365 Ga0496109_0218904 3300048912 Bacteria 1791
366 Ga0496109_0307824 3300048912 Bacteria 1494
367 Ga0496110_0002508 3300048913 Bacteria 13784
368 Ga0496110_0008006 3300048913 Bacteria 8470
369 Ga0496110_0111513 3300048913 Bacteria 2459
370 Ga0496110_0558014 3300048913 Bacteria 1041
371 Ga0496111_0042609 3300048914 Bacteria 3260
372 Ga0496112_0013770 3300048915 Bacteria 7480
373 Ga0496112_0070099 3300048915 Bacteria 3464
374 Ga0496114_0083510 3300048917 Bacteria 2702
375 Ga0496114_0464962 3300048917 Bacteria 1120
376 Ga0496115_0048733 3300048918 Bacteria 3389
377 Ga0496119_0086658 3300048922 Bacteria 1789
378 Ga0496121_0060663 3300048924 Bacteria 3110
379 Ga0501038_0226403 3300049574 Bacteria 1490
380 Ga0501042_0113201 3300049578 Bacteria 1954
381 Ga0501042_0196392 3300049578 Bacteria 1455
382 Ga0501046_0026444 3300049580 Bacteria 4740
383 Ga0501046_0166696 3300049580 Bacteria 1655
384 Ga0501046_0173166 3300049580 Bacteria 1618
385 Ga0501068_0016284 3300049584 Bacteria 4285
386 Ga0501069_0017447 3300049585 Bacteria 3863
387 Ga0501069_0051926 3300049585 Bacteria 2282
388 Ga0501071_0173342 3300049587 Bacteria 1615
389 Ga0501074_0307335 3300049590 Bacteria 1126
390 Ga0501076_0161854 3300049592 Bacteria 1823
391 Ga0501080_0019603 3300049742 Bacteria 6266
392 nmdc:mga05p37_111016_c1 3300050507 Bacteria 3372
393 nmdc:mga05p37_273550_c1 3300050507 Unclassified 2017
394 nmdc:mga05p37_4798_c1 3300050507 Bacteria 15804
395 nmdc:mga05p37_68677_c1 3300050507 Bacteria 4358
396 nmdc:mga09592_387554_c1 3300050508 Bacteria 1208
397 nmdc:mga08y16_485206_c1 3300050511 Bacteria 1257
398 nmdc:mga0n895_132869_c1 3300050512 Bacteria 2514
399 nmdc:mga08x19_112721_c1 3300050514 Bacteria 1815
400 Ga0495619_0088457 3300053085 Bacteria 2095
401 Ga0501082_0058334 3300060353 Bacteria 3326
402 Ga0466962_0004658 3300061719 Bacteria 6587
403 Ga0466962_0015051 3300061719 Bacteria 3730
404 Ga0530510_0138385 3300061734 Bacteria 1793
405 Ga0070680_100009780
406 JGI24744J21845_10013957
407 JGI25407J50210_10015771
408 Ga0070658_10008889
409 Ga0070676_10021635
410 Ga0070683_100018085
411 Ga0070683_100029525
412 Ga0070683_100057650
413 Ga0070683_100076705
414 Ga0070683_100091768
415 Ga0070683_100187353
416 Ga0068869_100056433
417 Ga0068869_100143580
418 Ga0070680_100008767
419 Ga0070680_100113050
420 Ga0070680_100317547
421 Ga0070682_100033199
422 Ga0070682_100045832
423 Ga0070682_100123361
424 Ga0070682_100200052
425 Ga0068868_100011208
426 Ga0070660_100008444
427 Ga0070660_100017408
428 Ga0070660_100022533
429 Ga0070660_100168180
430 Ga0070689_100203945
431 Ga0070691_10015167
432 Ga0070661_100004432
433 Ga0070661_100006075
434 Ga0070661_100087541
435 Ga0070661_100102824
436 Ga0070692_10183560
437 Ga0070668_100018341
438 Ga0070668_100150779
439 Ga0070671_100233258
440 Ga0070674_100012477
441 Ga0070674_100017686
442 Ga0070674_100105714
443 Ga0070673_100008985
444 Ga0070659_100002454
445 Ga0070667_100009301
446 Ga0070701_10067205
447 Ga0070701_10209939
448 Ga0070700_100072113
449 Ga0070694_100033656
450 Ga0070708_100022835
451 Ga0070708_100324707
452 Ga0070678_100003876
453 Ga0070678_100045602
454 Ga0070678_100473766
455 Ga0070662_100000602
456 Ga0070662_100005945
457 Ga0070681_10004229
458 Ga0070681_10007854
459 Ga0070681_10022615
460 Ga0070681_10025036
461 Ga0070681_10029852
462 Ga0070681_10033673
463 Ga0068867_100012977
464 Ga0068867_100043599
465 Ga0068867_100247388
466 Ga0070685_10010663
467 Ga0070685_10122425
468 Ga0070685_10165772
469 Ga0070679_100006301
470 Ga0070679_100012009
471 Ga0070679_100024824
472 Ga0070679_100041966
473 Ga0070679_100067141
474 Ga0070679_100321215
475 Ga0070684_100014312
476 Ga0070684_100016044
477 Ga0070684_100021903
478 Ga0070684_100040625
479 Ga0068853_100041303
480 Ga0070672_100022918
481 Ga0070686_100042250
482 Ga0070695_100035880
483 Ga0070695_100150407
484 Ga0070696_100033504
485 Ga0070693_100003865
486 Ga0070665_100061813
487 Ga0068855_100350311
488 Ga0070664_100067285
489 Ga0070664_100171241
490 Ga0070664_100310000
491 Ga0068857_100008377
492 Ga0068854_100004552
493 Ga0068854_100061415
494 Ga0068854_100228250
495 Ga0068856_100025160
496 Ga0068856_100105083
497 Ga0070702_100201508
498 Ga0068852_100012097
499 Ga0068852_100050190
500 Ga0068852_100209234
501 Ga0068859_100056007
502 Ga0068861_100006898
503 Ga0068861_100137547
504 Ga0068851_10016448
505 Ga0068870_10032750
506 Ga0068858_100129683
507 Ga0068858_100129763
508 Ga0068860_100130010
509 Ga0068860_100258888
510 Ga0081455_10051793
511 Ga0081455_10242919
512 Ga0081538_10001771
513 Ga0081540_1065305
514 Ga0081539_10007159
515 Ga0075365_10221388
516 Ga0068871_100115469
517 Ga0075434_100029761
518 Ga0075434_100171007
519 Ga0075434_100383696
520 Ga0097620_100056013
521 Ga0105240_10054300
522 Ga0105240_10142719
523 Ga0105240_10452703
524 Ga0105240_10520803
525 Ga0111539_10060675
526 Ga0111539_10247783
527 Ga0111539_10465038
528 Ga0105245_10004507
529 Ga0105245_10071059
530 Ga0105245_10553810
531 Ga0114129_10009896
532 Ga0114129_10043928
533 Ga0114129_10107634
534 Ga0114129_10149128
535 Ga0114129_10196401
536 Ga0105243_10007651
537 Ga0105243_10032600
538 Ga0105243_10467569
539 Ga0105241_10121123
540 Ga0105242_10206141
541 Ga0105248_10089053
542 Ga0105248_10287431
543 Ga0105238_10014110
544 Ga0105238_10045461
545 Ga0105238_10208009
546 Ga0105249_10033488
547 Ga0105249_10292547
548 Ga0105239_10517638
549 Ga0157371_10005753
550 Ga0157370_10009475
551 Ga0157370_10051826
552 Ga0157369_10006391
553 Ga0157369_10273223
554 Ga0157374_10037013
555 Ga0157374_10686746
556 Ga0163162_10360490
557 Ga0157372_10007491
558 Ga0157372_10048605
559 Ga0157375_10006799
560 Ga0157375_10143641
561 Ga0157375_10374146
562 Ga0163163_10038562
563 Ga0157380_10139642
564 Ga0182008_10004665
565 Ga0182008_10062852
566 Ga0157377_10002866
567 Ga0157377_10094578
568 Ga0157379_10014351
569 Ga0157379_10048908
570 Ga0157376_10040889
571 Ga0206354_10392727
572 Ga0206353_10247300
573 Ga0206353_11225562
574 Ga0207656_10062521
575 Ga0207653_10011429
576 Ga0207642_10003155
577 Ga0207688_10002253
578 Ga0207645_10076462
579 Ga0207643_10036302
580 Ga0207643_10057234
581 Ga0207705_10011220
582 Ga0207707_10008376
583 Ga0207707_10019398
584 Ga0207707_10023583
585 Ga0207707_10042841
586 Ga0207707_10069739
587 Ga0207693_10041444
588 Ga0207660_10011768
589 Ga0207660_10019548
590 Ga0207662_10137373
591 Ga0207657_10005767
592 Ga0207657_10014232
593 Ga0207657_10084090
594 Ga0207657_10084960
595 Ga0207657_10134862
596 Ga0207649_10023529
597 Ga0207649_10026129
598 Ga0207649_10046667
599 Ga0207649_10066483
600 Ga0207652_10003637
601 Ga0207652_10024901
602 Ga0207652_10163876
603 Ga0207652_10191960
604 Ga0207652_10238575
605 Ga0207681_10035687
606 Ga0207694_10055352
607 Ga0207694_10194796
608 Ga0207687_10221723
609 Ga0207690_10004023
610 Ga0207690_10060881
611 Ga0207706_10001350
612 Ga0207706_10007657
613 Ga0207706_10034874
614 Ga0207706_10435778
615 Ga0207709_10021264
616 Ga0207709_10154741
617 Ga0207669_10013141
618 Ga0207669_10048331
619 Ga0207669_10177282
620 Ga0207669_10182843
621 Ga0207704_10258729
622 Ga0207691_10008998
623 Ga0207691_10012314
624 Ga0207691_10015174
625 Ga0207711_10178225
626 Ga0207689_10067412
627 Ga0207661_10000277
628 Ga0207661_10006195
629 Ga0207661_10051011
630 Ga0207661_10074993
631 Ga0207679_10093373
632 Ga0207679_10371343
633 Ga0207667_10037993
634 Ga0207651_10005607
635 Ga0207712_10111507
636 Ga0207668_10053126
637 Ga0207640_10002956
638 Ga0207640_10056204
639 Ga0207658_10006189
640 Ga0207658_10188913
641 Ga0207703_10513259
642 Ga0207639_10009827
643 Ga0207678_10053743
644 Ga0207678_10203573
645 Ga0207708_10019546
646 Ga0207708_10148633
647 Ga0207702_10032025
648 Ga0207702_10101189
649 Ga0207641_10457850
650 Ga0207648_10021051
651 Ga0207648_10091022
652 Ga0207648_10111354
653 Ga0207676_10362478
654 Ga0207674_10009581
655 Ga0207674_10046317
656 Ga0207675_100002331
657 Ga0207675_100036934
658 Ga0207675_100077224
659 Ga0207683_10034162
660 Ga0207683_10121494
661 Ga0207698_10006586
662 Ga0207698_10055872
663 Ga0207698_10226896
664 Ga0207428_10043646
665 Ga0207428_10061142
666 Ga0207428_10246742
667 Ga0268266_10093135
668 Ga0268265_10017754
669 Ga0307408_100216910
670 Ga0307405_10011954
671 Ga0307413_10010032
672 Ga0307410_10022657
673 Ga0307406_10017084
674 Ga0307412_10025978
675 Ga0307409_100007685
676 Ga0307416_100038543
677 Ga0307411_10016372
678 Ga0307415_100006552
679 Ga0373949_0008291
680 Ga0373952_0011529
681 Ga0373941_0005963
682 Ga0395899_0032349
683 Ga0395900_0082543
684 Ga0395898_0006560
685 Ga0395905_0150554
686 Ga0395901_0045178
687 Ga0395901_0155558
688 Ga0395901_0177601
689 Ga0436363_1555292
690 Ga0439448_0041904
691 Ga0439450_021652
692 Ga0439463_041480
693 Ga0439444_0035520
694 Ga0466965_0041773
695 Ga0466966_0003005
696 Ga0466966_0151761
697 Ga0466961_0003562
698 Ga0466961_0281198
699 Ga0466963_0004189
700 Ga0466963_0007785
701 Ga0466963_0017171
702 Ga0466963_0024965
703 Ga0466963_0030836
704 Ga0466963_0037970
705 Ga0466963_0043409
706 Ga0466963_0220493
707 Ga0466964_0022790
708 Ga0466971_0009248
709 Ga0466971_0103395
710 Ga0466968_0106314
711 Ga0466970_0098139
712 Ga0466970_0122003
713 Ga0466957_0010073
714 Ga0466957_0012752
715 Ga0466957_0081429
716 Ga0466957_0146754
717 Ga0466960_0195716
718 Ga0466959_0019093
719 Ga0466959_0062825
720 Ga0466958_0003660
721 Ga0466958_0008962
722 Ga0466958_0037230
723 Ga0466958_0072447
724 Ga0466958_0073507
725 Ga0466958_0080150
726 Ga0466958_0091615
727 Ga0466967_0008259
728 Ga0466967_0011490
729 Ga0466967_0013193
730 Ga0466967_0014112
731 Ga0466967_0016585
732 Ga0466967_0024486
733 Ga0466967_0034103
734 Ga0466967_0038929
735 Ga0466967_0073623
736 Ga0466967_0078685
737 Ga0466967_0139912
738 Ga0466967_0172210
739 Ga0495603_0069167
740 Ga0495603_0073608
741 Ga0495596_0047566
742 Ga0495630_0320785
743 Ga0495630_0348378
744 Ga0495586_0077156
745 Ga0495656_0084789
746 Ga0495634_0068124
747 Ga0495657_0200171
748 Ga0495658_0050379
749 Ga0495613_0134283
750 Ga0495613_0378793
751 Ga0495674_0166264
752 Ga0495676_0342578
753 Ga0495680_0076289
754 Ga0496100_0025448
755 Ga0496102_0015088
756 Ga0496102_0152639
757 Ga0496104_0015094
758 Ga0496104_0222668
759 Ga0496104_0267061
760 Ga0496105_0043097
761 Ga0496106_0035334
762 Ga0496106_0057029
763 Ga0496107_0008097
764 Ga0496108_0000617
765 Ga0496108_0025511
766 Ga0496108_0200347
767 Ga0496109_0001083
768 Ga0496109_0024884
769 Ga0496109_0218904
770 Ga0496109_0307824
771 Ga0496110_0002508
772 Ga0496110_0008006
773 Ga0496110_0111513
774 Ga0496110_0558014
775 Ga0496111_0042609
776 Ga0496112_0013770
777 Ga0496112_0070099
778 Ga0496114_0083510
779 Ga0496114_0464962
780 Ga0496115_0048733
781 Ga0496119_0086658
782 Ga0496121_0060663
783 Ga0501038_0226403
784 Ga0501042_0113201
785 Ga0501042_0196392
786 Ga0501046_0026444
787 Ga0501046_0166696
788 Ga0501046_0173166
789 Ga0501068_0016284
790 Ga0501069_0017447
791 Ga0501069_0051926
792 Ga0501071_0173342
793 Ga0501074_0307335
794 Ga0501076_0161854
795 Ga0501080_0019603
796 nmdc:mga05p37_111016_c1
797 nmdc:mga05p37_273550_c1
798 nmdc:mga05p37_4798_c1
799 nmdc:mga05p37_68677_c1
800 nmdc:mga09592_387554_c1
801 nmdc:mga08y16_485206_c1
802 nmdc:mga0n895_132869_c1
803 nmdc:mga08x19_112721_c1
804 Ga0495619_0088457
805 Ga0501082_0058334
806 Ga0466962_0004658
807 Ga0466962_0015051
808 Ga0530510_0138385

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07732

Cu-oxidase_3

Multicopper oxidase

249

349

0.89

PF07731

Cu-oxidase_2

Multicopper oxidase

235

349

0.86

PF07732

Cu-oxidase_3

Multicopper oxidase

127

235

0.81

PF07731

Cu-oxidase_2

Multicopper oxidase

96

230

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i5j-assembly1.cif.gz_A shewanella denitrificans nitrous oxide reductase, reduced apo form 0.8642 224 305
5n4l-assembly2.cif.gz_B rat ceruloplasmin trigonal form 0.8637 34 306
5i5i-assembly1.cif.gz_B shewanella denitrificans nitrous oxide reductase, app form 0.8473 224 306
5i5j-assembly1.cif.gz_B shewanella denitrificans nitrous oxide reductase, reduced apo form 0.8452 224 305
4ejx-assembly1.cif.gz_A structure of ceruloplasmin-myeloperoxidase complex 0.8417 36 305
ID Description Score Start End Superfamily
af_P00450_573_724_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.896 195 306 2.60.40.420
af_P12259_208_333_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8819 197 306 2.60.40.420
2xu9A03 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8808 194 305 2.60.40.420
af_Q3V1H3_22_375_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8738 41 306 2.60.40.420
af_Q5N9W4_387_547_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8704 223 305 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A7V9F0E0-F1-model_v4 Multicopper oxidase domain-containing protein 0.9849 200 305 GO:0005507
GO:0016491
AF-A0A7V9BEV0-F1-model_v4 Multicopper oxidase domain-containing protein 0.9816 85 305 GO:0005507
GO:0016491
AF-A0A1Q7VWL6-F1-model_v4 Plastocyanin-like domain-containing protein 0.9631 203 304 GO:0005507
GO:0016491
AF-A0A7V9V7L8-F1-model_v4 Multicopper oxidase domain-containing protein 0.9594 91 306 GO:0005507
GO:0016491
AF-A0A7V9BEV0-F1-model_v4 Multicopper oxidase domain-containing protein 0.9518 85 305 GO:0005507
GO:0016491

Map