F435579

General Info

Members Datasets Scaffolds Average Seq Length
404 259 808 126

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10672720|Ga0065704_106727201
Length 149
Sequence LEKVFLPVILCPVLIIFATQNRIVMNFPAELRYTKDHEWIRLDGDEALVGITDFAQRELGDIVYVEVETIGKQLDAGTVFGTVEAVKTVSDLYLPVRGTITELNPALVNAPELVNNDPYGQGWMVKMKISNTSDIDDLMDAKAYEQMVQ

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
99 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
161 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
162 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
163 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
164 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
165 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
166 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
167 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
168 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
169 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
176 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
181 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
182 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
183 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
190 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
204 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
205 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
206 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
207 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
208 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
209 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
210 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
213 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
214 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
222 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
223 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
224 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
225 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
226 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
227 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
230 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
231 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
232 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
233 2738541284 Pedobacter sp. YR016 Isolate Unclassified
234 2738541302 Pedobacter sp. CF074 Isolate Unclassified
235 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
236 2739367651 Pedobacter sp. OK291 Isolate Unclassified
237 2739367656 Pedobacter sp. CF523 Isolate Unclassified
238 2739367663 Pedobacter sp. YR510 Isolate Unclassified
239 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
240 2818991437 Pedobacter terrae 518 Isolate Unclassified
241 2818991444 Filimonas endophytica 3197 Isolate Unclassified
242 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
243 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
244 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
245 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
246 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
247 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
248 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
249 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
250 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
251 2914759650 Rhizosphaericola mali Isolate Rhizosphere
252 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
253 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
254 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
255 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
256 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
257 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
258 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
259 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.33
Metatranscriptomes 0.25
Isolates 7.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.7
Nodule 0
Rhizoplane 0.99
Rhizosphere 86.39
Stem 0
Stem Tuber 0
Unclassified 9.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10672720 3300005289 Unclassified 573
2 SwRhRL2b_contig_3370872 2162886007 Bacteria 2920
3 JGI24744J21845_10009846 3300002077 Bacteria 1962
4 JGI25152J39213_1000203 3300002773 Bacteria 39884
5 JGI25150J39212_1000025 3300002774 Bacteria 123597
6 JGI25151J46595_10000089 3300003187 Bacteria 123597
7 JGI25153J46596_10000079 3300003215 Bacteria 113263
8 rootH2_10006602 3300003320 Bacteria 39003
9 rootH2_10077261 3300003320 Bacteria 2453
10 rootH2_10111293 3300003320 Bacteria 4642
11 rootL2_10249439 3300003322 Bacteria 3028
12 rootH1_10191183 3300003323 Bacteria 1902
13 Ga0055536_1000010 3300003781 Bacteria 304614
14 Ga0055530_10001794 3300003791 Bacteria 14900
15 Ga0065714_10009349 3300005288 Bacteria 5050
16 Ga0065714_10016881 3300005288 Bacteria 1906
17 Ga0065714_10064503 3300005288 Bacteria 46875
18 Ga0065714_10068516 3300005288 Bacteria 4689
19 Ga0065704_10000425 3300005289 Bacteria 76756
20 Ga0065704_10077055 3300005289 Bacteria 4871
21 Ga0065704_10169486 3300005289 Bacteria 1300
22 Ga0065707_10087666 3300005295 Bacteria 4934
23 Ga0065707_10118826 3300005295 Bacteria 2176
24 Ga0065707_10305712 3300005295 Bacteria 995
25 Ga0070676_10027426 3300005328 Bacteria 3230
26 Ga0070670_100041605 3300005331 Bacteria 3949
27 Ga0070670_100053313 3300005331 Bacteria 3473
28 Ga0070677_10004086 3300005333 Bacteria 4735
29 Ga0068869_100012061 3300005334 Bacteria 5696
30 Ga0070666_10002570 3300005335 Bacteria 10973
31 Ga0070680_100845094 3300005336 Bacteria 789
32 Ga0068868_100249868 3300005338 Unclassified 1492
33 Ga0070668_100037918 3300005347 Bacteria 3682
34 Ga0070669_100686720 3300005353 Unclassified 863
35 Ga0070675_101970590 3300005354 Unclassified 539
36 Ga0070671_100069244 3300005355 Bacteria 2943
37 Ga0070671_100360582 3300005355 Bacteria 1241
38 Ga0070674_100010112 3300005356 Bacteria 5685
39 Ga0070673_100341722 3300005364 Unclassified 1326
40 Ga0070688_100559471 3300005365 Unclassified 870
41 Ga0070688_100977286 3300005365 Bacteria 671
42 Ga0070659_100209834 3300005366 Bacteria 1605
43 Ga0070667_100005970 3300005367 Bacteria 10120
44 Ga0070667_100476082 3300005367 Bacteria 1143
45 Ga0070713_100067706 3300005436 Bacteria 3007
46 Ga0070713_100284844 3300005436 Unclassified 1517
47 Ga0070700_101031232 3300005441 Bacteria 678
48 Ga0070694_100460031 3300005444 Bacteria 1006
49 Ga0070678_100002060 3300005456 Bacteria 10891
50 Ga0070662_100069312 3300005457 Unclassified 2595
51 Ga0068867_100009197 3300005459 Bacteria 6975
52 Ga0070685_10088553 3300005466 Bacteria 1870
53 Ga0070707_100344670 3300005468 Bacteria 1447
54 Ga0070699_100129607 3300005518 Bacteria 2223
55 Ga0070684_100002072 3300005535 Bacteria 14772
56 Ga0068853_100068338 3300005539 Bacteria 3089
57 Ga0068853_100395816 3300005539 Unclassified 1292
58 Ga0068853_102197448 3300005539 Bacteria 535
59 Ga0070672_100024039 3300005543 Bacteria 4495
60 Ga0070695_100674867 3300005545 Bacteria 818
61 Ga0070693_100094825 3300005547 Unclassified 1806
62 Ga0070693_101294112 3300005547 Bacteria 563
63 Ga0070665_100004791 3300005548 Bacteria 14076
64 Ga0070704_100236299 3300005549 Bacteria 1494
65 Ga0070704_100971724 3300005549 Bacteria 767
66 Ga0068855_100205204 3300005563 Bacteria 2218
67 Ga0068855_100228635 3300005563 Bacteria 2084
68 Ga0068855_102083325 3300005563 Bacteria 572
69 Ga0068857_100065980 3300005577 Bacteria 3220
70 Ga0068857_100344568 3300005577 Bacteria 1379
71 Ga0068854_100043689 3300005578 Bacteria 3178
72 Ga0068854_100876841 3300005578 Bacteria 787
73 Ga0068856_100111571 3300005614 Bacteria 2732
74 Ga0068859_100017301 3300005617 Bacteria 7240
75 Ga0068859_100574614 3300005617 Bacteria 1221
76 Ga0068864_100313622 3300005618 Bacteria 1471
77 Ga0068866_10100822 3300005718 Unclassified 1592
78 Ga0068866_10293425 3300005718 Bacteria 1012
79 Ga0068861_100070263 3300005719 Bacteria 2711
80 Ga0068861_100332250 3300005719 Bacteria 1327
81 Ga0068861_100386399 3300005719 Bacteria 1238
82 Ga0068861_101594280 3300005719 Bacteria 643
83 Ga0068861_102221032 3300005719 Bacteria 550
84 Ga0068851_10067671 3300005834 Bacteria 1842
85 Ga0068870_10035336 3300005840 Unclassified 2563
86 Ga0068860_100130839 3300005843 Bacteria 2408
87 Ga0068860_100257489 3300005843 Unclassified 1700
88 Ga0068862_100014662 3300005844 Bacteria 6510
89 Ga0068862_101246875 3300005844 Bacteria 743
90 Ga0081539_10202283 3300005985 Bacteria 916
91 Ga0070717_10000246 3300006028 Bacteria 37200
92 Ga0070716_100293837 3300006173 Bacteria 1127
93 Ga0097621_100028042 3300006237 Bacteria 4434
94 Ga0097621_102116865 3300006237 Bacteria 538
95 Ga0068871_100014223 3300006358 Bacteria 5926
96 Ga0068871_100401730 3300006358 Bacteria 1220
97 Ga0068871_100709750 3300006358 Unclassified 922
98 Ga0075428_100019909 3300006844 Bacteria 7430
99 Ga0075428_100085598 3300006844 Bacteria 3438
100 Ga0075428_100086718 3300006844 Bacteria 3415
101 Ga0075428_100405570 3300006844 Bacteria 1461
102 Ga0075430_100541700 3300006846 Bacteria 960
103 Ga0075431_100212692 3300006847 Bacteria 1975
104 Ga0075431_100602946 3300006847 Bacteria 1082
105 Ga0075431_100622108 3300006847 Bacteria 1062
106 Ga0075433_10009051 3300006852 Bacteria 7953
107 Ga0075433_10094244 3300006852 Bacteria 2650
108 Ga0075433_10226595 3300006852 Bacteria 1660
109 Ga0075429_100013793 3300006880 Bacteria 7009
110 Ga0075429_100063159 3300006880 Bacteria 3227
111 Ga0068865_100062063 3300006881 Bacteria 2622
112 Ga0068865_100672735 3300006881 Bacteria 882
113 Ga0097620_100017302 3300006931 Bacteria 7240
114 Ga0097620_100574634 3300006931 Bacteria 1221
115 Ga0105244_10024429 3300009036 Bacteria 3298
116 Ga0105240_10409390 3300009093 Bacteria 1526
117 Ga0111539_10874725 3300009094 Bacteria 1045
118 Ga0114129_10005887 3300009147 Bacteria 17366
119 Ga0114129_10033334 3300009147 Bacteria 7278
120 Ga0114129_10552736 3300009147 Bacteria 1497
121 Ga0114129_10756935 3300009147 Bacteria 1243
122 Ga0114129_11755896 3300009147 Unclassified 756
123 Ga0114129_12255877 3300009147 Bacteria 654
124 Ga0105241_10032432 3300009174 Bacteria 3916
125 Ga0105241_10246072 3300009174 Bacteria 1514
126 Ga0105242_10093666 3300009176 Unclassified 2533
127 Ga0105242_10514464 3300009176 Bacteria 1141
128 Ga0105237_11467262 3300009545 Unclassified 689
129 Ga0105249_10017974 3300009553 Bacteria 6285
130 Ga0105249_10264057 3300009553 Bacteria 1712
131 Ga0105249_10292923 3300009553 Unclassified 1630
132 Ga0105239_10008230 3300010375 Bacteria 11897
133 Ga0105239_11343343 3300010375 Bacteria 825
134 Ga0105246_10007341 3300011119 Bacteria 6753
135 Ga0105246_10725337 3300011119 Bacteria 874
136 Ga0157373_10000695 3300013100 Bacteria 26351
137 Ga0157373_10002305 3300013100 Bacteria 14484
138 Ga0157373_10037232 3300013100 Bacteria 3489
139 Ga0157373_11038962 3300013100 Bacteria 613
140 Ga0157371_10000496 3300013102 Bacteria 47702
141 Ga0157371_10001317 3300013102 Bacteria 26071
142 Ga0157371_10001448 3300013102 Bacteria 24636
143 Ga0157371_11309323 3300013102 Bacteria 561
144 Ga0157370_10010946 3300013104 Bacteria 9521
145 Ga0157370_10012390 3300013104 Bacteria 8843
146 Ga0157370_10058264 3300013104 Bacteria 3672
147 Ga0157370_10117806 3300013104 Bacteria 2481
148 Ga0157370_10146308 3300013104 Bacteria 2200
149 Ga0157370_10202284 3300013104 Bacteria 1842
150 Ga0157369_10000414 3300013105 Bacteria 56570
151 Ga0157374_10034173 3300013296 Bacteria 4642
152 Ga0157378_10012526 3300013297 Bacteria 7422
153 Ga0163162_10000343 3300013306 Bacteria 42312
154 Ga0163162_10091973 3300013306 Bacteria 3117
155 Ga0163162_10555474 3300013306 Bacteria 1276
156 Ga0157372_10641447 3300013307 Bacteria 1237
157 Ga0157372_13262919 3300013307 Bacteria 517
158 Ga0157375_10431520 3300013308 Bacteria 1484
159 Ga0157375_13038375 3300013308 Bacteria 560
160 Ga0157380_10111941 3300014326 Bacteria 2296
161 Ga0157380_11413267 3300014326 Bacteria 747
162 Ga0182008_10000022 3300014497 Bacteria 207052
163 Ga0182008_10000312 3300014497 Bacteria 38208
164 Ga0182008_10138192 3300014497 Unclassified 1218
165 Ga0182008_10299020 3300014497 Bacteria 842
166 Ga0157379_12387353 3300014968 Bacteria 527
167 Ga0182006_1000001 3300015261 Bacteria 1091090
168 Ga0182006_1000253 3300015261 Bacteria 49431
169 Ga0182006_1000929 3300015261 Bacteria 19540
170 Ga0182006_1002476 3300015261 Bacteria 10072
171 Ga0182007_10000009 3300015262 Bacteria 316298
172 Ga0183373_1013 3300015682 Bacteria 112340
173 Ga0163161_10000475 3300017792 Bacteria 33301
174 Ga0163161_10001960 3300017792 Bacteria 14971
175 Ga0163161_10027052 3300017792 Bacteria 4068
176 Ga0163161_10468726 3300017792 Bacteria 1021
177 Ga0213876_10346294 3300021384 Bacteria 790
178 Ga0207425_1000008 3300025245 Bacteria 618024
179 Ga0209129_1000042 3300025258 Bacteria 305537
180 Ga0209233_1043963 3300025261 Bacteria 949
181 Ga0209676_1000009 3300025292 Bacteria 981719
182 Ga0209025_1000020 3300025294 Bacteria 618024
183 Ga0209758_1000022 3300025297 Bacteria 618024
184 Ga0209050_1000103 3300025298 Bacteria 229225
185 Ga0207697_10019168 3300025315 Bacteria 2802
186 Ga0207655_1000045 3300025728 Bacteria 315397
187 Ga0207655_1116750 3300025728 Bacteria 891
188 Ga0207682_10007427 3300025893 Bacteria 4367
189 Ga0207688_10930528 3300025901 Bacteria 550
190 Ga0207680_10015099 3300025903 Bacteria 4021
191 Ga0207645_10001508 3300025907 Bacteria 19057
192 Ga0207643_10007398 3300025908 Bacteria 5890
193 Ga0207654_10043323 3300025911 Bacteria 2551
194 Ga0207654_10702187 3300025911 Bacteria 727
195 Ga0207671_11247408 3300025914 Unclassified 580
196 Ga0207662_10294124 3300025918 Bacteria 1078
197 Ga0207681_10031071 3300025923 Bacteria 3485
198 Ga0207681_10054660 3300025923 Bacteria 2716
199 Ga0207650_10115216 3300025925 Bacteria 2085
200 Ga0207659_10332152 3300025926 Unclassified 1257
201 Ga0207700_10528666 3300025928 Unclassified 1045
202 Ga0207644_10169618 3300025931 Bacteria 1703
203 Ga0207686_10227606 3300025934 Bacteria 1350
204 Ga0207686_10499877 3300025934 Unclassified 943
205 Ga0207669_10203383 3300025937 Unclassified 1439
206 Ga0207704_10114599 3300025938 Bacteria 1830
207 Ga0207704_10625170 3300025938 Bacteria 884
208 Ga0207665_10161681 3300025939 Bacteria 1611
209 Ga0207665_10613804 3300025939 Bacteria 850
210 Ga0207691_10023976 3300025940 Bacteria 5740
211 Ga0207689_10011428 3300025942 Bacteria 7610
212 Ga0207689_10012158 3300025942 Bacteria 7367
213 Ga0207661_10000964 3300025944 Bacteria 18942
214 Ga0207667_10134836 3300025949 Bacteria 2542
215 Ga0207667_11215680 3300025949 Bacteria 733
216 Ga0207712_10040582 3300025961 Bacteria 3195
217 Ga0207668_10077776 3300025972 Unclassified 2393
218 Ga0207658_10722680 3300025986 Bacteria 901
219 Ga0207677_10026412 3300026023 Bacteria 3640
220 Ga0207639_10181774 3300026041 Unclassified 1789
221 Ga0207639_10206945 3300026041 Bacteria 1687
222 Ga0207639_10632829 3300026041 Unclassified 989
223 Ga0207708_11706781 3300026075 Bacteria 553
224 Ga0207702_10086493 3300026078 Bacteria 2734
225 Ga0207641_11619884 3300026088 Unclassified 649
226 Ga0207648_10011758 3300026089 Bacteria 8227
227 Ga0207648_10016275 3300026089 Bacteria 6803
228 Ga0207648_10145151 3300026089 Bacteria 2093
229 Ga0207648_11300054 3300026089 Bacteria 683
230 Ga0207676_10571856 3300026095 Unclassified 1082
231 Ga0207674_10562778 3300026116 Bacteria 1101
232 Ga0207674_11679708 3300026116 Bacteria 603
233 Ga0207675_100074858 3300026118 Unclassified 3169
234 Ga0207675_100075547 3300026118 Bacteria 3154
235 Ga0207675_100476771 3300026118 Bacteria 1239
236 Ga0207675_101001383 3300026118 Unclassified 854
237 Ga0207675_102119270 3300026118 Unclassified 578
238 Ga0207675_102354441 3300026118 Bacteria 545
239 Ga0207683_10000468 3300026121 Bacteria 37569
240 Ga0207698_11486538 3300026142 Unclassified 693
241 Ga0209999_1050140 3300027543 Bacteria 788
242 Ga0268265_10025013 3300028380 Bacteria 4232
243 Ga0268264_10333014 3300028381 Unclassified 1439
244 Ga0268264_10411517 3300028381 Bacteria 1302
245 Ga0268264_10524029 3300028381 Bacteria 1159
246 Ga0268264_11204004 3300028381 Bacteria 767
247 Ga0314311_1049899 3300030733 Bacteria 917
248 Ga0265331_10385768 3300031250 Bacteria 628
249 Ga0265327_10000030 3300031251 Bacteria 333531
250 Ga0307513_10170706 3300031456 Bacteria 2053
251 Ga0307509_10136011 3300031507 Bacteria 2403
252 Ga0307405_10000036 3300031731 Bacteria 91687
253 Ga0307405_10149304 3300031731 Bacteria 1641
254 Ga0307405_10396423 3300031731 Bacteria 1079
255 Ga0307405_11040222 3300031731 Bacteria 701
256 Ga0307413_10550871 3300031824 Bacteria 935
257 Ga0307407_10000006 3300031903 Bacteria 218714
258 Ga0307412_10000001 3300031911 Bacteria 822691
259 Ga0307412_10000036 3300031911 Bacteria 192270
260 Ga0307412_10001630 3300031911 Bacteria 12375
261 Ga0307412_10022418 3300031911 Bacteria 3870
262 Ga0307412_10104684 3300031911 Bacteria 2008
263 Ga0307412_10825724 3300031911 Bacteria 807
264 Ga0307412_11066950 3300031911 Bacteria 717
265 Ga0307416_100000044 3300032002 Bacteria 127948
266 Ga0307416_100000058 3300032002 Bacteria 103674
267 Ga0307416_100216892 3300032002 Bacteria 1831
268 Ga0307416_101103489 3300032002 Bacteria 898
269 Ga0307416_102837726 3300032002 Bacteria 580
270 Ga0307414_10000268 3300032004 Bacteria 32688
271 Ga0307414_10005268 3300032004 Bacteria 7103
272 Ga0307414_10078587 3300032004 Bacteria 2405
273 Ga0307414_10094005 3300032004 Bacteria 2236
274 Ga0307414_10197931 3300032004 Bacteria 1631
275 Ga0307414_10638847 3300032004 Bacteria 958
276 Ga0307414_11702947 3300032004 Bacteria 588
277 Ga0307411_10352791 3300032005 Bacteria 1200
278 Ga0307411_10843411 3300032005 Bacteria 810
279 Ga0316214_1029360 3300033545 Unclassified 779
280 Ga0373927_0008297 3300035695 Bacteria 6993
281 Ga0436365_1075575 3300039437 Bacteria 1049
282 Ga0436360_0428284 3300039438 Bacteria 768
283 Ga0436360_0941832 3300039438 Unclassified 1311
284 Ga0436362_0383228 3300039453 Unclassified 860
285 Ga0451795_1093492 3300041456 Bacteria 820
286 Ga0451800_0412688 3300041459 Bacteria 832
287 Ga0451807_2475361 3300041486 Bacteria 679
288 Ga0451837_0551606 3300041494 Unclassified 727
289 Ga0451837_0735461 3300041494 Unclassified 657
290 Ga0451849_0812886 3300041505 Bacteria 713
291 Ga0451852_35333 3300041508 Bacteria 727
292 Ga0439445_0000813 3300042004 Bacteria 6582
293 Ga0450923_133999 3300042125 Bacteria 591
294 Ga0451577_0012556 3300042876 Bacteria 7953
295 Ga0451577_0030749 3300042876 Bacteria 4849
296 Ga0466961_0008931 3300044693 Bacteria 6395
297 Ga0453684_0000239 3300044712 Bacteria 235992
298 Ga0453684_0077866 3300044712 Bacteria 4152
299 Ga0453684_0136660 3300044712 Bacteria 2934
300 Ga0453684_1045045 3300044712 Bacteria 866
301 Ga0453684_1164139 3300044712 Archaea 811
302 Ga0466957_0060256 3300044842 Unclassified 2327
303 Ga0451576_0852688 3300045051 Bacteria 956
304 Ga0451576_1374067 3300045051 Bacteria 735
305 Ga0495627_024645 3300046453 Bacteria 1959
306 Ga0495627_073070 3300046453 Bacteria 1000
307 Ga0495607_0364380 3300046501 Bacteria 664
308 Ga0495606_0085595 3300046507 Bacteria 1950
309 Ga0495606_0479880 3300046507 Bacteria 631
310 Ga0495610_0000680 3300046512 Bacteria 32861
311 Ga0495610_0001782 3300046512 Bacteria 18811
312 Ga0495630_0963302 3300046517 Bacteria 649
313 Ga0495637_0062667 3300046520 Bacteria 1521
314 Ga0495654_0000001 3300046530 Bacteria 1513197
315 Ga0495633_0310956 3300046558 Bacteria 715
316 Ga0495599_0050915 3300046678 Bacteria 2595
317 Ga0495680_0105917 3300047322 Bacteria 2090
318 Ga0495686_0001508 3300047472 Bacteria 25068
319 Ga0495686_0181425 3300047472 Bacteria 1219
320 Ga0495686_0219897 3300047472 Bacteria 1081
321 Ga0496108_0000070 3300048911 Bacteria 115009
322 Ga0496124_0040180 3300048927 Bacteria 4049
323 Ga0496124_0857380 3300048927 Bacteria 556
324 Ga0496125_0027231 3300048928 Bacteria 5186
325 Ga0501297_035072 3300049520 Bacteria 684
326 Ga0501298_023200 3300049521 Bacteria 1174
327 Ga0501031_0365047 3300049568 Bacteria 934
328 Ga0501033_0189443 3300049570 Bacteria 1472
329 Ga0501036_1051378 3300049572 Bacteria 666
330 Ga0501040_1358225 3300049576 Bacteria 516
331 Ga0501042_0166206 3300049578 Bacteria 1592
332 Ga0501046_0379162 3300049580 Bacteria 1024
333 Ga0501071_0394134 3300049587 Bacteria 1057
334 Ga0501072_0010433 3300049588 Bacteria 7080
335 Ga0501073_0007073 3300049589 Bacteria 8361
336 Ga0501074_0873655 3300049590 Bacteria 633
337 Ga0501074_0937302 3300049590 Bacteria 609
338 Ga0501075_1456395 3300049591 Bacteria 518
339 Ga0501076_0494552 3300049592 Bacteria 1008
340 Ga0501202_036027 3300049652 Bacteria 1052
341 Ga0501207_026835 3300049654 Bacteria 951
342 Ga0501216_065893 3300049660 Bacteria 739
343 Ga0501233_268245 3300049668 Bacteria 518
344 Ga0501243_016136 3300049675 Bacteria 1204
345 Ga0501249_007618 3300049679 Bacteria 2241
346 Ga0501257_065721 3300049686 Bacteria 921
347 Ga0501221_036911 3300049704 Bacteria 1049
348 Ga0501080_0020890 3300049742 Bacteria 6059
349 Ga0501241_000109 3300049758 Bacteria 17834
350 Ga0501241_009198 3300049758 Bacteria 1800
351 Ga0501267_055975 3300049764 Bacteria 523
352 Ga0501268_009717 3300049765 Bacteria 1483
353 nmdc:mga05p37_13454_c1 3300050507 Bacteria 9804
354 nmdc:mga05p37_320978_c1 3300050507 Bacteria 1833
355 nmdc:mga05p37_60808_c1 3300050507 Bacteria 4651
356 nmdc:mga05p37_7619_c1 3300050507 Bacteria 12776
357 nmdc:mga09592_3874_c1 3300050508 Bacteria 12049
358 nmdc:mga0qj67_970274_c1 3300050509 Bacteria 668
359 nmdc:mga06r32_48593_c1 3300050510 Bacteria 4056
360 nmdc:mga08y16_35513_c1 3300050511 Bacteria 5234
361 nmdc:mga0a205_1854_c1 3300050515 Bacteria 18289
362 nmdc:mga0a205_54267_c2 3300050515 Bacteria 2464
363 nmdc:mga0a205_565782_c1 3300050515 Bacteria 991
364 nmdc:mga0a205_6425_c1 3300050515 Bacteria 9582
365 Ga0500651_0051307 3300053093 Bacteria 2586
366 Ga0500566_0051819 3300053094 Bacteria 2347
367 Ga0500555_000206 3300053103 Bacteria 27499
368 Ga0500573_0300158 3300053140 Bacteria 803
369 Ga0500645_000067 3300053730 Bacteria 81846
370 Ga0500599_007043 3300053736 Bacteria 1441
371 Ga0590071_052126 3300059421 Bacteria 993
372 Ga0501082_1005220 3300060353 Bacteria 729
373 Ga0501082_1373559 3300060353 Bacteria 617
374 Ga0530510_0500467 3300061734 Bacteria 921
375 2586209254 2585427687 Bacteria 5544917
376 2590610407 2588254257 Bacteria 5436094
377 2738701465 2738541273 Bacteria 4048577
378 2738763167 2738541284 Bacteria 5199923
379 2738854055 2738541302 Bacteria 5944758
380 2739255763 2738543014 Bacteria 4048139
381 2739587530 2739367651 Bacteria 6359826
382 2739618130 2739367656 Bacteria 5152243
383 2739646216 2739367663 Bacteria 5040914
384 2776616290 2775506987 Bacteria 5373360
385 2819545442 2818991437 Bacteria 5805520
386 2819586269 2818991444 Bacteria 6968812
387 2842086444 2842083920 Bacteria 4857652
388 2842724682 2842722452 Bacteria 6263924
389 2842911822 2842909656 Bacteria 6185908
390 2849285693 2849281842 Bacteria 6065644
391 2857631559 2857627736 Bacteria 5625397
392 2881955824 2881955468 Bacteria 3545609
393 2896115688 2896109856 Bacteria 7140722
394 2904447932 2904445276 Bacteria 5310396
395 2906000985 2905999023 Bacteria 4591259
396 2914763565 2914759650 Bacteria 4701441
397 2919191049 2919186247 Bacteria 6244071
398 2929158818 2929154850 Bacteria 6753285
399 2939669329 2939664404 Bacteria 6364494
400 2945924608 2945924605 Bacteria 4296724
401 2945998453 2945997725 Bacteria 6404843
402 2954020927 2954016120 Bacteria 6446024
403 2958515232 2958512119 Bacteria 4528530
404 2977244420 2977243572 Bacteria 4374394
405 Ga0065704_10672720
406 SwRhRL2b_contig_3370872
407 JGI24744J21845_10009846
408 JGI25152J39213_1000203
409 JGI25150J39212_1000025
410 JGI25151J46595_10000089
411 JGI25153J46596_10000079
412 rootH2_10006602
413 rootH2_10077261
414 rootH2_10111293
415 rootL2_10249439
416 rootH1_10191183
417 Ga0055536_1000010
418 Ga0055530_10001794
419 Ga0065714_10009349
420 Ga0065714_10016881
421 Ga0065714_10064503
422 Ga0065714_10068516
423 Ga0065704_10000425
424 Ga0065704_10077055
425 Ga0065704_10169486
426 Ga0065707_10087666
427 Ga0065707_10118826
428 Ga0065707_10305712
429 Ga0070676_10027426
430 Ga0070670_100041605
431 Ga0070670_100053313
432 Ga0070677_10004086
433 Ga0068869_100012061
434 Ga0070666_10002570
435 Ga0070680_100845094
436 Ga0068868_100249868
437 Ga0070668_100037918
438 Ga0070669_100686720
439 Ga0070675_101970590
440 Ga0070671_100069244
441 Ga0070671_100360582
442 Ga0070674_100010112
443 Ga0070673_100341722
444 Ga0070688_100559471
445 Ga0070688_100977286
446 Ga0070659_100209834
447 Ga0070667_100005970
448 Ga0070667_100476082
449 Ga0070713_100067706
450 Ga0070713_100284844
451 Ga0070700_101031232
452 Ga0070694_100460031
453 Ga0070678_100002060
454 Ga0070662_100069312
455 Ga0068867_100009197
456 Ga0070685_10088553
457 Ga0070707_100344670
458 Ga0070699_100129607
459 Ga0070684_100002072
460 Ga0068853_100068338
461 Ga0068853_100395816
462 Ga0068853_102197448
463 Ga0070672_100024039
464 Ga0070695_100674867
465 Ga0070693_100094825
466 Ga0070693_101294112
467 Ga0070665_100004791
468 Ga0070704_100236299
469 Ga0070704_100971724
470 Ga0068855_100205204
471 Ga0068855_100228635
472 Ga0068855_102083325
473 Ga0068857_100065980
474 Ga0068857_100344568
475 Ga0068854_100043689
476 Ga0068854_100876841
477 Ga0068856_100111571
478 Ga0068859_100017301
479 Ga0068859_100574614
480 Ga0068864_100313622
481 Ga0068866_10100822
482 Ga0068866_10293425
483 Ga0068861_100070263
484 Ga0068861_100332250
485 Ga0068861_100386399
486 Ga0068861_101594280
487 Ga0068861_102221032
488 Ga0068851_10067671
489 Ga0068870_10035336
490 Ga0068860_100130839
491 Ga0068860_100257489
492 Ga0068862_100014662
493 Ga0068862_101246875
494 Ga0081539_10202283
495 Ga0070717_10000246
496 Ga0070716_100293837
497 Ga0097621_100028042
498 Ga0097621_102116865
499 Ga0068871_100014223
500 Ga0068871_100401730
501 Ga0068871_100709750
502 Ga0075428_100019909
503 Ga0075428_100085598
504 Ga0075428_100086718
505 Ga0075428_100405570
506 Ga0075430_100541700
507 Ga0075431_100212692
508 Ga0075431_100602946
509 Ga0075431_100622108
510 Ga0075433_10009051
511 Ga0075433_10094244
512 Ga0075433_10226595
513 Ga0075429_100013793
514 Ga0075429_100063159
515 Ga0068865_100062063
516 Ga0068865_100672735
517 Ga0097620_100017302
518 Ga0097620_100574634
519 Ga0105244_10024429
520 Ga0105240_10409390
521 Ga0111539_10874725
522 Ga0114129_10005887
523 Ga0114129_10033334
524 Ga0114129_10552736
525 Ga0114129_10756935
526 Ga0114129_11755896
527 Ga0114129_12255877
528 Ga0105241_10032432
529 Ga0105241_10246072
530 Ga0105242_10093666
531 Ga0105242_10514464
532 Ga0105237_11467262
533 Ga0105249_10017974
534 Ga0105249_10264057
535 Ga0105249_10292923
536 Ga0105239_10008230
537 Ga0105239_11343343
538 Ga0105246_10007341
539 Ga0105246_10725337
540 Ga0157373_10000695
541 Ga0157373_10002305
542 Ga0157373_10037232
543 Ga0157373_11038962
544 Ga0157371_10000496
545 Ga0157371_10001317
546 Ga0157371_10001448
547 Ga0157371_11309323
548 Ga0157370_10010946
549 Ga0157370_10012390
550 Ga0157370_10058264
551 Ga0157370_10117806
552 Ga0157370_10146308
553 Ga0157370_10202284
554 Ga0157369_10000414
555 Ga0157374_10034173
556 Ga0157378_10012526
557 Ga0163162_10000343
558 Ga0163162_10091973
559 Ga0163162_10555474
560 Ga0157372_10641447
561 Ga0157372_13262919
562 Ga0157375_10431520
563 Ga0157375_13038375
564 Ga0157380_10111941
565 Ga0157380_11413267
566 Ga0182008_10000022
567 Ga0182008_10000312
568 Ga0182008_10138192
569 Ga0182008_10299020
570 Ga0157379_12387353
571 Ga0182006_1000001
572 Ga0182006_1000253
573 Ga0182006_1000929
574 Ga0182006_1002476
575 Ga0182007_10000009
576 Ga0183373_1013
577 Ga0163161_10000475
578 Ga0163161_10001960
579 Ga0163161_10027052
580 Ga0163161_10468726
581 Ga0213876_10346294
582 Ga0207425_1000008
583 Ga0209129_1000042
584 Ga0209233_1043963
585 Ga0209676_1000009
586 Ga0209025_1000020
587 Ga0209758_1000022
588 Ga0209050_1000103
589 Ga0207697_10019168
590 Ga0207655_1000045
591 Ga0207655_1116750
592 Ga0207682_10007427
593 Ga0207688_10930528
594 Ga0207680_10015099
595 Ga0207645_10001508
596 Ga0207643_10007398
597 Ga0207654_10043323
598 Ga0207654_10702187
599 Ga0207671_11247408
600 Ga0207662_10294124
601 Ga0207681_10031071
602 Ga0207681_10054660
603 Ga0207650_10115216
604 Ga0207659_10332152
605 Ga0207700_10528666
606 Ga0207644_10169618
607 Ga0207686_10227606
608 Ga0207686_10499877
609 Ga0207669_10203383
610 Ga0207704_10114599
611 Ga0207704_10625170
612 Ga0207665_10161681
613 Ga0207665_10613804
614 Ga0207691_10023976
615 Ga0207689_10011428
616 Ga0207689_10012158
617 Ga0207661_10000964
618 Ga0207667_10134836
619 Ga0207667_11215680
620 Ga0207712_10040582
621 Ga0207668_10077776
622 Ga0207658_10722680
623 Ga0207677_10026412
624 Ga0207639_10181774
625 Ga0207639_10206945
626 Ga0207639_10632829
627 Ga0207708_11706781
628 Ga0207702_10086493
629 Ga0207641_11619884
630 Ga0207648_10011758
631 Ga0207648_10016275
632 Ga0207648_10145151
633 Ga0207648_11300054
634 Ga0207676_10571856
635 Ga0207674_10562778
636 Ga0207674_11679708
637 Ga0207675_100074858
638 Ga0207675_100075547
639 Ga0207675_100476771
640 Ga0207675_101001383
641 Ga0207675_102119270
642 Ga0207675_102354441
643 Ga0207683_10000468
644 Ga0207698_11486538
645 Ga0209999_1050140
646 Ga0268265_10025013
647 Ga0268264_10333014
648 Ga0268264_10411517
649 Ga0268264_10524029
650 Ga0268264_11204004
651 Ga0314311_1049899
652 Ga0265331_10385768
653 Ga0265327_10000030
654 Ga0307513_10170706
655 Ga0307509_10136011
656 Ga0307405_10000036
657 Ga0307405_10149304
658 Ga0307405_10396423
659 Ga0307405_11040222
660 Ga0307413_10550871
661 Ga0307407_10000006
662 Ga0307412_10000001
663 Ga0307412_10000036
664 Ga0307412_10001630
665 Ga0307412_10022418
666 Ga0307412_10104684
667 Ga0307412_10825724
668 Ga0307412_11066950
669 Ga0307416_100000044
670 Ga0307416_100000058
671 Ga0307416_100216892
672 Ga0307416_101103489
673 Ga0307416_102837726
674 Ga0307414_10000268
675 Ga0307414_10005268
676 Ga0307414_10078587
677 Ga0307414_10094005
678 Ga0307414_10197931
679 Ga0307414_10638847
680 Ga0307414_11702947
681 Ga0307411_10352791
682 Ga0307411_10843411
683 Ga0316214_1029360
684 Ga0373927_0008297
685 Ga0436365_1075575
686 Ga0436360_0428284
687 Ga0436360_0941832
688 Ga0436362_0383228
689 Ga0451795_1093492
690 Ga0451800_0412688
691 Ga0451807_2475361
692 Ga0451837_0551606
693 Ga0451837_0735461
694 Ga0451849_0812886
695 Ga0451852_35333
696 Ga0439445_0000813
697 Ga0450923_133999
698 Ga0451577_0012556
699 Ga0451577_0030749
700 Ga0466961_0008931
701 Ga0453684_0000239
702 Ga0453684_0077866
703 Ga0453684_0136660
704 Ga0453684_1045045
705 Ga0453684_1164139
706 Ga0466957_0060256
707 Ga0451576_0852688
708 Ga0451576_1374067
709 Ga0495627_024645
710 Ga0495627_073070
711 Ga0495607_0364380
712 Ga0495606_0085595
713 Ga0495606_0479880
714 Ga0495610_0000680
715 Ga0495610_0001782
716 Ga0495630_0963302
717 Ga0495637_0062667
718 Ga0495654_0000001
719 Ga0495633_0310956
720 Ga0495599_0050915
721 Ga0495680_0105917
722 Ga0495686_0001508
723 Ga0495686_0181425
724 Ga0495686_0219897
725 Ga0496108_0000070
726 Ga0496124_0040180
727 Ga0496124_0857380
728 Ga0496125_0027231
729 Ga0501297_035072
730 Ga0501298_023200
731 Ga0501031_0365047
732 Ga0501033_0189443
733 Ga0501036_1051378
734 Ga0501040_1358225
735 Ga0501042_0166206
736 Ga0501046_0379162
737 Ga0501071_0394134
738 Ga0501072_0010433
739 Ga0501073_0007073
740 Ga0501074_0873655
741 Ga0501074_0937302
742 Ga0501075_1456395
743 Ga0501076_0494552
744 Ga0501202_036027
745 Ga0501207_026835
746 Ga0501216_065893
747 Ga0501233_268245
748 Ga0501243_016136
749 Ga0501249_007618
750 Ga0501257_065721
751 Ga0501221_036911
752 Ga0501080_0020890
753 Ga0501241_000109
754 Ga0501241_009198
755 Ga0501267_055975
756 Ga0501268_009717
757 nmdc:mga05p37_13454_c1
758 nmdc:mga05p37_320978_c1
759 nmdc:mga05p37_60808_c1
760 nmdc:mga05p37_7619_c1
761 nmdc:mga09592_3874_c1
762 nmdc:mga0qj67_970274_c1
763 nmdc:mga06r32_48593_c1
764 nmdc:mga08y16_35513_c1
765 nmdc:mga0a205_1854_c1
766 nmdc:mga0a205_54267_c2
767 nmdc:mga0a205_565782_c1
768 nmdc:mga0a205_6425_c1
769 Ga0500651_0051307
770 Ga0500566_0051819
771 Ga0500555_000206
772 Ga0500573_0300158
773 Ga0500645_000067
774 Ga0500599_007043
775 Ga0590071_052126
776 Ga0501082_1005220
777 Ga0501082_1373559
778 Ga0530510_0500467
779 2586209254
780 2590610407
781 2738701465
782 2738763167
783 2738854055
784 2739255763
785 2739587530
786 2739618130
787 2739646216
788 2776616290
789 2819545442
790 2819586269
791 2842086444
792 2842724682
793 2842911822
794 2849285693
795 2857631559
796 2881955824
797 2896115688
798 2904447932
799 2906000985
800 2914763565
801 2919191049
802 2929158818
803 2939669329
804 2945924608
805 2945998453
806 2954020927
807 2958515232
808 2977244420

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

31

149

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9764 1 125
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.974 2 125
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.966 5 125
3a7a-assembly1.cif.gz_B crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.9619 2 125
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9613 1 125
ID Description Score Start End Superfamily
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9656 5 125 2.40.50.100
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9634 5 123 2.40.50.100
af_Q4E4F5_6_138_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.943 5 124 2.40.50.100
af_A4IC11_1_107_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9414 20 124 2.40.50.100
af_Q9U616_24_160_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9336 2 124 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A7D4ULF5-F1-model_v4 Glycine cleavage system H protein 0.9982 1 126 GO:0005829
GO:0005960
GO:0019464
AF-I4AGP6-F1-model_v4 Glycine cleavage system H protein 0.9974 1 125 GO:0005829
GO:0005960
GO:0019464
AF-A0A060R776-F1-model_v4 Glycine cleavage system H protein 0.9962 1 125 GO:0005829
GO:0005960
GO:0019464
AF-A0A4Y1XKQ4-F1-model_v4 Glycine cleavage system H protein 0.9957 1 125 GO:0005829
GO:0005960
GO:0019464
AF-A0A350MQU8-F1-model_v4 Glycine cleavage system H protein 0.9955 1 125 GO:0005829
GO:0005960
GO:0019464

Map