F435492

General Info

Members Datasets Scaffolds Average Seq Length
403 265 806 128

Family's Representative Sequence

Representative Sequence 3300046642|Ga0495634_0035842|Ga0495634_0035842_1926_2402
Length 158
Sequence MVSCPWAPRRRPPWNSGSGPIIAGEFEGQSVAIRIVRLGSRRVKDEGLRIGTVRRPPRGVPKSEFASRDFYDVWLPGLAPSEALVKMALAAEDERSWRVFKKRYRAEMNRPDARRVLDLLAALSHSSDFSVGCYCQDESRCHRSVLRELLSERNARIA

Samples

Sample ID Description Type Environment
1 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
136 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
137 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
138 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
146 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
147 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
148 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
162 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
163 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
164 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
167 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
171 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
172 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
173 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
174 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
175 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
176 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
177 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
178 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
179 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
180 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
181 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
182 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
183 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
184 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
185 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
186 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
187 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
188 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
189 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
195 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
198 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
199 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
210 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
224 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
251 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
262 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
263 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
264 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
265 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.7
Nodule 0
Rhizoplane 2.23
Rhizosphere 88.59
Stem 0
Stem Tuber 0
Unclassified 10.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495634_0035842 3300046642 Bacteria 3395
2 rootH1_10083402 3300003316 Bacteria 1059
3 rootH1_10042107 3300003323 Bacteria 2434
4 Ga0055535_1000720 3300003761 Bacteria 25059
5 Ga0055542_1000175 3300003762 Bacteria 79760
6 Ga0055529_1000438 3300003763 Bacteria 41865
7 Ga0055534_1001261 3300003784 Bacteria 10366
8 Ga0055528_1001099 3300003790 Bacteria 17773
9 Ga0058692_1007827 3300003856 Bacteria 2801
10 Ga0065715_10733345 3300005293 Bacteria 638
11 Ga0070658_10562120 3300005327 Unclassified 987
12 Ga0070683_100846869 3300005329 Bacteria 877
13 Ga0070683_101752894 3300005329 Bacteria 597
14 Ga0070683_101826862 3300005329 Bacteria 584
15 Ga0070670_100109078 3300005331 Bacteria 2385
16 Ga0070666_10774145 3300005335 Bacteria 706
17 Ga0070680_100081217 3300005336 Bacteria 2675
18 Ga0070682_100331908 3300005337 Unclassified 1127
19 Ga0068868_100793530 3300005338 Bacteria 854
20 Ga0070689_100638341 3300005340 Bacteria 925
21 Ga0070668_100439260 3300005347 Bacteria 1120
22 Ga0070669_100071427 3300005353 Bacteria 2568
23 Ga0070675_100506053 3300005354 Bacteria 1089
24 Ga0070675_100982145 3300005354 Bacteria 775
25 Ga0070667_100989755 3300005367 Unclassified 784
26 Ga0070667_102048300 3300005367 Bacteria 539
27 Ga0070713_100000354 3300005436 Bacteria 29691
28 Ga0070705_100249087 3300005440 Bacteria 1246
29 Ga0070694_100021224 3300005444 Bacteria 4146
30 Ga0070694_100026027 3300005444 Bacteria 3789
31 Ga0070708_100520095 3300005445 Unclassified 1122
32 Ga0070662_100388934 3300005457 Bacteria 1149
33 Ga0070662_100697194 3300005457 Bacteria 859
34 Ga0070681_10659317 3300005458 Bacteria 961
35 Ga0068867_100384491 3300005459 Bacteria 1180
36 Ga0068867_101493788 3300005459 Bacteria 629
37 Ga0068867_102381849 3300005459 Bacteria 504
38 Ga0070706_100122192 3300005467 Bacteria 2427
39 Ga0070706_100932711 3300005467 Unclassified 801
40 Ga0070707_100040058 3300005468 Bacteria 4481
41 Ga0070707_100051676 3300005468 Bacteria 3940
42 Ga0070707_100510082 3300005468 Bacteria 1164
43 Ga0070698_100239763 3300005471 Bacteria 1746
44 Ga0070698_100334724 3300005471 Bacteria 1445
45 Ga0070699_100054942 3300005518 Bacteria 3448
46 Ga0070699_101401485 3300005518 Bacteria 641
47 Ga0070699_101779275 3300005518 Unclassified 564
48 Ga0070679_100008357 3300005530 Bacteria 9741
49 Ga0070679_100095364 3300005530 Bacteria 2963
50 Ga0070697_100204132 3300005536 Bacteria 1680
51 Ga0070697_100219984 3300005536 Bacteria 1618
52 Ga0070697_100222982 3300005536 Bacteria 1607
53 Ga0070686_100180821 3300005544 Bacteria 1498
54 Ga0070686_101504908 3300005544 Bacteria 567
55 Ga0070695_100003168 3300005545 Bacteria 9596
56 Ga0070695_100035780 3300005545 Bacteria 3121
57 Ga0070695_101635659 3300005545 Bacteria 538
58 Ga0070696_100440613 3300005546 Bacteria 1026
59 Ga0070696_100449300 3300005546 Bacteria 1017
60 Ga0070696_100697332 3300005546 Bacteria 827
61 Ga0070665_100079985 3300005548 Bacteria 3274
62 Ga0070665_100490997 3300005548 Bacteria 1239
63 Ga0070704_100470943 3300005549 Bacteria 1085
64 Ga0070664_100861069 3300005564 Bacteria 849
65 Ga0068857_100657755 3300005577 Unclassified 993
66 Ga0068857_101815247 3300005577 Bacteria 597
67 Ga0068852_102069580 3300005616 Bacteria 591
68 Ga0068859_100312943 3300005617 Bacteria 1664
69 Ga0068859_101291362 3300005617 Bacteria 804
70 Ga0068864_100708336 3300005618 Bacteria 984
71 Ga0068870_10032759 3300005840 Unclassified 2646
72 Ga0068870_10372651 3300005840 Bacteria 922
73 Ga0068863_101388438 3300005841 Bacteria 710
74 Ga0068858_100006857 3300005842 Bacteria 11070
75 Ga0068858_100123775 3300005842 Bacteria 2420
76 Ga0068858_100162511 3300005842 Bacteria 2103
77 Ga0068858_102313826 3300005842 Bacteria 531
78 Ga0068860_101933022 3300005843 Bacteria 611
79 Ga0068862_101623693 3300005844 Bacteria 654
80 Ga0075365_10033516 3300006038 Bacteria 3310
81 Ga0075363_100034331 3300006048 Bacteria 2647
82 Ga0075432_10379654 3300006058 Bacteria 605
83 Ga0070715_10156608 3300006163 Bacteria 1122
84 Ga0070716_100031500 3300006173 Bacteria 2885
85 Ga0075370_10403487 3300006353 Bacteria 820
86 Ga0075430_100004564 3300006846 Bacteria 11656
87 Ga0075430_100058015 3300006846 Bacteria 3255
88 Ga0075430_100492431 3300006846 Bacteria 1012
89 Ga0075430_100757187 3300006846 Archaea 800
90 Ga0075430_101468641 3300006846 Bacteria 560
91 Ga0075431_100006755 3300006847 Bacteria 11395
92 Ga0075431_100018456 3300006847 Bacteria 7104
93 Ga0075431_101221177 3300006847 Bacteria 714
94 Ga0075433_10000967 3300006852 Bacteria 20371
95 Ga0075433_10354478 3300006852 Bacteria 1296
96 Ga0075433_11011441 3300006852 Unclassified 724
97 Ga0075434_100561686 3300006871 Bacteria 1161
98 Ga0075429_100007825 3300006880 Bacteria 9284
99 Ga0075429_100010699 3300006880 Archaea 7936
100 Ga0075429_100175090 3300006880 Bacteria 1880
101 Ga0068865_100104499 3300006881 Bacteria 2079
102 Ga0068865_100736235 3300006881 Bacteria 845
103 Ga0097620_100312932 3300006931 Bacteria 1664
104 Ga0097620_101291660 3300006931 Bacteria 804
105 Ga0075435_100018263 3300007076 Bacteria 5328
106 Ga0075435_100108739 3300007076 Bacteria 2304
107 Ga0099795_10190663 3300007788 Bacteria 860
108 Ga0111539_10734861 3300009094 Bacteria 1149
109 Ga0105247_10143458 3300009101 Bacteria 1567
110 Ga0114129_10000552 3300009147 Bacteria 45946
111 Ga0114129_10166837 3300009147 Bacteria 3004
112 Ga0114129_10198764 3300009147 Bacteria 2717
113 Ga0114129_10384059 3300009147 Bacteria 1854
114 Ga0105243_10070864 3300009148 Bacteria 2816
115 Ga0105241_11034846 3300009174 Bacteria 770
116 Ga0105242_10165843 3300009176 Bacteria 1938
117 Ga0105242_10187560 3300009176 Bacteria 1829
118 Ga0105242_10706961 3300009176 Bacteria 987
119 Ga0105248_10651875 3300009177 Bacteria 1188
120 Ga0105248_11442402 3300009177 Bacteria 779
121 Ga0105248_11636103 3300009177 Unclassified 730
122 Ga0105249_10242016 3300009553 Bacteria 1784
123 Ga0157371_11310257 3300013102 Bacteria 561
124 Ga0157378_11645846 3300013297 Bacteria 688
125 Ga0163162_12463201 3300013306 Bacteria 598
126 Ga0157375_10254931 3300013308 Unclassified 1916
127 Ga0157375_11079892 3300013308 Bacteria 939
128 Ga0163163_11369158 3300014325 Bacteria 769
129 Ga0163163_11444654 3300014325 Bacteria 749
130 Ga0157380_10385330 3300014326 Bacteria 1324
131 Ga0157379_11181919 3300014968 Unclassified 735
132 Ga0157376_10191534 3300014969 Bacteria 1875
133 Ga0157376_10717278 3300014969 Unclassified 1006
134 Ga0163161_11826191 3300017792 Bacteria 541
135 Ga0213875_10564197 3300021388 Bacteria 549
136 Ga0209672_100031 3300025228 Bacteria 332889
137 Ga0209672_100158 3300025228 Bacteria 58904
138 Ga0209147_100040 3300025229 Bacteria 307612
139 Ga0209258_100061 3300025242 Bacteria 313501
140 Ga0209148_1000070 3300025254 Bacteria 332889
141 Ga0209148_1029210 3300025254 Bacteria 834
142 Ga0209759_1054810 3300025256 Bacteria 592
143 Ga0209455_1000069 3300025272 Bacteria 308247
144 Ga0209673_1000026 3300025273 Bacteria 373739
145 Ga0209673_1039739 3300025273 Bacteria 1354
146 Ga0209130_1002660 3300025284 Bacteria 8535
147 Ga0209675_1003002 3300025291 Bacteria 8302
148 Ga0209676_1006467 3300025292 Bacteria 5774
149 Ga0209025_1000229 3300025294 Bacteria 131241
150 Ga0209025_1028304 3300025294 Bacteria 2751
151 Ga0209564_1028346 3300025295 Bacteria 1793
152 Ga0209051_1007014 3300025303 Bacteria 6241
153 Ga0209257_1005865 3300025304 Bacteria 8305
154 Ga0207653_10002028 3300025885 Bacteria 6463
155 Ga0207692_10743717 3300025898 Bacteria 639
156 Ga0207710_10082361 3300025900 Bacteria 1494
157 Ga0207710_10143264 3300025900 Bacteria 1155
158 Ga0207680_10699346 3300025903 Bacteria 726
159 Ga0207643_10345506 3300025908 Bacteria 933
160 Ga0207684_10038428 3300025910 Bacteria 4061
161 Ga0207684_10449456 3300025910 Bacteria 1106
162 Ga0207684_11086931 3300025910 Bacteria 666
163 Ga0207654_10616155 3300025911 Bacteria 775
164 Ga0207707_10029345 3300025912 Bacteria 4807
165 Ga0207693_10325891 3300025915 Bacteria 1202
166 Ga0207657_10544617 3300025919 Bacteria 907
167 Ga0207649_11159119 3300025920 Bacteria 610
168 Ga0207652_10416656 3300025921 Bacteria 1211
169 Ga0207652_11345208 3300025921 Bacteria 617
170 Ga0207646_10011420 3300025922 Bacteria 8609
171 Ga0207646_10018289 3300025922 Bacteria 6540
172 Ga0207646_10036978 3300025922 Bacteria 4403
173 Ga0207646_10443280 3300025922 Bacteria 1172
174 Ga0207681_10222479 3300025923 Bacteria 1461
175 Ga0207681_10274454 3300025923 Bacteria 1325
176 Ga0207650_10079690 3300025925 Bacteria 2481
177 Ga0207659_10242189 3300025926 Bacteria 1460
178 Ga0207659_10766199 3300025926 Bacteria 828
179 Ga0207700_10000042 3300025928 Bacteria 95374
180 Ga0207644_11410717 3300025931 Bacteria 585
181 Ga0207686_10073723 3300025934 Bacteria 2203
182 Ga0207704_10020973 3300025938 Bacteria 3470
183 Ga0207665_10007963 3300025939 Bacteria 6997
184 Ga0207691_10469969 3300025940 Bacteria 1069
185 Ga0207661_10877429 3300025944 Bacteria 826
186 Ga0207661_11488084 3300025944 Bacteria 621
187 Ga0207668_10643186 3300025972 Bacteria 928
188 Ga0207677_10736802 3300026023 Bacteria 877
189 Ga0207703_10127035 3300026035 Bacteria 2197
190 Ga0207703_10190744 3300026035 Bacteria 1815
191 Ga0207703_10475848 3300026035 Bacteria 1170
192 Ga0207703_10894171 3300026035 Bacteria 850
193 Ga0207678_10108609 3300026067 Bacteria 2367
194 Ga0207641_10058462 3300026088 Bacteria 3281
195 Ga0207648_10026476 3300026089 Bacteria 5153
196 Ga0207648_10976383 3300026089 Bacteria 793
197 Ga0207676_10735276 3300026095 Bacteria 958
198 Ga0207675_100339824 3300026118 Bacteria 1469
199 Ga0207675_101807396 3300026118 Unclassified 630
200 Ga0207698_10992911 3300026142 Bacteria 850
201 Ga0209371_1000585 3300027312 Bacteria 32773
202 Ga0210000_1067302 3300027462 Bacteria 582
203 Ga0209970_1010076 3300027614 Bacteria 1544
204 Ga0268266_10517064 3300028379 Unclassified 1141
205 Ga0268266_11253695 3300028379 Bacteria 717
206 Ga0268265_12266984 3300028380 Unclassified 550
207 Ga0268256_1000178 3300030500 Bacteria 75065
208 Ga0265328_10011955 3300031239 Bacteria 3461
209 Ga0265329_10070536 3300031242 Bacteria 1105
210 Ga0265340_10044965 3300031247 Bacteria 2159
211 Ga0265339_10012437 3300031249 Bacteria 5199
212 Ga0265331_10025356 3300031250 Bacteria 2994
213 Ga0265331_10047189 3300031250 Bacteria 2073
214 Ga0265327_10000282 3300031251 Bacteria 100324
215 Ga0265316_10010647 3300031344 Bacteria 8361
216 Ga0307509_10162174 3300031507 Bacteria 2131
217 Ga0307408_100040742 3300031548 Bacteria 3290
218 Ga0307408_100240446 3300031548 Bacteria 1488
219 Ga0307408_100487240 3300031548 Bacteria 1077
220 Ga0307408_100993024 3300031548 Bacteria 773
221 Ga0307408_101883843 3300031548 Bacteria 573
222 Ga0316575_10007284 3300031665 Bacteria 4005
223 Ga0316575_10477815 3300031665 Unclassified 539
224 Ga0316579_10037400 3300031691 Bacteria 2242
225 Ga0316576_10001304 3300031727 Bacteria 13233
226 Ga0316576_10161294 3300031727 Unclassified 1691
227 Ga0316578_10000583 3300031728 Bacteria 12670
228 Ga0307405_10467434 3300031731 Bacteria 1004
229 Ga0316577_10012682 3300031733 Bacteria 4596
230 Ga0316577_10013263 3300031733 Unclassified 4502
231 Ga0316577_10235348 3300031733 Bacteria 1036
232 Ga0307413_10390595 3300031824 Bacteria 1087
233 Ga0307410_11472399 3300031852 Bacteria 599
234 Ga0307406_10135123 3300031901 Bacteria 1737
235 Ga0307406_10246185 3300031901 Bacteria 1344
236 Ga0307406_10369603 3300031901 Bacteria 1127
237 Ga0307407_10915216 3300031903 Bacteria 674
238 Ga0307412_10144973 3300031911 Bacteria 1744
239 Ga0307409_100805673 3300031995 Bacteria 947
240 Ga0307416_100063751 3300032002 Bacteria 3020
241 Ga0307416_100174355 3300032002 Bacteria 2007
242 Ga0307416_100388102 3300032002 Bacteria 1429
243 Ga0307416_100704264 3300032002 Bacteria 1099
244 Ga0307414_10745766 3300032004 Bacteria 890
245 Ga0307411_10239405 3300032005 Bacteria 1420
246 Ga0307415_100126086 3300032126 Bacteria 1930
247 Ga0307415_100364492 3300032126 Bacteria 1221
248 Ga0316583_10001868 3300032133 Bacteria 7174
249 Ga0316583_10010255 3300032133 Bacteria 3376
250 Ga0316583_10055600 3300032133 Bacteria 1391
251 Ga0316583_10060776 3300032133 Bacteria 1324
252 Ga0316583_10202308 3300032133 Unclassified 689
253 Ga0316585_10028139 3300032137 Bacteria 1757
254 Ga0373940_0019784 3300035088 Bacteria 1704
255 Ga0373939_0352772 3300035114 Bacteria 599
256 Ga0373955_0474470 3300035172 Bacteria 763
257 Ga0373955_0529265 3300035172 Unclassified 720
258 Ga0373962_0121506 3300035242 Bacteria 833
259 Ga0316574_0539047 3300035398 Unclassified 725
260 Ga0316574_0805695 3300035398 Bacteria 571
261 Ga0373933_0286345 3300035724 Bacteria 1065
262 Ga0373937_0023569 3300036401 Bacteria 5544
263 Ga0373937_0213667 3300036401 Bacteria 1815
264 Ga0373937_0226504 3300036401 Unclassified 1760
265 Ga0373937_0540548 3300036401 Bacteria 1107
266 Ga0316582_0059091 3300036647 Bacteria 2454
267 Ga0316582_0070159 3300036647 Bacteria 2267
268 Ga0316584_0001283 3300036712 Bacteria 14826
269 Ga0316584_0074583 3300036712 Unclassified 2543
270 Ga0316584_0527678 3300036712 Bacteria 827
271 Ga0316581_0036677 3300037588 Bacteria 1488
272 Ga0316581_0062895 3300037588 Bacteria 1139
273 Ga0436364_0694530 3300037853 Bacteria 513
274 Ga0436365_1531831 3300039437 Bacteria 2989
275 Ga0436362_0282121 3300039453 Bacteria 561
276 Ga0439436_0023208 3300041404 Bacteria 1835
277 Ga0451798_1171161 3300041458 Bacteria 545
278 Ga0451802_0371975 3300041460 Bacteria 733
279 Ga0439433_0031390 3300041999 Bacteria 1216
280 Ga0439445_0024223 3300042004 Bacteria 1541
281 Ga0439445_0082138 3300042004 Bacteria 901
282 Ga0439449_0000431 3300042007 Bacteria 15498
283 Ga0439457_131763 3300042014 Bacteria 595
284 Ga0439462_0135186 3300042015 Bacteria 689
285 Ga0450911_006099 3300042115 Bacteria 1813
286 Ga0450888_010230 3300042126 Bacteria 1084
287 Ga0450890_020359 3300042127 Bacteria 898
288 Ga0439446_0196119 3300042156 Bacteria 680
289 Ga0439435_0089072 3300042436 Bacteria 935
290 Ga0439435_0152612 3300042436 Bacteria 742
291 Ga0439435_0193878 3300042436 Bacteria 667
292 Ga0439444_0160044 3300042437 Bacteria 549
293 Ga0451577_0098902 3300042876 Unclassified 2606
294 Ga0453683_0103786 3300044673 Bacteria 1785
295 Ga0466966_0163012 3300044684 Unclassified 1357
296 Ga0466961_0472673 3300044693 Unclassified 758
297 Ga0453684_0039842 3300044712 Bacteria 6392
298 Ga0466971_0566150 3300044719 Unclassified 565
299 Ga0466958_0319957 3300045836 Unclassified 997
300 Ga0495591_164102 3300046458 Bacteria 531
301 Ga0495638_0000483 3300046460 Bacteria 47826
302 Ga0495650_0116307 3300046471 Bacteria 988
303 Ga0495580_0070033 3300046472 Bacteria 2450
304 Ga0495585_0266754 3300046492 Bacteria 850
305 Ga0495606_0011141 3300046507 Bacteria 7369
306 Ga0495630_0234443 3300046517 Unclassified 1402
307 Ga0495640_0624924 3300046533 Unclassified 649
308 Ga0495640_0664129 3300046533 Bacteria 627
309 Ga0495587_0095476 3300046536 Unclassified 1716
310 Ga0495625_0073040 3300046660 Bacteria 2405
311 Ga0495635_0041959 3300046663 Bacteria 3161
312 Ga0495657_0220046 3300046675 Unclassified 1151
313 Ga0495599_0147514 3300046678 Unclassified 1458
314 Ga0495623_0367225 3300046679 Bacteria 781
315 Ga0495658_0387600 3300046683 Bacteria 890
316 Ga0495613_0033244 3300046689 Bacteria 3833
317 Ga0495674_0341963 3300047319 Unclassified 1216
318 Ga0495672_0177084 3300047320 Bacteria 1083
319 Ga0496100_0158574 3300048903 Bacteria 1620
320 Ga0496101_0566544 3300048904 Bacteria 898
321 Ga0496105_0119838 3300048908 Bacteria 2170
322 Ga0496105_0572836 3300048908 Unclassified 879
323 Ga0496110_1735153 3300048913 Unclassified 534
324 Ga0496114_0724668 3300048917 Bacteria 871
325 Ga0496115_0661958 3300048918 Bacteria 824
326 Ga0496118_0232345 3300048921 Bacteria 1063
327 Ga0496121_0047807 3300048924 Bacteria 3647
328 Ga0466983_0206619 3300048986 Bacteria 1561
329 Ga0501031_0118480 3300049568 Bacteria 1730
330 Ga0501033_0140332 3300049570 Bacteria 1747
331 Ga0501036_0027699 3300049572 Bacteria 4789
332 Ga0501037_0503044 3300049573 Bacteria 822
333 Ga0501038_0133589 3300049574 Bacteria 2035
334 Ga0501039_0630139 3300049575 Bacteria 840
335 Ga0501040_0411986 3300049576 Bacteria 971
336 Ga0501040_0469353 3300049576 Bacteria 906
337 Ga0501041_0046606 3300049577 Bacteria 2638
338 Ga0501041_0495799 3300049577 Bacteria 777
339 Ga0501042_0029284 3300049578 Bacteria 3883
340 Ga0501042_0089496 3300049578 Bacteria 2209
341 Ga0501043_0122594 3300049579 Bacteria 2039
342 Ga0501046_0153734 3300049580 Bacteria 1735
343 Ga0501047_0375793 3300049581 Bacteria 1256
344 Ga0501048_0023293 3300049582 Bacteria 4528
345 Ga0501068_0273848 3300049584 Bacteria 1078
346 Ga0501070_0108285 3300049586 Bacteria 2296
347 Ga0501071_0459069 3300049587 Bacteria 975
348 Ga0501075_0026939 3300049591 Bacteria 4234
349 Ga0501075_0464534 3300049591 Bacteria 965
350 Ga0501076_0024394 3300049592 Bacteria 4674
351 Ga0501076_0030628 3300049592 Bacteria 4192
352 Ga0501077_0019926 3300049593 Bacteria 4244
353 Ga0501077_0437378 3300049593 Bacteria 837
354 Ga0501233_169037 3300049668 Bacteria 620
355 Ga0501079_0151321 3300049741 Bacteria 1809
356 Ga0501079_0543114 3300049741 Bacteria 914
357 Ga0501079_1365861 3300049741 Unclassified 558
358 Ga0501080_0038884 3300049742 Bacteria 4440
359 Ga0501080_0131850 3300049742 Bacteria 2314
360 Ga0501080_0250770 3300049742 Bacteria 1614
361 Ga0501083_0398352 3300049744 Bacteria 896
362 Ga0501083_0967878 3300049744 Bacteria 554
363 Ga0501283_097452 3300049779 Bacteria 569
364 Ga0501044_0484989 3300049823 Bacteria 1139
365 Ga0501044_0610201 3300049823 Bacteria 983
366 Ga0501045_0023152 3300049824 Bacteria 4451
367 Ga0501045_0032038 3300049824 Bacteria 3808
368 Ga0501045_0662516 3300049824 Bacteria 771
369 nmdc:mga03n38_182151_c1 3300050490 Bacteria 1077
370 nmdc:mga0yw44_34333_c1 3300050492 Bacteria 2971
371 nmdc:mga05p37_148012_c1 3300050507 Bacteria 2874
372 nmdc:mga05p37_284676_c1 3300050507 Bacteria 1970
373 nmdc:mga05p37_4214_c1 3300050507 Bacteria 16799
374 nmdc:mga05p37_422701_c1 3300050507 Bacteria 1550
375 nmdc:mga05p37_60209_c1 3300050507 Bacteria 4676
376 nmdc:mga05p37_81143_c1 3300050507 Bacteria 3995
377 nmdc:mga09592_3502_c1 3300050508 Bacteria 12673
378 nmdc:mga09592_84197_c1 3300050508 Bacteria 2711
379 nmdc:mga0qj67_1314795_c1 3300050509 Bacteria 560
380 nmdc:mga0qj67_24582_c1 3300050509 Bacteria 4646
381 nmdc:mga0qj67_574633_c1 3300050509 Bacteria 903
382 nmdc:mga06r32_2063_c1 3300050510 Bacteria 17981
383 nmdc:mga06r32_27940_c1 3300050510 Bacteria 5277
384 nmdc:mga0n895_183228_c1 3300050512 Bacteria 2126
385 nmdc:mga0n895_3863_c1 3300050512 Bacteria 12163
386 nmdc:mga0n895_588406_c1 3300050512 Bacteria 1116
387 nmdc:mga0n895_955986_c1 3300050512 Bacteria 840
388 nmdc:mga0rr50_134861_c1 3300050513 Bacteria 1981
389 nmdc:mga0rr50_16423_c1 3300050513 Bacteria 4918
390 nmdc:mga0rr50_309847_c1 3300050513 Bacteria 1322
391 nmdc:mga08x19_120378_c1 3300050514 Bacteria 1759
392 nmdc:mga08x19_1627_c1 3300050514 Bacteria 13903
393 nmdc:mga0a205_222266_c1 3300050515 Bacteria 1774
394 nmdc:mga0a205_70517_c1 3300050515 Unclassified 3375
395 nmdc:mga0a205_914083_c1 3300050515 Unclassified 724
396 Ga0495601_0141260 3300053077 Unclassified 1571
397 Ga0495595_0041818 3300053084 Bacteria 2099
398 Ga0495619_0017209 3300053085 Bacteria 4578
399 Ga0501084_0111723 3300054114 Bacteria 2296
400 Ga0501084_0261876 3300054114 Bacteria 1460
401 Ga0501084_0414963 3300054114 Bacteria 1138
402 Ga0466962_0157076 3300061719 Bacteria 1105
403 Ga0530510_0319290 3300061734 Bacteria 1164
404 Ga0495634_0035842
405 rootH1_10083402
406 rootH1_10042107
407 Ga0055535_1000720
408 Ga0055542_1000175
409 Ga0055529_1000438
410 Ga0055534_1001261
411 Ga0055528_1001099
412 Ga0058692_1007827
413 Ga0065715_10733345
414 Ga0070658_10562120
415 Ga0070683_100846869
416 Ga0070683_101752894
417 Ga0070683_101826862
418 Ga0070670_100109078
419 Ga0070666_10774145
420 Ga0070680_100081217
421 Ga0070682_100331908
422 Ga0068868_100793530
423 Ga0070689_100638341
424 Ga0070668_100439260
425 Ga0070669_100071427
426 Ga0070675_100506053
427 Ga0070675_100982145
428 Ga0070667_100989755
429 Ga0070667_102048300
430 Ga0070713_100000354
431 Ga0070705_100249087
432 Ga0070694_100021224
433 Ga0070694_100026027
434 Ga0070708_100520095
435 Ga0070662_100388934
436 Ga0070662_100697194
437 Ga0070681_10659317
438 Ga0068867_100384491
439 Ga0068867_101493788
440 Ga0068867_102381849
441 Ga0070706_100122192
442 Ga0070706_100932711
443 Ga0070707_100040058
444 Ga0070707_100051676
445 Ga0070707_100510082
446 Ga0070698_100239763
447 Ga0070698_100334724
448 Ga0070699_100054942
449 Ga0070699_101401485
450 Ga0070699_101779275
451 Ga0070679_100008357
452 Ga0070679_100095364
453 Ga0070697_100204132
454 Ga0070697_100219984
455 Ga0070697_100222982
456 Ga0070686_100180821
457 Ga0070686_101504908
458 Ga0070695_100003168
459 Ga0070695_100035780
460 Ga0070695_101635659
461 Ga0070696_100440613
462 Ga0070696_100449300
463 Ga0070696_100697332
464 Ga0070665_100079985
465 Ga0070665_100490997
466 Ga0070704_100470943
467 Ga0070664_100861069
468 Ga0068857_100657755
469 Ga0068857_101815247
470 Ga0068852_102069580
471 Ga0068859_100312943
472 Ga0068859_101291362
473 Ga0068864_100708336
474 Ga0068870_10032759
475 Ga0068870_10372651
476 Ga0068863_101388438
477 Ga0068858_100006857
478 Ga0068858_100123775
479 Ga0068858_100162511
480 Ga0068858_102313826
481 Ga0068860_101933022
482 Ga0068862_101623693
483 Ga0075365_10033516
484 Ga0075363_100034331
485 Ga0075432_10379654
486 Ga0070715_10156608
487 Ga0070716_100031500
488 Ga0075370_10403487
489 Ga0075430_100004564
490 Ga0075430_100058015
491 Ga0075430_100492431
492 Ga0075430_100757187
493 Ga0075430_101468641
494 Ga0075431_100006755
495 Ga0075431_100018456
496 Ga0075431_101221177
497 Ga0075433_10000967
498 Ga0075433_10354478
499 Ga0075433_11011441
500 Ga0075434_100561686
501 Ga0075429_100007825
502 Ga0075429_100010699
503 Ga0075429_100175090
504 Ga0068865_100104499
505 Ga0068865_100736235
506 Ga0097620_100312932
507 Ga0097620_101291660
508 Ga0075435_100018263
509 Ga0075435_100108739
510 Ga0099795_10190663
511 Ga0111539_10734861
512 Ga0105247_10143458
513 Ga0114129_10000552
514 Ga0114129_10166837
515 Ga0114129_10198764
516 Ga0114129_10384059
517 Ga0105243_10070864
518 Ga0105241_11034846
519 Ga0105242_10165843
520 Ga0105242_10187560
521 Ga0105242_10706961
522 Ga0105248_10651875
523 Ga0105248_11442402
524 Ga0105248_11636103
525 Ga0105249_10242016
526 Ga0157371_11310257
527 Ga0157378_11645846
528 Ga0163162_12463201
529 Ga0157375_10254931
530 Ga0157375_11079892
531 Ga0163163_11369158
532 Ga0163163_11444654
533 Ga0157380_10385330
534 Ga0157379_11181919
535 Ga0157376_10191534
536 Ga0157376_10717278
537 Ga0163161_11826191
538 Ga0213875_10564197
539 Ga0209672_100031
540 Ga0209672_100158
541 Ga0209147_100040
542 Ga0209258_100061
543 Ga0209148_1000070
544 Ga0209148_1029210
545 Ga0209759_1054810
546 Ga0209455_1000069
547 Ga0209673_1000026
548 Ga0209673_1039739
549 Ga0209130_1002660
550 Ga0209675_1003002
551 Ga0209676_1006467
552 Ga0209025_1000229
553 Ga0209025_1028304
554 Ga0209564_1028346
555 Ga0209051_1007014
556 Ga0209257_1005865
557 Ga0207653_10002028
558 Ga0207692_10743717
559 Ga0207710_10082361
560 Ga0207710_10143264
561 Ga0207680_10699346
562 Ga0207643_10345506
563 Ga0207684_10038428
564 Ga0207684_10449456
565 Ga0207684_11086931
566 Ga0207654_10616155
567 Ga0207707_10029345
568 Ga0207693_10325891
569 Ga0207657_10544617
570 Ga0207649_11159119
571 Ga0207652_10416656
572 Ga0207652_11345208
573 Ga0207646_10011420
574 Ga0207646_10018289
575 Ga0207646_10036978
576 Ga0207646_10443280
577 Ga0207681_10222479
578 Ga0207681_10274454
579 Ga0207650_10079690
580 Ga0207659_10242189
581 Ga0207659_10766199
582 Ga0207700_10000042
583 Ga0207644_11410717
584 Ga0207686_10073723
585 Ga0207704_10020973
586 Ga0207665_10007963
587 Ga0207691_10469969
588 Ga0207661_10877429
589 Ga0207661_11488084
590 Ga0207668_10643186
591 Ga0207677_10736802
592 Ga0207703_10127035
593 Ga0207703_10190744
594 Ga0207703_10475848
595 Ga0207703_10894171
596 Ga0207678_10108609
597 Ga0207641_10058462
598 Ga0207648_10026476
599 Ga0207648_10976383
600 Ga0207676_10735276
601 Ga0207675_100339824
602 Ga0207675_101807396
603 Ga0207698_10992911
604 Ga0209371_1000585
605 Ga0210000_1067302
606 Ga0209970_1010076
607 Ga0268266_10517064
608 Ga0268266_11253695
609 Ga0268265_12266984
610 Ga0268256_1000178
611 Ga0265328_10011955
612 Ga0265329_10070536
613 Ga0265340_10044965
614 Ga0265339_10012437
615 Ga0265331_10025356
616 Ga0265331_10047189
617 Ga0265327_10000282
618 Ga0265316_10010647
619 Ga0307509_10162174
620 Ga0307408_100040742
621 Ga0307408_100240446
622 Ga0307408_100487240
623 Ga0307408_100993024
624 Ga0307408_101883843
625 Ga0316575_10007284
626 Ga0316575_10477815
627 Ga0316579_10037400
628 Ga0316576_10001304
629 Ga0316576_10161294
630 Ga0316578_10000583
631 Ga0307405_10467434
632 Ga0316577_10012682
633 Ga0316577_10013263
634 Ga0316577_10235348
635 Ga0307413_10390595
636 Ga0307410_11472399
637 Ga0307406_10135123
638 Ga0307406_10246185
639 Ga0307406_10369603
640 Ga0307407_10915216
641 Ga0307412_10144973
642 Ga0307409_100805673
643 Ga0307416_100063751
644 Ga0307416_100174355
645 Ga0307416_100388102
646 Ga0307416_100704264
647 Ga0307414_10745766
648 Ga0307411_10239405
649 Ga0307415_100126086
650 Ga0307415_100364492
651 Ga0316583_10001868
652 Ga0316583_10010255
653 Ga0316583_10055600
654 Ga0316583_10060776
655 Ga0316583_10202308
656 Ga0316585_10028139
657 Ga0373940_0019784
658 Ga0373939_0352772
659 Ga0373955_0474470
660 Ga0373955_0529265
661 Ga0373962_0121506
662 Ga0316574_0539047
663 Ga0316574_0805695
664 Ga0373933_0286345
665 Ga0373937_0023569
666 Ga0373937_0213667
667 Ga0373937_0226504
668 Ga0373937_0540548
669 Ga0316582_0059091
670 Ga0316582_0070159
671 Ga0316584_0001283
672 Ga0316584_0074583
673 Ga0316584_0527678
674 Ga0316581_0036677
675 Ga0316581_0062895
676 Ga0436364_0694530
677 Ga0436365_1531831
678 Ga0436362_0282121
679 Ga0439436_0023208
680 Ga0451798_1171161
681 Ga0451802_0371975
682 Ga0439433_0031390
683 Ga0439445_0024223
684 Ga0439445_0082138
685 Ga0439449_0000431
686 Ga0439457_131763
687 Ga0439462_0135186
688 Ga0450911_006099
689 Ga0450888_010230
690 Ga0450890_020359
691 Ga0439446_0196119
692 Ga0439435_0089072
693 Ga0439435_0152612
694 Ga0439435_0193878
695 Ga0439444_0160044
696 Ga0451577_0098902
697 Ga0453683_0103786
698 Ga0466966_0163012
699 Ga0466961_0472673
700 Ga0453684_0039842
701 Ga0466971_0566150
702 Ga0466958_0319957
703 Ga0495591_164102
704 Ga0495638_0000483
705 Ga0495650_0116307
706 Ga0495580_0070033
707 Ga0495585_0266754
708 Ga0495606_0011141
709 Ga0495630_0234443
710 Ga0495640_0624924
711 Ga0495640_0664129
712 Ga0495587_0095476
713 Ga0495625_0073040
714 Ga0495635_0041959
715 Ga0495657_0220046
716 Ga0495599_0147514
717 Ga0495623_0367225
718 Ga0495658_0387600
719 Ga0495613_0033244
720 Ga0495674_0341963
721 Ga0495672_0177084
722 Ga0496100_0158574
723 Ga0496101_0566544
724 Ga0496105_0119838
725 Ga0496105_0572836
726 Ga0496110_1735153
727 Ga0496114_0724668
728 Ga0496115_0661958
729 Ga0496118_0232345
730 Ga0496121_0047807
731 Ga0466983_0206619
732 Ga0501031_0118480
733 Ga0501033_0140332
734 Ga0501036_0027699
735 Ga0501037_0503044
736 Ga0501038_0133589
737 Ga0501039_0630139
738 Ga0501040_0411986
739 Ga0501040_0469353
740 Ga0501041_0046606
741 Ga0501041_0495799
742 Ga0501042_0029284
743 Ga0501042_0089496
744 Ga0501043_0122594
745 Ga0501046_0153734
746 Ga0501047_0375793
747 Ga0501048_0023293
748 Ga0501068_0273848
749 Ga0501070_0108285
750 Ga0501071_0459069
751 Ga0501075_0026939
752 Ga0501075_0464534
753 Ga0501076_0024394
754 Ga0501076_0030628
755 Ga0501077_0019926
756 Ga0501077_0437378
757 Ga0501233_169037
758 Ga0501079_0151321
759 Ga0501079_0543114
760 Ga0501079_1365861
761 Ga0501080_0038884
762 Ga0501080_0131850
763 Ga0501080_0250770
764 Ga0501083_0398352
765 Ga0501083_0967878
766 Ga0501283_097452
767 Ga0501044_0484989
768 Ga0501044_0610201
769 Ga0501045_0023152
770 Ga0501045_0032038
771 Ga0501045_0662516
772 nmdc:mga03n38_182151_c1
773 nmdc:mga0yw44_34333_c1
774 nmdc:mga05p37_148012_c1
775 nmdc:mga05p37_284676_c1
776 nmdc:mga05p37_4214_c1
777 nmdc:mga05p37_422701_c1
778 nmdc:mga05p37_60209_c1
779 nmdc:mga05p37_81143_c1
780 nmdc:mga09592_3502_c1
781 nmdc:mga09592_84197_c1
782 nmdc:mga0qj67_1314795_c1
783 nmdc:mga0qj67_24582_c1
784 nmdc:mga0qj67_574633_c1
785 nmdc:mga06r32_2063_c1
786 nmdc:mga06r32_27940_c1
787 nmdc:mga0n895_183228_c1
788 nmdc:mga0n895_3863_c1
789 nmdc:mga0n895_588406_c1
790 nmdc:mga0n895_955986_c1
791 nmdc:mga0rr50_134861_c1
792 nmdc:mga0rr50_16423_c1
793 nmdc:mga0rr50_309847_c1
794 nmdc:mga08x19_120378_c1
795 nmdc:mga08x19_1627_c1
796 nmdc:mga0a205_222266_c1
797 nmdc:mga0a205_70517_c1
798 nmdc:mga0a205_914083_c1
799 Ga0495601_0141260
800 Ga0495595_0041818
801 Ga0495619_0017209
802 Ga0501084_0111723
803 Ga0501084_0261876
804 Ga0501084_0414963
805 Ga0466962_0157076
806 Ga0530510_0319290

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22751

DUF488-N3a

Active DUF488-N3 subclade

33

154

0.98

PF04343

DUF488

Domain of unknown function DUF488

34

150

0.88

PF22752

DUF488-N3i

Inactive DUF488-N3 subclade

32

158

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2owu-assembly1.cif.gz_B crystal structure of ph0725 from pyrococcus horikoshii ot3 0.5995 1 128
2hut-assembly1.cif.gz_A crystal structure of ph0725 from pyrococcus horikoshii ot3 0.5974 1 128
2dsh-assembly1.cif.gz_A crystal structure of lys26 to tyr mutant of diphthine synthase 0.5965 1 128
2huq-assembly1.cif.gz_A crystal structure of ph0725 from pyrococcus horikoshii ot3 0.5963 1 128
2el0-assembly1.cif.gz_B structural study of project id ph0725 from pyrococcus horikoshii ot3 (l21m) 0.5933 1 128
ID Description Score Start End Superfamily
af_K7V4Q1_89_225_1.20.58.740 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;DOCK DHR2 domain, lobe C 0.693 53 85 1.20.58.740
af_Q2G0R8_1016_1167_3.90.1150.50 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Transcription-repair-coupling factor, D7 domain 0.6221 53 91 3.90.1150.50
1wngA01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.5974 1 128 3.40.1010.10
1wngA01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.5728 1 128 3.40.1010.10
af_K7MIR4_1_151_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5701 52 92 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A157ZQZ9-F1-model_v4 DUF488 domain-containing protein 0.9974 1 128
AF-A0A375BAR4-F1-model_v4 deleted 0.9973 1 128
AF-A0A375J012-F1-model_v4 DUF488 domain-containing protein 0.9956 1 128
AF-A0A157Z7I5-F1-model_v4 DUF488 domain-containing protein 0.9955 1 126
AF-A0A519ZC59-F1-model_v4 DUF488 family protein 0.9955 21 128

Map