F435471

General Info

Members Datasets Scaffolds Average Seq Length
403 230 379 209

Family's Representative Sequence

Representative Sequence 3300044901|Ga0466960_0150664|Ga0466960_0150664_409_1125
Length 238
Sequence MARHRAGPGESSATVGDAAGVGSVDGVAQVVVLDYGTGNIRSAERALARVGADVTVTADFATAMEADGLVVPGVGAFAACMAGLRAVEGPRLIGRRLAGGRPVLGICVGMQVLFEHGVEHGQDTEGCGEWPGVVEQLKAPVLPHMGWNTVQAPASSTLFAGLADARFYFVHSYGVRDFPLGAEGPPSRLAPPLVTWAEHGDRFVAGVENAALSATQFHPEKSGDAGAQLLSNWLGTLR

Samples

Sample ID Description Type Environment
1 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
2 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
3 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
4 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
5 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
6 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
7 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
8 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
9 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
10 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
11 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
12 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
13 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
14 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
15 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
16 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
17 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
18 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
19 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
20 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
21 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
22 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
74 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
107 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
108 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
109 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
110 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
124 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
125 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
126 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
137 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
138 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
139 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
140 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
170 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
171 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
183 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
192 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
195 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
217 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
220 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
221 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
222 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
223 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
224 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
225 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
226 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
227 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
230 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.8
Metatranscriptomes 1.24
Isolates 5.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.96
Nodule 0
Rhizoplane 1.99
Rhizosphere 80.65
Stem 0
Stem Tuber 0
Unclassified 11.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10007386 3300005327 Bacteria 8880
2 Ga0070658_10054159 3300005327 Bacteria 3257
3 Ga0070658_10115451 3300005327 Bacteria 2227
4 Ga0070658_10390091 3300005327 Bacteria 1195
5 Ga0070683_100025595 3300005329 Bacteria 5302
6 Ga0070683_100240711 3300005329 Bacteria 1721
7 Ga0070690_100461114 3300005330 Bacteria 944
8 Ga0070690_100782026 3300005330 Bacteria 739
9 Ga0070680_100142119 3300005336 Bacteria 2013
10 Ga0070680_100503329 3300005336 Bacteria 1037
11 Ga0070682_101068400 3300005337 Bacteria 674
12 Ga0068868_100007705 3300005338 Bacteria 7680
13 Ga0070660_100005438 3300005339 Bacteria 8822
14 Ga0070660_100088855 3300005339 Bacteria 2434
15 Ga0070660_100133370 3300005339 Bacteria 1989
16 Ga0070661_100341137 3300005344 Bacteria 1174
17 Ga0070659_100000614 3300005366 Bacteria 26134
18 Ga0070659_100040922 3300005366 Bacteria 3622
19 Ga0070709_10240074 3300005434 Bacteria 1301
20 Ga0070714_100004428 3300005435 Bacteria 10573
21 Ga0070714_100462098 3300005435 Bacteria 1207
22 Ga0070713_100165576 3300005436 Bacteria 1977
23 Ga0070681_10104492 3300005458 Bacteria 2775
24 Ga0070681_11000230 3300005458 Bacteria 756
25 Ga0070685_10083781 3300005466 Bacteria 1916
26 Ga0070679_100007399 3300005530 Bacteria 10261
27 Ga0070684_100066242 3300005535 Bacteria 3171
28 Ga0070684_100270795 3300005535 Bacteria 1554
29 Ga0070686_100126260 3300005544 Bacteria 1763
30 Ga0070665_100021952 3300005548 Bacteria 6420
31 Ga0070665_100213759 3300005548 Bacteria 1929
32 Ga0070704_100616226 3300005549 Bacteria 955
33 Ga0068855_100013558 3300005563 Bacteria 9831
34 Ga0068855_100141077 3300005563 Bacteria 2747
35 Ga0068855_100250917 3300005563 Bacteria 1974
36 Ga0068855_100836958 3300005563 Bacteria 976
37 Ga0068857_100113732 3300005577 Bacteria 2434
38 Ga0068857_100554278 3300005577 Bacteria 1083
39 Ga0068854_100495522 3300005578 Bacteria 1028
40 Ga0068856_100314723 3300005614 Bacteria 1583
41 Ga0068852_100010538 3300005616 Bacteria 6914
42 Ga0068858_100000175 3300005842 Bacteria 68239
43 Ga0081455_10001337 3300005937 Bacteria 30512
44 Ga0081539_10000440 3300005985 Bacteria 88238
45 Ga0070717_10160215 3300006028 Bacteria 1952
46 Ga0075365_10009470 3300006038 Bacteria 5602
47 Ga0075365_10079723 3300006038 Bacteria 2216
48 Ga0075365_10170934 3300006038 Bacteria 1517
49 Ga0075364_10035873 3300006051 Bacteria 3205
50 Ga0075364_10044269 3300006051 Bacteria 2895
51 Ga0070712_100406169 3300006175 Bacteria 1126
52 Ga0075369_10013750 3300006186 Bacteria 3220
53 Ga0075369_10076895 3300006186 Bacteria 1476
54 Ga0105240_10002006 3300009093 Bacteria 33571
55 Ga0105240_10131613 3300009093 Bacteria 3000
56 Ga0105240_10210183 3300009093 Bacteria 2275
57 Ga0105240_10866628 3300009093 Bacteria 974
58 Ga0111539_10679960 3300009094 Bacteria 1198
59 Ga0105245_10571632 3300009098 Bacteria 1154
60 Ga0105241_10000211 3300009174 Bacteria 43844
61 Ga0105241_10009224 3300009174 Bacteria 7256
62 Ga0105242_10068684 3300009176 Bacteria 2933
63 Ga0105248_10000882 3300009177 Bacteria 33632
64 Ga0105248_10172428 3300009177 Bacteria 2438
65 Ga0105237_10007321 3300009545 Bacteria 12100
66 Ga0105237_10032397 3300009545 Bacteria 5291
67 Ga0105237_10094775 3300009545 Bacteria 2974
68 Ga0105237_10245916 3300009545 Bacteria 1790
69 Ga0105238_10013809 3300009551 Bacteria 8164
70 Ga0105238_10133265 3300009551 Bacteria 2463
71 Ga0105238_10426667 3300009551 Bacteria 1321
72 Ga0105239_10073281 3300010375 Bacteria 3765
73 Ga0105246_10034373 3300011119 Bacteria 3377
74 Ga0157370_10577470 3300013104 Bacteria 1030
75 Ga0157369_10016379 3300013105 Bacteria 8340
76 Ga0157369_10101724 3300013105 Bacteria 3062
77 Ga0157369_10241338 3300013105 Bacteria 1887
78 Ga0157369_10505773 3300013105 Bacteria 1250
79 Ga0157369_10737934 3300013105 Bacteria 1013
80 Ga0157369_10867709 3300013105 Bacteria 926
81 Ga0157374_10475304 3300013296 Bacteria 1253
82 Ga0157372_10430676 3300013307 Bacteria 1537
83 Ga0157372_10658434 3300013307 Bacteria 1219
84 Ga0163163_10173331 3300014325 Bacteria 2204
85 Ga0157377_10519621 3300014745 Bacteria 835
86 Ga0157379_10000039 3300014968 Bacteria 79484
87 Ga0157379_10004102 3300014968 Bacteria 12432
88 Ga0197907_10609208 3300020069 Bacteria 893
89 Ga0197907_10782661 3300020069 Bacteria 1792
90 Ga0213875_10120812 3300021388 Bacteria 1224
91 Ga0224712_10003570 3300022467 Bacteria 4066
92 Ga0224712_10226177 3300022467 Bacteria 858
93 Ga0209148_1000830 3300025254 Bacteria 22075
94 Ga0209148_1011447 3300025254 Bacteria 1648
95 Ga0207647_10016380 3300025904 Bacteria 5060
96 Ga0207699_10365054 3300025906 Bacteria 1022
97 Ga0207705_10004785 3300025909 Bacteria 10196
98 Ga0207705_10006198 3300025909 Bacteria 8891
99 Ga0207705_10094709 3300025909 Bacteria 2190
100 Ga0207705_10164002 3300025909 Bacteria 1670
101 Ga0207654_10000003 3300025911 Bacteria 1030378
102 Ga0207654_10069953 3300025911 Bacteria 2082
103 Ga0207707_10069975 3300025912 Bacteria 3058
104 Ga0207695_10001622 3300025913 Bacteria 36477
105 Ga0207695_10019828 3300025913 Bacteria 7729
106 Ga0207695_10035922 3300025913 Bacteria 5364
107 Ga0207671_10000976 3300025914 Bacteria 35441
108 Ga0207671_10112110 3300025914 Bacteria 2076
109 Ga0207693_10452619 3300025915 Bacteria 1003
110 Ga0207663_10068419 3300025916 Bacteria 2280
111 Ga0207660_10173387 3300025917 Bacteria 1671
112 Ga0207657_10014789 3300025919 Bacteria 7597
113 Ga0207657_10022274 3300025919 Bacteria 5935
114 Ga0207657_10256619 3300025919 Bacteria 1392
115 Ga0207694_10000220 3300025924 Bacteria 55978
116 Ga0207694_10047828 3300025924 Bacteria 3308
117 Ga0207694_10054186 3300025924 Bacteria 3111
118 Ga0207694_10561669 3300025924 Bacteria 958
119 Ga0207687_10063863 3300025927 Bacteria 2608
120 Ga0207700_10251994 3300025928 Bacteria 1508
121 Ga0207664_10004273 3300025929 Bacteria 9668
122 Ga0207664_10157794 3300025929 Bacteria 1933
123 Ga0207690_10002300 3300025932 Bacteria 11646
124 Ga0207690_10017351 3300025932 Bacteria 4392
125 Ga0207686_10100348 3300025934 Bacteria 1931
126 Ga0207711_10001209 3300025941 Bacteria 24455
127 Ga0207711_10002075 3300025941 Bacteria 18101
128 Ga0207711_10210925 3300025941 Bacteria 1774
129 Ga0207661_10279071 3300025944 Bacteria 1493
130 Ga0207667_10001963 3300025949 Bacteria 25773
131 Ga0207667_10414694 3300025949 Bacteria 1370
132 Ga0207640_10005073 3300025981 Bacteria 7165
133 Ga0207677_10010029 3300026023 Bacteria 5345
134 Ga0207703_10000001 3300026035 Bacteria 822925
135 Ga0207703_10000131 3300026035 Bacteria 90186
136 Ga0207639_10054075 3300026041 Bacteria 3067
137 Ga0207639_10055224 3300026041 Bacteria 3039
138 Ga0207678_10023532 3300026067 Bacteria 5387
139 Ga0207678_10237019 3300026067 Bacteria 1562
140 Ga0207702_10248601 3300026078 Bacteria 1669
141 Ga0207702_10898337 3300026078 Bacteria 878
142 Ga0207674_10086436 3300026116 Bacteria 3131
143 Ga0207674_10307283 3300026116 Bacteria 1535
144 Ga0207698_10005106 3300026142 Bacteria 8063
145 Ga0207698_10056232 3300026142 Bacteria 3037
146 Ga0268266_10070360 3300028379 Bacteria 3032
147 Ga0268266_10440756 3300028379 Bacteria 1237
148 Ga0307515_10059733 3300028794 Bacteria 5457
149 Ga0307515_10072777 3300028794 Bacteria 4631
150 Ga0307515_10138279 3300028794 Bacteria 2631
151 Ga0307509_10062666 3300031507 Bacteria 3920
152 Ga0307508_10048095 3300031616 Bacteria 3801
153 Ga0307514_10139981 3300031649 Bacteria 1647
154 Ga0316576_10047954 3300031727 Bacteria 3096
155 Ga0316578_10207326 3300031728 Bacteria 1179
156 Ga0307405_10224457 3300031731 Bacteria 1381
157 Ga0307405_10516200 3300031731 Bacteria 960
158 Ga0307413_10175506 3300031824 Bacteria 1522
159 Ga0307413_10596661 3300031824 Bacteria 903
160 Ga0307518_10137229 3300031838 Bacteria 1711
161 Ga0307410_10061015 3300031852 Bacteria 2579
162 Ga0307410_10263572 3300031852 Bacteria 1345
163 Ga0307406_10093287 3300031901 Bacteria 2032
164 Ga0307406_10311593 3300031901 Bacteria 1213
165 Ga0307407_10221215 3300031903 Bacteria 1280
166 Ga0307407_10366143 3300031903 Bacteria 1025
167 Ga0307409_100056591 3300031995 Bacteria 3033
168 Ga0307409_100065600 3300031995 Bacteria 2858
169 Ga0307416_100038747 3300032002 Bacteria 3680
170 Ga0307416_100081307 3300032002 Bacteria 2739
171 Ga0307416_100274708 3300032002 Bacteria 1657
172 Ga0307416_100656530 3300032002 Bacteria 1134
173 Ga0307414_10471167 3300032004 Bacteria 1106
174 Ga0307411_10328430 3300032005 Bacteria 1238
175 Ga0307415_100232231 3300032126 Bacteria 1486
176 Ga0373936_0194993 3300035113 Bacteria 892
177 Ga0373954_0034461 3300035118 Bacteria 2345
178 Ga0373956_0006834 3300035119 Bacteria 4579
179 Ga0373957_0002550 3300035120 Bacteria 5221
180 Ga0373946_0015848 3300035171 Bacteria 2864
181 Ga0373955_0028111 3300035172 Bacteria 2913
182 Ga0373924_0000562 3300035410 Bacteria 11432
183 Ga0373935_0131923 3300035692 Bacteria 1679
184 Ga0373933_0004351 3300035724 Bacteria 7777
185 Ga0373933_0006584 3300035724 Bacteria 6330
186 Ga0373937_0004325 3300036401 Bacteria 12051
187 Ga0395900_0021269 3300037418 Bacteria 6633
188 Ga0395900_0126962 3300037418 Bacteria 2616
189 Ga0395898_0102743 3300037466 Bacteria 2743
190 Ga0395898_0284253 3300037466 Bacteria 1578
191 Ga0436364_1469438 3300037853 Bacteria 1701
192 Ga0395901_0134305 3300038443 Bacteria 2600
193 Ga0395901_0151031 3300038443 Bacteria 2441
194 Ga0451789_0505661 3300041443 Bacteria 789
195 Ga0451802_0639360 3300041460 Bacteria 863
196 Ga0451851_0668483 3300041507 Bacteria 910
197 Ga0466969_0000312 3300044656 Bacteria 26699
198 Ga0466969_0035308 3300044656 Bacteria 2528
199 Ga0466969_0080916 3300044656 Bacteria 1551
200 Ga0466969_0145320 3300044656 Bacteria 1094
201 Ga0466965_0041970 3300044683 Bacteria 2255
202 Ga0466966_0017580 3300044684 Bacteria 4724
203 Ga0466966_0044132 3300044684 Bacteria 2855
204 Ga0466966_0074133 3300044684 Bacteria 2128
205 Ga0466966_0173124 3300044684 Bacteria 1311
206 Ga0466961_0001762 3300044693 Bacteria 13420
207 Ga0466961_0010808 3300044693 Bacteria 5830
208 Ga0466961_0137049 3300044693 Bacteria 1533
209 Ga0466961_0139491 3300044693 Bacteria 1518
210 Ga0466961_0193716 3300044693 Bacteria 1259
211 Ga0466961_0217580 3300044693 Bacteria 1178
212 Ga0466961_0252687 3300044693 Bacteria 1082
213 Ga0466961_0602872 3300044693 Bacteria 660
214 Ga0466963_0097962 3300044694 Bacteria 2004
215 Ga0466963_0160345 3300044694 Bacteria 1565
216 Ga0466963_0174318 3300044694 Bacteria 1500
217 Ga0466963_0487175 3300044694 Bacteria 870
218 Ga0466971_0008218 3300044719 Bacteria 4552
219 Ga0466971_0012329 3300044719 Bacteria 3744
220 Ga0466971_0020482 3300044719 Bacteria 2940
221 Ga0466971_0033469 3300044719 Bacteria 2303
222 Ga0466971_0038368 3300044719 Bacteria 2150
223 Ga0466971_0076677 3300044719 Bacteria 1521
224 Ga0466971_0309674 3300044719 Bacteria 759
225 Ga0466970_0000017 3300044765 Bacteria 64907
226 Ga0466970_0019046 3300044765 Bacteria 3557
227 Ga0466970_0023084 3300044765 Bacteria 3247
228 Ga0466970_0028223 3300044765 Bacteria 2948
229 Ga0466970_0029432 3300044765 Bacteria 2891
230 Ga0466970_0035683 3300044765 Bacteria 2634
231 Ga0466970_0413864 3300044765 Bacteria 770
232 Ga0466970_0486519 3300044765 Bacteria 710
233 Ga0466957_0088520 3300044842 Bacteria 1937
234 Ga0466957_0125396 3300044842 Bacteria 1640
235 Ga0466957_0647424 3300044842 Bacteria 743
236 Ga0466960_0034270 3300044901 Bacteria 2365
237 Ga0466960_0047255 3300044901 Bacteria 2064
238 Ga0466960_0150664 3300044901 Bacteria 1242
239 Ga0466960_0285950 3300044901 Bacteria 925
240 Ga0466960_0376123 3300044901 Bacteria 814
241 Ga0466959_0029885 3300045049 Bacteria 4035
242 Ga0466959_0043461 3300045049 Bacteria 3312
243 Ga0466959_0071713 3300045049 Bacteria 2508
244 Ga0466959_0306765 3300045049 Bacteria 1086
245 Ga0466959_0463754 3300045049 Bacteria 858
246 Ga0466958_0013377 3300045836 Bacteria 4671
247 Ga0466958_0019819 3300045836 Bacteria 3917
248 Ga0466958_0027072 3300045836 Bacteria 3392
249 Ga0466958_0114644 3300045836 Bacteria 1684
250 Ga0466958_0154476 3300045836 Bacteria 1448
251 Ga0466967_0000510 3300045976 Bacteria 18961
252 Ga0466967_0016260 3300045976 Bacteria 5860
253 Ga0466967_0080213 3300045976 Bacteria 2944
254 Ga0466967_0189273 3300045976 Bacteria 1944
255 Ga0466967_0193818 3300045976 Bacteria 1922
256 Ga0466967_0307820 3300045976 Bacteria 1525
257 Ga0466967_0332632 3300045976 Bacteria 1467
258 Ga0466967_0734348 3300045976 Bacteria 979
259 Ga0495603_0303544 3300046455 Bacteria 917
260 Ga0495651_0000211 3300046462 Bacteria 44617
261 Ga0495651_0034874 3300046462 Bacteria 3921
262 Ga0495639_0044076 3300046475 Bacteria 2016
263 Ga0495664_0119985 3300046477 Bacteria 1590
264 Ga0495608_0094496 3300046511 Bacteria 1931
265 Ga0495618_0018008 3300046514 Bacteria 4335
266 Ga0495618_0044642 3300046514 Bacteria 2795
267 Ga0495620_0098934 3300046515 Bacteria 1164
268 Ga0495628_0026002 3300046516 Bacteria 4779
269 Ga0495628_0130712 3300046516 Bacteria 1920
270 Ga0495631_0108279 3300046518 Bacteria 1195
271 Ga0495652_0012957 3300046529 Bacteria 7515
272 Ga0495652_0014267 3300046529 Bacteria 7133
273 Ga0495640_0049188 3300046533 Bacteria 2909
274 Ga0495586_0030252 3300046535 Bacteria 2897
275 Ga0495586_0089008 3300046535 Bacteria 1703
276 Ga0495587_0008620 3300046536 Bacteria 6554
277 Ga0495621_0154185 3300046539 Bacteria 905
278 Ga0495645_0350899 3300046543 Bacteria 950
279 Ga0495634_0038005 3300046642 Bacteria 3284
280 Ga0495634_0238865 3300046642 Bacteria 1115
281 Ga0495635_0003328 3300046663 Bacteria 11115
282 Ga0495599_0080383 3300046678 Bacteria 2035
283 Ga0495623_0011914 3300046679 Bacteria 5635
284 Ga0495623_0072871 3300046679 Bacteria 2135
285 Ga0495646_0035868 3300046680 Bacteria 3073
286 Ga0495646_0140229 3300046680 Bacteria 1352
287 Ga0495647_0217800 3300046681 Bacteria 842
288 Ga0495613_0050844 3300046689 Bacteria 3056
289 Ga0495624_0084727 3300046690 Bacteria 1958
290 Ga0495589_0136347 3300046794 Bacteria 1177
291 Ga0495600_0036789 3300046809 Bacteria 3181
292 Ga0495600_0164882 3300046809 Bacteria 1431
293 Ga0495581_0026136 3300047315 Bacteria 3386
294 Ga0495604_0004607 3300047317 Bacteria 10923
295 Ga0495604_0074011 3300047317 Bacteria 2568
296 Ga0495680_0045310 3300047322 Bacteria 3472
297 Ga0495675_0077676 3300047444 Bacteria 2091
298 Ga0495684_0086336 3300047471 Bacteria 2378
299 Ga0495593_0033640 3300047673 Bacteria 2791
300 Ga0495614_0019723 3300048089 Bacteria 2917
301 Ga0495626_0147948 3300048091 Bacteria 992
302 Ga0496101_0351912 3300048904 Bacteria 1158
303 Ga0496102_0349729 3300048905 Bacteria 1392
304 Ga0496102_0401125 3300048905 Bacteria 1289
305 Ga0496106_0865940 3300048909 Bacteria 715
306 Ga0496109_0572503 3300048912 Bacteria 1065
307 Ga0496115_0895863 3300048918 Bacteria 684
308 Ga0496117_0006826 3300048920 Bacteria 11363
309 Ga0496117_0158894 3300048920 Bacteria 1327
310 Ga0496118_0000149 3300048921 Bacteria 123317
311 Ga0496118_0035053 3300048921 Bacteria 4083
312 Ga0496119_0001675 3300048922 Bacteria 25909
313 Ga0496119_0033780 3300048922 Bacteria 3384
314 Ga0496119_0113433 3300048922 Bacteria 1501
315 Ga0496119_0160674 3300048922 Bacteria 1195
316 Ga0496120_0008046 3300048923 Bacteria 7753
317 Ga0496120_0024499 3300048923 Bacteria 3762
318 Ga0496120_0052245 3300048923 Bacteria 2329
319 Ga0496120_0189370 3300048923 Bacteria 1004
320 Ga0496121_0000277 3300048924 Bacteria 107014
321 Ga0496121_0008461 3300048924 Bacteria 12083
322 Ga0496121_0125420 3300048924 Bacteria 1931
323 Ga0496121_0168652 3300048924 Bacteria 1593
324 Ga0496122_0073563 3300048925 Bacteria 2422
325 Ga0496122_0102619 3300048925 Bacteria 1906
326 Ga0496122_0150552 3300048925 Bacteria 1437
327 Ga0496123_0022170 3300048926 Bacteria 4905
328 Ga0496124_0003142 3300048927 Bacteria 20440
329 Ga0496124_0003796 3300048927 Bacteria 18150
330 Ga0496124_0025041 3300048927 Bacteria 5411
331 Ga0496124_0157211 3300048927 Bacteria 1776
332 Ga0496126_0200816 3300048929 Bacteria 1684
333 Ga0501312_062358 3300049528 Bacteria 648
334 Ga0501032_0036550 3300049569 Bacteria 3352
335 Ga0501034_0000699 3300049571 Bacteria 50906
336 Ga0501034_0032981 3300049571 Bacteria 5258
337 Ga0501047_0213792 3300049581 Bacteria 1786
338 Ga0501069_0024117 3300049585 Bacteria 3318
339 Ga0501070_0001434 3300049586 Bacteria 21325
340 Ga0501070_0005356 3300049586 Bacteria 10946
341 Ga0501070_0015602 3300049586 Bacteria 6388
342 Ga0501070_0018008 3300049586 Bacteria 5926
343 Ga0501073_0000024 3300049589 Bacteria 128851
344 Ga0501074_0062693 3300049590 Bacteria 2678
345 Ga0501080_0000253 3300049742 Bacteria 40425
346 Ga0501080_0007864 3300049742 Bacteria 9649
347 Ga0501080_0056542 3300049742 Bacteria 3653
348 Ga0501044_0004741 3300049823 Bacteria 15203
349 nmdc:mga00v17_33519_c1 3300050491 Bacteria 3043
350 nmdc:mga0yw44_148889_c1 3300050492 Bacteria 1526
351 nmdc:mga0yw44_21477_c1 3300050492 Bacteria 3601
352 nmdc:mga0yw44_40546_c1 3300050492 Bacteria 2767
353 nmdc:mga0n895_17970_c1 3300050512 Bacteria 6535
354 nmdc:mga0rr50_15996_c1 3300050513 Bacteria 4969
355 nmdc:mga08x19_639835_c1 3300050514 Bacteria 754
356 nmdc:mga0sz30_358625_c1 3300050516 Bacteria 652
357 Ga0495601_0003606 3300053077 Bacteria 8907
358 Ga0495601_0040369 3300053077 Bacteria 2923
359 Ga0495601_0099592 3300053077 Bacteria 1876
360 Ga0495601_0117768 3300053077 Bacteria 1723
361 Ga0495612_0005021 3300053078 Bacteria 5480
362 Ga0495612_0014263 3300053078 Bacteria 3197
363 Ga0500635_0065970 3300053080 Bacteria 1274
364 Ga0495595_0026966 3300053084 Bacteria 2556
365 Ga0495619_0124379 3300053085 Bacteria 1769
366 Ga0495619_0143557 3300053085 Bacteria 1645
367 Ga0500556_0001014 3300053104 Bacteria 14754
368 Ga0500593_000363 3300053117 Bacteria 18295
369 Ga0500655_001024 3300053133 Bacteria 5398
370 Ga0500559_0000496 3300053136 Bacteria 27644
371 Ga0500573_0001177 3300053140 Bacteria 12200
372 Ga0500590_006392 3300053148 Bacteria 5740
373 Ga0500616_0031943 3300053153 Bacteria 2880
374 Ga0500620_000023 3300053155 Bacteria 31007
375 Ga0500611_023241 3300053727 Bacteria 1205
376 Ga0466962_0003662 3300061719 Bacteria 7330
377 Ga0466962_0020994 3300061719 Bacteria 3138
378 Ga0466962_0024435 3300061719 Bacteria 2902
379 Ga0466962_0048490 3300061719 Bacteria 2030

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050516 nmdc:mga0sz30_358625_c1 nmdc:mga0sz30_358625_c1_16_558 171
2 3300049528 Ga0501312_062358 Ga0501312_062358_22_597 179
3 3300038443 Ga0395901_0151031 Ga0395901_0151031_1846_2424 180
4 3300048918 Ga0496115_0895863 Ga0496115_0895863_21_593 180
5 3300006038 Ga0075365_10009470 Ga0075365_100094706 182
6 3300041443 Ga0451789_0505661 Ga0451789_0505661_153_731 182
7 3300050492 nmdc:mga0yw44_148889_c1 nmdc:mga0yw44_148889_c1_730_1308 182
8 3300009094 Ga0111539_10679960 Ga0111539_106799601 183
9 3300021388 Ga0213875_10120812 Ga0213875_101208122 183
10 3300037853 Ga0436364_1469438 Ga0436364_1469438_439_1029 183
11 3300035410 Ga0373924_0000562 Ga0373924_0000562_8627_9208 184
12 3300045836 Ga0466958_0013377 Ga0466958_0013377_2399_3016 188
13 3300048924 Ga0496121_0000277 Ga0496121_0000277_80285_80923 188
14 iso_pu_bacteria 2795385472 2795796045 191
15 3300044656 Ga0466969_0000312 Ga0466969_0000312_1922_2554 193
16 3300044684 Ga0466966_0173124 Ga0466966_0173124_662_1294 193
17 3300044693 Ga0466961_0001762 Ga0466961_0001762_10863_11495 193
18 3300044719 Ga0466971_0012329 Ga0466971_0012329_2529_3161 193
19 3300045049 Ga0466959_0306765 Ga0466959_0306765_223_855 193
20 3300045836 Ga0466958_0019819 Ga0466958_0019819_2046_2678 193
21 3300061719 Ga0466962_0024435 Ga0466962_0024435_1966_2598 193
22 3300005338 Ga0068868_100007705 Ga0068868_1000077056 194
23 3300005339 Ga0070660_100005438 Ga0070660_1000054387 194
24 3300005344 Ga0070661_100341137 Ga0070661_1003411372 194
25 3300005366 Ga0070659_100000614 Ga0070659_10000061418 194
26 3300005466 Ga0070685_10083781 Ga0070685_100837813 194
27 3300005842 Ga0068858_100000175 Ga0068858_10000017544 194
28 3300006028 Ga0070717_10160215 Ga0070717_101602152 194
29 3300009093 Ga0105240_10210183 Ga0105240_102101831 194
30 3300009551 Ga0105238_10133265 Ga0105238_101332652 194
31 3300025909 Ga0207705_10004785 Ga0207705_100047856 194
32 3300025913 Ga0207695_10019828 Ga0207695_100198284 194
33 3300025919 Ga0207657_10014789 Ga0207657_100147898 194
34 3300025924 Ga0207694_10047828 Ga0207694_100478285 194
35 3300025929 Ga0207664_10004273 Ga0207664_1000427310 194
36 3300025932 Ga0207690_10002300 Ga0207690_100023009 194
37 3300025949 Ga0207667_10001963 Ga0207667_100019638 194
38 3300026023 Ga0207677_10010029 Ga0207677_100100296 194
39 3300026035 Ga0207703_10000131 Ga0207703_1000013127 194
40 3300026041 Ga0207639_10054075 Ga0207639_100540753 194
41 3300026067 Ga0207678_10237019 Ga0207678_102370192 194
42 3300026142 Ga0207698_10056232 Ga0207698_100562324 194
43 3300053140 Ga0500573_0001177 Ga0500573_0001177_1782_2393 194
44 iso_pu_bacteria 2643221687 2644485922 194
45 iso_pu_bacteria 2873314349 2873320730 194
46 iso_pu_bacteria 2902792274 2902795885 194
47 3300005563 Ga0068855_100836958 Ga0068855_1008369582 195
48 3300025924 Ga0207694_10054186 Ga0207694_100541863 195
49 3300025949 Ga0207667_10414694 Ga0207667_104146941 195
50 3300026041 Ga0207639_10055224 Ga0207639_100552244 195
51 3300044656 Ga0466969_0145320 Ga0466969_0145320_450_1067 195
52 3300044693 Ga0466961_0217580 Ga0466961_0217580_39_632 195
53 3300045976 Ga0466967_0734348 Ga0466967_0734348_109_741 195
54 3300049586 Ga0501070_0015602 Ga0501070_0015602_1605_2198 195
55 iso_pu_bacteria 2866552031 2866552448 195
56 iso_pu_bacteria 8055172936 8055178862 195
57 3300005330 Ga0070690_100461114 Ga0070690_1004611141 196
58 3300006186 Ga0075369_10013750 Ga0075369_100137504 196
59 3300011119 Ga0105246_10034373 Ga0105246_100343734 196
60 3300013296 Ga0157374_10475304 Ga0157374_104753042 196
61 3300014325 Ga0163163_10173331 Ga0163163_101733313 196
62 3300025941 Ga0207711_10002075 Ga0207711_1000207516 196
63 3300035113 Ga0373936_0194993 Ga0373936_0194993_126_743 196
64 3300035118 Ga0373954_0034461 Ga0373954_0034461_231_848 196
65 3300035119 Ga0373956_0006834 Ga0373956_0006834_3560_4177 196
66 3300035120 Ga0373957_0002550 Ga0373957_0002550_4375_4992 196
67 3300035171 Ga0373946_0015848 Ga0373946_0015848_468_1085 196
68 3300035172 Ga0373955_0028111 Ga0373955_0028111_293_910 196
69 3300035692 Ga0373935_0131923 Ga0373935_0131923_343_960 196
70 3300035724 Ga0373933_0006584 Ga0373933_0006584_1645_2262 196
71 3300036401 Ga0373937_0004325 Ga0373937_0004325_3168_3785 196
72 3300046455 Ga0495603_0303544 Ga0495603_0303544_185_802 196
73 3300046475 Ga0495639_0044076 Ga0495639_0044076_466_1083 196
74 3300046477 Ga0495664_0119985 Ga0495664_0119985_280_897 196
75 3300046511 Ga0495608_0094496 Ga0495608_0094496_822_1439 196
76 3300046514 Ga0495618_0018008 Ga0495618_0018008_3081_3698 196
77 3300046516 Ga0495628_0130712 Ga0495628_0130712_475_1092 196
78 3300046529 Ga0495652_0014267 Ga0495652_0014267_2711_3328 196
79 3300046533 Ga0495640_0049188 Ga0495640_0049188_1884_2501 196
80 3300046535 Ga0495586_0030252 Ga0495586_0030252_293_910 196
81 3300046536 Ga0495587_0008620 Ga0495587_0008620_4164_4781 196
82 3300046543 Ga0495645_0350899 Ga0495645_0350899_232_849 196
83 3300046642 Ga0495634_0038005 Ga0495634_0038005_2259_2876 196
84 3300046678 Ga0495599_0080383 Ga0495599_0080383_23_640 196
85 3300046680 Ga0495646_0035868 Ga0495646_0035868_1635_2252 196
86 3300046681 Ga0495647_0217800 Ga0495647_0217800_40_657 196
87 3300046689 Ga0495613_0050844 Ga0495613_0050844_1276_1893 196
88 3300046690 Ga0495624_0084727 Ga0495624_0084727_222_839 196
89 3300046809 Ga0495600_0164882 Ga0495600_0164882_480_1097 196
90 3300047315 Ga0495581_0026136 Ga0495581_0026136_1495_2112 196
91 3300047317 Ga0495604_0074011 Ga0495604_0074011_1130_1747 196
92 3300047322 Ga0495680_0045310 Ga0495680_0045310_957_1574 196
93 3300047444 Ga0495675_0077676 Ga0495675_0077676_208_825 196
94 3300047471 Ga0495684_0086336 Ga0495684_0086336_494_1111 196
95 3300047673 Ga0495593_0033640 Ga0495593_0033640_612_1229 196
96 3300048089 Ga0495614_0019723 Ga0495614_0019723_2091_2708 196
97 3300050512 nmdc:mga0n895_17970_c1 nmdc:mga0n895_17970_c1_5709_6329 196
98 3300050513 nmdc:mga0rr50_15996_c1 nmdc:mga0rr50_15996_c1_2853_3473 196
99 3300050514 nmdc:mga08x19_639835_c1 nmdc:mga08x19_639835_c1_94_714 196
100 3300053084 Ga0495595_0026966 Ga0495595_0026966_673_1290 196
101 3300053085 Ga0495619_0124379 Ga0495619_0124379_849_1466 196
102 3300053148 Ga0500590_006392 Ga0500590_006392_4570_5208 196
103 iso_pu_bacteria 2855386786 2855387821 196
104 iso_pu_bacteria 8055066027 8055066852 196
105 3300005327 Ga0070658_10390091 Ga0070658_103900911 197
106 3300005548 Ga0070665_100021952 Ga0070665_1000219525 197
107 3300005563 Ga0068855_100013558 Ga0068855_1000135589 197
108 3300005578 Ga0068854_100495522 Ga0068854_1004955223 197
109 3300005614 Ga0068856_100314723 Ga0068856_1003147233 197
110 3300005985 Ga0081539_10000440 Ga0081539_1000044052 197
111 3300025904 Ga0207647_10016380 Ga0207647_100163804 197
112 3300025911 Ga0207654_10069953 Ga0207654_100699534 197
113 3300025913 Ga0207695_10001622 Ga0207695_100016227 197
114 3300025914 Ga0207671_10000976 Ga0207671_1000097619 197
115 3300025924 Ga0207694_10000220 Ga0207694_100002204 197
116 3300025981 Ga0207640_10005073 Ga0207640_100050737 197
117 3300026078 Ga0207702_10248601 Ga0207702_102486013 197
118 iso_pu_bacteria 2995463766 2995464589 197
119 3300005327 Ga0070658_10115451 Ga0070658_101154512 198
120 3300009177 Ga0105248_10000882 Ga0105248_1000088234 198
121 3300013105 Ga0157369_10737934 Ga0157369_107379341 198
122 3300014968 Ga0157379_10000039 Ga0157379_1000003955 198
123 3300025941 Ga0207711_10001209 Ga0207711_1000120925 198
124 3300026035 Ga0207703_10000001 Ga0207703_10000001609 198
125 3300028794 Ga0307515_10059733 Ga0307515_100597332 198
126 3300044693 Ga0466961_0602872 Ga0466961_0602872_20_622 198
127 3300044765 Ga0466970_0028223 Ga0466970_0028223_1223_1825 198
128 3300044765 Ga0466970_0413864 Ga0466970_0413864_23_625 198
129 iso_pu_bacteria 2870622029 2870623210 198
130 iso_pu_bacteria 2904501621 2904503768 198
131 iso_pu_bacteria 2908674828 2908675408 198
132 iso_pu_bacteria 2909074476 2909077664 198
133 iso_pu_bacteria 2919039151 2919041993 198
134 iso_pu_bacteria 2928500415 2928501433 198
135 iso_pu_bacteria 2946041624 2946044772 198
136 3300005544 Ga0070686_100126260 Ga0070686_1001262603 199
137 3300005937 Ga0081455_10001337 Ga0081455_100013372 199
138 3300009098 Ga0105245_10571632 Ga0105245_105716322 199
139 3300028379 Ga0268266_10440756 Ga0268266_104407561 199
140 3300048920 Ga0496117_0158894 Ga0496117_0158894_653_1279 199
141 iso_pu_bacteria 2622736605 2623500328 199
142 iso_pu_bacteria 2643221724 2644681435 199
143 iso_pu_bacteria 2728369380 2730230127 199
144 iso_pu_bacteria 2751185788 2753301416 199
145 iso_pu_bacteria 2928104781 2928108382 199
146 3300005435 Ga0070714_100004428 Ga0070714_1000044288 200
147 3300005548 Ga0070665_100213759 Ga0070665_1002137593 200
148 3300005563 Ga0068855_100250917 Ga0068855_1002509172 200
149 3300013105 Ga0157369_10505773 Ga0157369_105057732 200
150 3300013307 Ga0157372_10658434 Ga0157372_106584342 200
151 3300014745 Ga0157377_10519621 Ga0157377_105196212 200
152 3300020069 Ga0197907_10609208 Ga0197907_106092081 200
153 3300022467 Ga0224712_10226177 Ga0224712_102261772 200
154 3300026078 Ga0207702_10898337 Ga0207702_108983372 200
155 3300028379 Ga0268266_10070360 Ga0268266_100703604 200
156 3300031507 Ga0307509_10062666 Ga0307509_100626665 200
157 3300031616 Ga0307508_10048095 Ga0307508_100480954 200
158 3300031731 Ga0307405_10224457 Ga0307405_102244572 200
159 3300041460 Ga0451802_0639360 Ga0451802_0639360_23_661 200
160 3300044656 Ga0466969_0035308 Ga0466969_0035308_208_840 200
161 3300044656 Ga0466969_0080916 Ga0466969_0080916_742_1377 200
162 3300044683 Ga0466965_0041970 Ga0466965_0041970_1296_1934 200
163 3300044684 Ga0466966_0017580 Ga0466966_0017580_286_918 200
164 3300044684 Ga0466966_0044132 Ga0466966_0044132_941_1579 200
165 3300044693 Ga0466961_0137049 Ga0466961_0137049_149_781 200
166 3300044693 Ga0466961_0139491 Ga0466961_0139491_114_746 200
167 3300044693 Ga0466961_0252687 Ga0466961_0252687_386_1015 200
168 3300044694 Ga0466963_0174318 Ga0466963_0174318_779_1411 200
169 3300044694 Ga0466963_0487175 Ga0466963_0487175_115_744 200
170 3300044719 Ga0466971_0008218 Ga0466971_0008218_2996_3628 200
171 3300044719 Ga0466971_0020482 Ga0466971_0020482_84_725 200
172 3300044719 Ga0466971_0033469 Ga0466971_0033469_1345_1974 200
173 3300044719 Ga0466971_0038368 Ga0466971_0038368_450_1082 200
174 3300044719 Ga0466971_0076677 Ga0466971_0076677_802_1440 200
175 3300044765 Ga0466970_0019046 Ga0466970_0019046_108_740 200
176 3300044765 Ga0466970_0023084 Ga0466970_0023084_1097_1732 200
177 3300044765 Ga0466970_0029432 Ga0466970_0029432_1485_2114 200
178 3300044765 Ga0466970_0035683 Ga0466970_0035683_1527_2162 200
179 3300044842 Ga0466957_0088520 Ga0466957_0088520_692_1321 200
180 3300044901 Ga0466960_0034270 Ga0466960_0034270_955_1563 200
181 3300044901 Ga0466960_0047255 Ga0466960_0047255_1403_2041 200
182 3300045049 Ga0466959_0029885 Ga0466959_0029885_3312_3944 200
183 3300045049 Ga0466959_0043461 Ga0466959_0043461_1688_2317 200
184 3300045049 Ga0466959_0463754 Ga0466959_0463754_202_834 200
185 3300045836 Ga0466958_0027072 Ga0466958_0027072_1771_2400 200
186 3300045976 Ga0466967_0000510 Ga0466967_0000510_10387_11025 200
187 3300045976 Ga0466967_0193818 Ga0466967_0193818_529_1167 200
188 3300045976 Ga0466967_0307820 Ga0466967_0307820_508_1137 200
189 3300046462 Ga0495651_0000211 Ga0495651_0000211_33914_34546 200
190 3300046514 Ga0495618_0044642 Ga0495618_0044642_2109_2741 200
191 3300046516 Ga0495628_0026002 Ga0495628_0026002_3728_4360 200
192 3300046529 Ga0495652_0012957 Ga0495652_0012957_493_1125 200
193 3300046535 Ga0495586_0089008 Ga0495586_0089008_175_807 200
194 3300046642 Ga0495634_0238865 Ga0495634_0238865_226_858 200
195 3300046663 Ga0495635_0003328 Ga0495635_0003328_8431_9063 200
196 3300046679 Ga0495623_0011914 Ga0495623_0011914_2091_2723 200
197 3300046679 Ga0495623_0072871 Ga0495623_0072871_1300_1935 200
198 3300046680 Ga0495646_0140229 Ga0495646_0140229_310_942 200
199 3300046809 Ga0495600_0036789 Ga0495600_0036789_369_1001 200
200 3300047317 Ga0495604_0004607 Ga0495604_0004607_6104_6739 200
201 3300048091 Ga0495626_0147948 Ga0495626_0147948_137_772 200
202 3300048905 Ga0496102_0349729 Ga0496102_0349729_79_720 200
203 3300048912 Ga0496109_0572503 Ga0496109_0572503_377_1015 200
204 3300048922 Ga0496119_0113433 Ga0496119_0113433_376_1011 200
205 3300048924 Ga0496121_0008461 Ga0496121_0008461_639_1259 200
206 3300048925 Ga0496122_0102619 Ga0496122_0102619_605_1240 200
207 3300048927 Ga0496124_0003796 Ga0496124_0003796_6736_7371 200
208 3300048927 Ga0496124_0025041 Ga0496124_0025041_1695_2330 200
209 3300049569 Ga0501032_0036550 Ga0501032_0036550_830_1441 200
210 3300049581 Ga0501047_0213792 Ga0501047_0213792_747_1358 200
211 3300049585 Ga0501069_0024117 Ga0501069_0024117_1180_1791 200
212 3300049586 Ga0501070_0001434 Ga0501070_0001434_6000_6611 200
213 3300049586 Ga0501070_0018008 Ga0501070_0018008_3591_4202 200
214 3300049742 Ga0501080_0000253 Ga0501080_0000253_38314_38925 200
215 3300049742 Ga0501080_0007864 Ga0501080_0007864_6300_6911 200
216 3300049823 Ga0501044_0004741 Ga0501044_0004741_2792_3403 200
217 3300053077 Ga0495601_0099592 Ga0495601_0099592_493_1125 200
218 3300053077 Ga0495601_0117768 Ga0495601_0117768_766_1398 200
219 3300053078 Ga0495612_0014263 Ga0495612_0014263_508_1140 200
220 3300053085 Ga0495619_0143557 Ga0495619_0143557_787_1419 200
221 3300061719 Ga0466962_0003662 Ga0466962_0003662_3808_4440 200
222 3300061719 Ga0466962_0020994 Ga0466962_0020994_372_1001 200
223 3300061719 Ga0466962_0048490 Ga0466962_0048490_866_1504 200
224 iso_pu_bacteria 2919042368 2919045043 200
225 iso_pu_bacteria 2932398195 2932398856 200
226 3300005329 Ga0070683_100240711 Ga0070683_1002407113 201
227 3300005434 Ga0070709_10240074 Ga0070709_102400742 201
228 3300005435 Ga0070714_100462098 Ga0070714_1004620983 201
229 3300005436 Ga0070713_100165576 Ga0070713_1001655764 201
230 3300005549 Ga0070704_100616226 Ga0070704_1006162262 201
231 3300005563 Ga0068855_100141077 Ga0068855_1001410773 201
232 3300005577 Ga0068857_100113732 Ga0068857_1001137322 201
233 3300005577 Ga0068857_100554278 Ga0068857_1005542782 201
234 3300005616 Ga0068852_100010538 Ga0068852_1000105386 201
235 3300006038 Ga0075365_10079723 Ga0075365_100797232 201
236 3300006038 Ga0075365_10170934 Ga0075365_101709342 201
237 3300006051 Ga0075364_10035873 Ga0075364_100358733 201
238 3300006186 Ga0075369_10076895 Ga0075369_100768952 201
239 3300009093 Ga0105240_10131613 Ga0105240_101316134 201
240 3300009093 Ga0105240_10866628 Ga0105240_108666282 201
241 3300009174 Ga0105241_10000211 Ga0105241_1000021121 201
242 3300009177 Ga0105248_10172428 Ga0105248_101724283 201
243 3300009545 Ga0105237_10007321 Ga0105237_1000732110 201
244 3300009545 Ga0105237_10094775 Ga0105237_100947755 201
245 3300009545 Ga0105237_10245916 Ga0105237_102459162 201
246 3300013104 Ga0157370_10577470 Ga0157370_105774702 201
247 3300014968 Ga0157379_10004102 Ga0157379_100041029 201
248 3300025254 Ga0209148_1000830 Ga0209148_100083011 201
249 3300025254 Ga0209148_1011447 Ga0209148_10114472 201
250 3300025906 Ga0207699_10365054 Ga0207699_103650541 201
251 3300025911 Ga0207654_10000003 Ga0207654_10000003334 201
252 3300025913 Ga0207695_10035922 Ga0207695_100359224 201
253 3300025914 Ga0207671_10112110 Ga0207671_101121103 201
254 3300025916 Ga0207663_10068419 Ga0207663_100684192 201
255 3300025927 Ga0207687_10063863 Ga0207687_100638633 201
256 3300025928 Ga0207700_10251994 Ga0207700_102519943 201
257 3300025929 Ga0207664_10157794 Ga0207664_101577942 201
258 3300025941 Ga0207711_10210925 Ga0207711_102109252 201
259 3300026116 Ga0207674_10086436 Ga0207674_100864365 201
260 3300026116 Ga0207674_10307283 Ga0207674_103072833 201
261 3300026142 Ga0207698_10005106 Ga0207698_100051064 201
262 3300028794 Ga0307515_10072777 Ga0307515_100727772 201
263 3300028794 Ga0307515_10138279 Ga0307515_101382793 201
264 3300031649 Ga0307514_10139981 Ga0307514_101399812 201
265 3300031838 Ga0307518_10137229 Ga0307518_101372293 201
266 3300041507 Ga0451851_0668483 Ga0451851_0668483_30_668 201
267 3300044684 Ga0466966_0074133 Ga0466966_0074133_689_1294 201
268 3300044693 Ga0466961_0010808 Ga0466961_0010808_419_1024 201
269 3300044765 Ga0466970_0000017 Ga0466970_0000017_39351_40001 201
270 3300045049 Ga0466959_0071713 Ga0466959_0071713_1406_2011 201
271 3300046462 Ga0495651_0034874 Ga0495651_0034874_2780_3427 201
272 3300048904 Ga0496101_0351912 Ga0496101_0351912_228_866 201
273 3300048905 Ga0496102_0401125 Ga0496102_0401125_132_773 201
274 3300048920 Ga0496117_0006826 Ga0496117_0006826_3362_4000 201
275 3300048921 Ga0496118_0000149 Ga0496118_0000149_98056_98694 201
276 3300048921 Ga0496118_0035053 Ga0496118_0035053_1734_2417 201
277 3300048922 Ga0496119_0001675 Ga0496119_0001675_1570_2253 201
278 3300048922 Ga0496119_0033780 Ga0496119_0033780_1547_2185 201
279 3300048922 Ga0496119_0160674 Ga0496119_0160674_110_742 201
280 3300048923 Ga0496120_0008046 Ga0496120_0008046_6735_7403 201
281 3300048923 Ga0496120_0024499 Ga0496120_0024499_1610_2293 201
282 3300048923 Ga0496120_0052245 Ga0496120_0052245_570_1211 201
283 3300048923 Ga0496120_0189370 Ga0496120_0189370_130_768 201
284 3300048924 Ga0496121_0125420 Ga0496121_0125420_651_1283 201
285 3300048924 Ga0496121_0168652 Ga0496121_0168652_681_1313 201
286 3300048925 Ga0496122_0073563 Ga0496122_0073563_1291_1929 201
287 3300048925 Ga0496122_0150552 Ga0496122_0150552_189_830 201
288 3300048926 Ga0496123_0022170 Ga0496123_0022170_3166_3804 201
289 3300048927 Ga0496124_0003142 Ga0496124_0003142_11846_12484 201
290 3300048927 Ga0496124_0157211 Ga0496124_0157211_199_840 201
291 3300048929 Ga0496126_0200816 Ga0496126_0200816_751_1419 201
292 3300049571 Ga0501034_0000699 Ga0501034_0000699_29293_29928 201
293 3300049571 Ga0501034_0032981 Ga0501034_0032981_3624_4256 201
294 3300049586 Ga0501070_0005356 Ga0501070_0005356_4289_4924 201
295 3300049589 Ga0501073_0000024 Ga0501073_0000024_31912_32547 201
296 3300049590 Ga0501074_0062693 Ga0501074_0062693_1759_2394 201
297 3300049742 Ga0501080_0056542 Ga0501080_0056542_238_873 201
298 3300050491 nmdc:mga00v17_33519_c1 nmdc:mga00v17_33519_c1_1012_1647 201
299 3300050492 nmdc:mga0yw44_21477_c1 nmdc:mga0yw44_21477_c1_771_1406 201
300 3300050492 nmdc:mga0yw44_40546_c1 nmdc:mga0yw44_40546_c1_142_777 201
301 3300053077 Ga0495601_0003606 Ga0495601_0003606_2588_3235 201
302 3300053078 Ga0495612_0005021 Ga0495612_0005021_812_1459 201
303 3300053080 Ga0500635_0065970 Ga0500635_0065970_52_720 201
304 3300053104 Ga0500556_0001014 Ga0500556_0001014_7492_8127 201
305 3300053117 Ga0500593_000363 Ga0500593_000363_9082_9717 201
306 3300053133 Ga0500655_001024 Ga0500655_001024_2531_3166 201
307 3300053136 Ga0500559_0000496 Ga0500559_0000496_22392_23027 201
308 3300053153 Ga0500616_0031943 Ga0500616_0031943_840_1475 201
309 3300053155 Ga0500620_000023 Ga0500620_000023_141_809 201
310 3300053727 Ga0500611_023241 Ga0500611_023241_413_1048 201
311 iso_pu_bacteria 2904430863 2904433363 201
312 3300005336 Ga0070680_100503329 Ga0070680_1005033292 202
313 3300005337 Ga0070682_101068400 Ga0070682_1010684001 202
314 3300005339 Ga0070660_100133370 Ga0070660_1001333702 202
315 3300005366 Ga0070659_100040922 Ga0070659_1000409222 202
316 3300005535 Ga0070684_100270795 Ga0070684_1002707952 202
317 3300006051 Ga0075364_10044269 Ga0075364_100442692 202
318 3300006175 Ga0070712_100406169 Ga0070712_1004061693 202
319 3300009093 Ga0105240_10002006 Ga0105240_100020068 202
320 3300009174 Ga0105241_10009224 Ga0105241_100092248 202
321 3300009545 Ga0105237_10032397 Ga0105237_100323975 202
322 3300009551 Ga0105238_10013809 Ga0105238_100138099 202
323 3300009551 Ga0105238_10426667 Ga0105238_104266672 202
324 3300010375 Ga0105239_10073281 Ga0105239_100732813 202
325 3300013105 Ga0157369_10241338 Ga0157369_102413382 202
326 3300013105 Ga0157369_10867709 Ga0157369_108677091 202
327 3300013307 Ga0157372_10430676 Ga0157372_104306762 202
328 3300022467 Ga0224712_10003570 Ga0224712_100035701 202
329 3300025915 Ga0207693_10452619 Ga0207693_104526191 202
330 3300025919 Ga0207657_10256619 Ga0207657_102566193 202
331 3300025924 Ga0207694_10561669 Ga0207694_105616692 202
332 3300025932 Ga0207690_10017351 Ga0207690_100173514 202
333 3300025944 Ga0207661_10279071 Ga0207661_102790712 202
334 3300026067 Ga0207678_10023532 Ga0207678_100235323 202
335 3300031727 Ga0316576_10047954 Ga0316576_100479543 202
336 3300031728 Ga0316578_10207326 Ga0316578_102073262 202
337 3300031731 Ga0307405_10516200 Ga0307405_105162001 202
338 3300031824 Ga0307413_10175506 Ga0307413_101755062 202
339 3300031824 Ga0307413_10596661 Ga0307413_105966611 202
340 3300031852 Ga0307410_10061015 Ga0307410_100610152 202
341 3300031852 Ga0307410_10263572 Ga0307410_102635721 202
342 3300031901 Ga0307406_10093287 Ga0307406_100932873 202
343 3300031901 Ga0307406_10311593 Ga0307406_103115932 202
344 3300031903 Ga0307407_10221215 Ga0307407_102212152 202
345 3300031903 Ga0307407_10366143 Ga0307407_103661431 202
346 3300031995 Ga0307409_100056591 Ga0307409_1000565911 202
347 3300031995 Ga0307409_100065600 Ga0307409_1000656003 202
348 3300032002 Ga0307416_100038747 Ga0307416_1000387472 202
349 3300032002 Ga0307416_100081307 Ga0307416_1000813073 202
350 3300032002 Ga0307416_100274708 Ga0307416_1002747081 202
351 3300032002 Ga0307416_100656530 Ga0307416_1006565302 202
352 3300032004 Ga0307414_10471167 Ga0307414_104711672 202
353 3300032005 Ga0307411_10328430 Ga0307411_103284303 202
354 3300032126 Ga0307415_100232231 Ga0307415_1002322312 202
355 3300035724 Ga0373933_0004351 Ga0373933_0004351_208_894 202
356 3300037418 Ga0395900_0021269 Ga0395900_0021269_1837_2484 202
357 3300037418 Ga0395900_0126962 Ga0395900_0126962_1592_2239 202
358 3300037466 Ga0395898_0102743 Ga0395898_0102743_1185_1832 202
359 3300037466 Ga0395898_0284253 Ga0395898_0284253_164_811 202
360 3300038443 Ga0395901_0134305 Ga0395901_0134305_1393_2040 202
361 3300044693 Ga0466961_0193716 Ga0466961_0193716_576_1226 202
362 3300044694 Ga0466963_0097962 Ga0466963_0097962_1084_1731 202
363 3300044694 Ga0466963_0160345 Ga0466963_0160345_665_1312 202
364 3300044719 Ga0466971_0309674 Ga0466971_0309674_39_686 202
365 3300044765 Ga0466970_0486519 Ga0466970_0486519_45_692 202
366 3300044842 Ga0466957_0125396 Ga0466957_0125396_380_1027 202
367 3300044842 Ga0466957_0647424 Ga0466957_0647424_81_731 202
368 3300044901 Ga0466960_0150664 Ga0466960_0150664_409_1125 202
369 3300044901 Ga0466960_0285950 Ga0466960_0285950_35_685 202
370 3300044901 Ga0466960_0376123 Ga0466960_0376123_142_789 202
371 3300045836 Ga0466958_0114644 Ga0466958_0114644_776_1423 202
372 3300045836 Ga0466958_0154476 Ga0466958_0154476_591_1241 202
373 3300045976 Ga0466967_0016260 Ga0466967_0016260_1504_2151 202
374 3300045976 Ga0466967_0080213 Ga0466967_0080213_1692_2342 202
375 3300045976 Ga0466967_0189273 Ga0466967_0189273_143_790 202
376 3300046515 Ga0495620_0098934 Ga0495620_0098934_244_891 202
377 3300046518 Ga0495631_0108279 Ga0495631_0108279_412_1077 202
378 3300046539 Ga0495621_0154185 Ga0495621_0154185_209_874 202
379 3300046794 Ga0495589_0136347 Ga0495589_0136347_387_1052 202
380 3300048909 Ga0496106_0865940 Ga0496106_0865940_35_673 202
381 3300053077 Ga0495601_0040369 Ga0495601_0040369_1278_1916 202
382 3300005327 Ga0070658_10007386 Ga0070658_100073863 203
383 3300005327 Ga0070658_10054159 Ga0070658_100541592 203
384 3300005329 Ga0070683_100025595 Ga0070683_1000255956 203
385 3300005330 Ga0070690_100782026 Ga0070690_1007820261 203
386 3300005336 Ga0070680_100142119 Ga0070680_1001421192 203
387 3300005339 Ga0070660_100088855 Ga0070660_1000888552 203
388 3300005458 Ga0070681_10104492 Ga0070681_101044921 203
389 3300005458 Ga0070681_11000230 Ga0070681_110002301 203
390 3300005530 Ga0070679_100007399 Ga0070679_1000073994 203
391 3300005535 Ga0070684_100066242 Ga0070684_1000662422 203
392 3300009176 Ga0105242_10068684 Ga0105242_100686842 203
393 3300013105 Ga0157369_10016379 Ga0157369_100163796 203
394 3300013105 Ga0157369_10101724 Ga0157369_101017241 203
395 3300020069 Ga0197907_10782661 Ga0197907_107826612 203
396 3300025909 Ga0207705_10006198 Ga0207705_100061983 203
397 3300025909 Ga0207705_10094709 Ga0207705_100947092 203
398 3300025909 Ga0207705_10164002 Ga0207705_101640023 203
399 3300025912 Ga0207707_10069975 Ga0207707_100699754 203
400 3300025917 Ga0207660_10173387 Ga0207660_101733872 203
401 3300025919 Ga0207657_10022274 Ga0207657_100222743 203
402 3300025934 Ga0207686_10100348 Ga0207686_101003482 203
403 3300045976 Ga0466967_0332632 Ga0466967_0332632_780_1391 203

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

31

236

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ka9-assembly1.cif.gz_H imidazole glycerol phosphate synthase 0.9411 5 201
4gud-assembly2.cif.gz_B crystal structure of amidotransferase hish from vibrio cholerae 0.9339 4 201
4gud-assembly1.cif.gz_A crystal structure of amidotransferase hish from vibrio cholerae 0.9334 6 200
1ka9-assembly1.cif.gz_H imidazole glycerol phosphate synthase 0.9272 5 201
4gud-assembly1.cif.gz_A crystal structure of amidotransferase hish from vibrio cholerae 0.9152 6 200
ID Description Score Start End Superfamily
af_P9WMM1_1_205_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9722 1 200 3.40.50.880
af_P9WMM1_1_205_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9534 1 200 3.40.50.880
1ka9H00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9411 5 201 3.40.50.880
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9387 6 200 3.40.50.880
af_Q9SZ30_59_284_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9319 1 201 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A6L6R5S6-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 3.5.1.2) (EC 4.3.2.10) (IGP synthase glutaminase subunit) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) 0.9825 1 135 GO:0000105
GO:0000107
GO:0004359
GO:0016829
AF-A0A1V3WHK1-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 3.5.1.2) (EC 4.3.2.10) (IGP synthase glutaminase subunit) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) 0.9814 1 115 GO:0000105
GO:0000107
GO:0004359
GO:0016829
AF-A0A2S9FLK9-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 3.5.1.2) (EC 4.3.2.10) (IGP synthase glutaminase subunit) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) 0.9806 1 131 GO:0000105
GO:0000107
GO:0004359
GO:0016829
AF-A0A522DHH1-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 3.5.1.2) (EC 4.3.2.10) (IGP synthase glutaminase subunit) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) 0.9799 1 132 GO:0000105
GO:0000107
GO:0004359
GO:0016829
AF-A0A6M1QHQ9-F1-model_v4 deleted 0.9783 4 203

Feature Viewer

pLDDT pTM Quality
95.46 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map