F435183

General Info

Members Datasets Scaffolds Average Seq Length
402 283 399 137

Family's Representative Sequence

Representative Sequence 3300046557|Ga0495622_0034190|Ga0495622_0034190_963_1403
Length 140
Sequence MPPPPDEPPFTKGHPAPDALEREVEISAIRAQGKGGQNVNKVSNAVHLRFDIRASSLSEELKERLLSGSDRRVSRDGILIIKAQSHRSLEQNREEALGRLRALIEQASHVPRPRRGSHKRRLQGKEKRANVKALRRRVED

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
3 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
91 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
92 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
93 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
94 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
95 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
96 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
97 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
98 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
124 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
131 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
132 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
133 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
134 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
135 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
151 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
152 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
157 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
160 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
170 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
171 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
174 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
175 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
176 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
177 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
178 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
179 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
180 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
181 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
182 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
183 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
184 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
185 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
188 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
194 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
203 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
208 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
226 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
227 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
231 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
232 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
233 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
234 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
241 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
242 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
243 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
244 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
245 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
246 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
247 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
248 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
252 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
253 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
254 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
257 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
258 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
259 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
263 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
264 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
267 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
268 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
269 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
270 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
271 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
272 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
273 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
274 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
275 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
276 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
277 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
278 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
279 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
280 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
281 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
282 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
283 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.37
Nodule 0.5
Rhizoplane 1
Rhizosphere 64.93
Stem 0
Stem Tuber 0
Unclassified 8.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000090 3300002704 Bacteria 51836
2 JGI25156J39149_1000148 3300002705 Bacteria 51890
3 JGI25154J39366_1000155 3300002738 Bacteria 52889
4 JGI25157J39369_1000183 3300002741 Bacteria 52889
5 JGI25159J45721_1000700 3300002987 Bacteria 14634
6 JGI25159J45721_1013364 3300002987 Bacteria 1902
7 JGI25151J46595_10001873 3300003187 Bacteria 13428
8 JGI25151J46595_10023375 3300003187 Bacteria 2547
9 JGI25151J46595_10033441 3300003187 Bacteria 1981
10 rootH1_10095717 3300003316 Bacteria 4100
11 rootL2_10018177 3300003322 Bacteria 6146
12 rootL2_10019510 3300003322 Bacteria 4452
13 rootH1_10038457 3300003323 Bacteria 9183
14 rootH1_10201108 3300003323 Bacteria 1004
15 JGI25160J50197_1000059 3300003354 Bacteria 116962
16 JGI25160J50197_1029594 3300003354 Bacteria 1444
17 JGI25161J50226_1000109 3300003374 Bacteria 64835
18 JGI25161J50226_1023261 3300003374 Bacteria 613
19 Ga0055526_1005473 3300003771 Bacteria 7288
20 Ga0055526_1007631 3300003771 Bacteria 5579
21 Ga0055526_1050996 3300003771 Bacteria 944
22 Ga0055537_1000245 3300003773 Bacteria 39851
23 Ga0055537_1008529 3300003773 Bacteria 2355
24 Ga0055524_1000057 3300003775 Bacteria 139566
25 Ga0055536_1003494 3300003781 Bacteria 8425
26 Ga0055534_1017401 3300003784 Bacteria 1272
27 Ga0055534_1027939 3300003784 Bacteria 887
28 Ga0055528_1032513 3300003790 Bacteria 1329
29 Ga0055530_10002076 3300003791 Bacteria 13433
30 Ga0055530_10030955 3300003791 Bacteria 1411
31 Ga0055540_1001554 3300003792 Bacteria 13439
32 Ga0055531_10002433 3300003794 Bacteria 12465
33 Ga0055543_1000138 3300004625 Bacteria 60628
34 Ga0055543_1008092 3300004625 Bacteria 2360
35 Ga0065165_1000086 3300005262 Bacteria 154235
36 Ga0065165_1003210 3300005262 Bacteria 11915
37 Ga0065165_1008442 3300005262 Bacteria 4817
38 Ga0070676_10543149 3300005328 Bacteria 831
39 Ga0068869_100391081 3300005334 Bacteria 1142
40 Ga0070680_100414553 3300005336 Bacteria 1149
41 Ga0070682_100028026 3300005337 Bacteria 3385
42 Ga0068868_101247094 3300005338 Bacteria 689
43 Ga0068868_101247870 3300005338 Bacteria 689
44 Ga0070660_100174917 3300005339 Bacteria 1735
45 Ga0070660_100297183 3300005339 Bacteria 1323
46 Ga0070689_101025634 3300005340 Bacteria 735
47 Ga0070661_100277788 3300005344 Bacteria 1299
48 Ga0070692_10011717 3300005345 Bacteria 4035
49 Ga0070692_10115399 3300005345 Bacteria 1491
50 Ga0070659_100874349 3300005366 Bacteria 784
51 Ga0070667_101197979 3300005367 Bacteria 711
52 Ga0070714_100015439 3300005435 Bacteria 6146
53 Ga0070714_100198241 3300005435 Bacteria 1836
54 Ga0070705_100081299 3300005440 Bacteria 1990
55 Ga0070694_100261896 3300005444 Bacteria 1312
56 Ga0070708_100118868 3300005445 Bacteria 2435
57 Ga0070663_100222434 3300005455 Bacteria 1483
58 Ga0070681_10074878 3300005458 Bacteria 3346
59 Ga0070706_100188102 3300005467 Bacteria 1930
60 Ga0070707_100298823 3300005468 Bacteria 1564
61 Ga0070698_100367757 3300005471 Bacteria 1370
62 Ga0070698_101579766 3300005471 Bacteria 608
63 Ga0070699_100006642 3300005518 Bacteria 10056
64 Ga0070679_100025119 3300005530 Bacteria 5843
65 Ga0070679_101150813 3300005530 Bacteria 721
66 Ga0070684_100081796 3300005535 Bacteria 2858
67 Ga0068853_100164313 3300005539 Bacteria 2005
68 Ga0068853_100342443 3300005539 Bacteria 1389
69 Ga0068853_100411873 3300005539 Bacteria 1266
70 Ga0070686_101086829 3300005544 Bacteria 660
71 Ga0070695_100119260 3300005545 Bacteria 1802
72 Ga0070695_100177844 3300005545 Bacteria 1505
73 Ga0070695_100294289 3300005545 Bacteria 1198
74 Ga0070695_100751895 3300005545 Bacteria 778
75 Ga0070696_100029501 3300005546 Bacteria 3750
76 Ga0070696_100361669 3300005546 Bacteria 1126
77 Ga0070696_100591210 3300005546 Bacteria 894
78 Ga0070696_100700143 3300005546 Bacteria 826
79 Ga0070696_101407548 3300005546 Bacteria 595
80 Ga0070693_100004998 3300005547 Bacteria 6335
81 Ga0070704_100085515 3300005549 Bacteria 2334
82 Ga0070704_100166685 3300005549 Bacteria 1747
83 Ga0070704_100696509 3300005549 Bacteria 901
84 Ga0068855_100222038 3300005563 Bacteria 2118
85 Ga0068855_100354446 3300005563 Bacteria 1616
86 Ga0068857_100585929 3300005577 Bacteria 1053
87 Ga0068854_100170679 3300005578 Bacteria 1692
88 Ga0068854_100246728 3300005578 Bacteria 1424
89 Ga0068856_100026594 3300005614 Bacteria 5642
90 Ga0068856_100038624 3300005614 Bacteria 4687
91 Ga0068852_100161351 3300005616 Bacteria 2093
92 Ga0068852_100643750 3300005616 Bacteria 1067
93 Ga0068851_10110189 3300005834 Bacteria 1469
94 Ga0068858_101124858 3300005842 Bacteria 771
95 Ga0075363_100599441 3300006048 Bacteria 660
96 Ga0075364_10004242 3300006051 Bacteria 8231
97 Ga0070716_101076898 3300006173 Bacteria 640
98 Ga0070712_100103698 3300006175 Bacteria 2109
99 Ga0075362_10032202 3300006177 Bacteria 2273
100 Ga0075366_10010288 3300006195 Bacteria 5249
101 Ga0075366_10132961 3300006195 Bacteria 1502
102 Ga0097621_100514741 3300006237 Bacteria 1085
103 Ga0075370_10020206 3300006353 Bacteria 3637
104 Ga0075370_10204696 3300006353 Bacteria 1165
105 Ga0075370_10236153 3300006353 Bacteria 1082
106 Ga0075370_10315375 3300006353 Bacteria 931
107 Ga0075370_10564520 3300006353 Bacteria 689
108 Ga0075428_100014718 3300006844 Bacteria 8688
109 Ga0075428_100320418 3300006844 Bacteria 1666
110 Ga0075430_100898052 3300006846 Bacteria 730
111 Ga0075431_100959915 3300006847 Bacteria 823
112 Ga0075436_100010630 3300006914 Bacteria 6312
113 Ga0075436_100038677 3300006914 Bacteria 3293
114 Ga0079104_1009955 3300006946 Bacteria 3173
115 Ga0105240_10058934 3300009093 Bacteria 4793
116 Ga0111539_10014998 3300009094 Bacteria 9657
117 Ga0105245_11900814 3300009098 Bacteria 648
118 Ga0114129_10462972 3300009147 Bacteria 1661
119 Ga0105241_10071305 3300009174 Bacteria 2697
120 Ga0105241_10921652 3300009174 Bacteria 813
121 Ga0105237_10023031 3300009545 Bacteria 6387
122 Ga0105238_10112002 3300009551 Bacteria 2709
123 Ga0105239_10174801 3300010375 Bacteria 2402
124 Ga0105246_11021759 3300011119 Bacteria 750
125 Ga0157373_10021602 3300013100 Bacteria 4673
126 Ga0157371_10316176 3300013102 Bacteria 1132
127 Ga0157370_10396573 3300013104 Bacteria 1270
128 Ga0157370_11489858 3300013104 Bacteria 608
129 Ga0157372_10301698 3300013307 Bacteria 1863
130 Ga0157372_10317394 3300013307 Bacteria 1814
131 Ga0157380_10146234 3300014326 Bacteria 2037
132 Ga0157377_10866044 3300014745 Bacteria 672
133 Ga0213872_10264102 3300021361 Bacteria 722
134 Ga0209435_100014 3300025206 Bacteria 322129
135 Ga0209436_104445 3300025208 Bacteria 3466
136 Ga0207425_1005409 3300025245 Bacteria 3647
137 Ga0207425_1036160 3300025245 Bacteria 959
138 Ga0209646_1000001 3300025246 Bacteria 3092932
139 Ga0209026_1000137 3300025250 Bacteria 116282
140 Ga0209759_1000013 3300025256 Bacteria 399300
141 Ga0209129_1009317 3300025258 Bacteria 2605
142 Ga0209565_1000028 3300025263 Bacteria 348536
143 Ga0209565_1001085 3300025263 Bacteria 13573
144 Ga0209673_1000035 3300025273 Bacteria 328411
145 Ga0209673_1008755 3300025273 Bacteria 4466
146 Ga0209130_1000052 3300025284 Bacteria 216971
147 Ga0209130_1011570 3300025284 Bacteria 2357
148 Ga0209675_1001685 3300025291 Bacteria 12264
149 Ga0209675_1003118 3300025291 Bacteria 8079
150 Ga0209676_1000634 3300025292 Bacteria 50573
151 Ga0209676_1013887 3300025292 Bacteria 3067
152 Ga0209025_1005213 3300025294 Bacteria 10723
153 Ga0209025_1012897 3300025294 Bacteria 5311
154 Ga0209025_1023178 3300025294 Bacteria 3256
155 Ga0209564_1000229 3300025295 Bacteria 125047
156 Ga0209564_1003759 3300025295 Bacteria 9912
157 Ga0209564_1004913 3300025295 Bacteria 7918
158 Ga0209758_1022528 3300025297 Bacteria 2883
159 Ga0209050_1000023 3300025298 Bacteria 537172
160 Ga0209050_1011041 3300025298 Bacteria 4349
161 Ga0209050_1013772 3300025298 Bacteria 3556
162 Ga0209050_1029475 3300025298 Bacteria 1754
163 Ga0209256_1000003 3300025299 Bacteria 1661127
164 Ga0207426_1000306 3300025302 Bacteria 96112
165 Ga0207426_1007697 3300025302 Bacteria 4473
166 Ga0209051_1000017 3300025303 Bacteria 537172
167 Ga0209051_1004187 3300025303 Bacteria 9003
168 Ga0209051_1030581 3300025303 Bacteria 2087
169 Ga0209257_1000041 3300025304 Bacteria 537172
170 Ga0209257_1000061 3300025304 Bacteria 367698
171 Ga0209257_1027053 3300025304 Bacteria 1917
172 Ga0207685_10038558 3300025905 Bacteria 1767
173 Ga0207699_10888364 3300025906 Bacteria 657
174 Ga0207654_10180887 3300025911 Bacteria 1376
175 Ga0207694_10600954 3300025924 Bacteria 925
176 Ga0207700_11079020 3300025928 Bacteria 718
177 Ga0207664_10840075 3300025929 Bacteria 825
178 Ga0207665_10193739 3300025939 Bacteria 1478
179 Ga0207679_11452055 3300025945 Bacteria 629
180 Ga0207639_10226334 3300026041 Bacteria 1618
181 Ga0207702_10042319 3300026078 Bacteria 3821
182 Ga0207674_11188040 3300026116 Bacteria 732
183 Ga0207698_10460595 3300026142 Bacteria 1230
184 Ga0209281_1050747 3300027111 Unclassified 662
185 Ga0209981_1004620 3300027378 Bacteria 1811
186 Ga0209996_1027754 3300027395 Bacteria 815
187 Ga0209968_1023044 3300027526 Bacteria 1017
188 Ga0209999_1018619 3300027543 Bacteria 1271
189 Ga0209966_1041745 3300027695 Bacteria 958
190 Ga0209974_10055437 3300027876 Bacteria 1337
191 Ga0265318_10039702 3300028577 Bacteria 1795
192 Ga0307515_10000013 3300028794 Bacteria 568456
193 Ga0307515_10002637 3300028794 Bacteria 38528
194 Ga0307515_10064215 3300028794 Bacteria 5136
195 Ga0307515_10409158 3300028794 Bacteria 980
196 Ga0265330_10000062 3300031235 Bacteria 95409
197 Ga0265332_10000001 3300031238 Bacteria 863783
198 Ga0265328_10009465 3300031239 Bacteria 3965
199 Ga0265328_10013425 3300031239 Bacteria 3243
200 Ga0265325_10009916 3300031241 Bacteria 5542
201 Ga0265325_10015878 3300031241 Bacteria 4222
202 Ga0265340_10007258 3300031247 Bacteria 6028
203 Ga0265331_10000873 3300031250 Bacteria 24581
204 Ga0265327_10000135 3300031251 Bacteria 162683
205 Ga0265327_10000178 3300031251 Bacteria 135732
206 Ga0265327_10000407 3300031251 Bacteria 79425
207 Ga0265316_10230614 3300031344 Bacteria 1363
208 Ga0307513_10007938 3300031456 Bacteria 13654
209 Ga0307513_10027199 3300031456 Bacteria 6572
210 Ga0307509_10000245 3300031507 Bacteria 87456
211 Ga0307408_100465032 3300031548 Bacteria 1100
212 Ga0307408_101123872 3300031548 Bacteria 730
213 Ga0265314_10000145 3300031711 Bacteria 106541
214 Ga0307516_10000193 3300031730 Bacteria 78825
215 Ga0307516_10035658 3300031730 Bacteria 4987
216 Ga0307516_10048824 3300031730 Bacteria 4164
217 Ga0307413_11719308 3300031824 Bacteria 560
218 Ga0307406_10017929 3300031901 Bacteria 4130
219 Ga0307406_10861360 3300031901 Bacteria 769
220 Ga0307407_11010020 3300031903 Bacteria 643
221 Ga0307414_10022528 3300032004 Bacteria 3976
222 Ga0307411_10005959 3300032005 Bacteria 6055
223 Ga0316583_10007765 3300032133 Bacteria 3869
224 Ga0373948_0078898 3300034817 Bacteria 748
225 Ga0373940_0019619 3300035088 Bacteria 1710
226 Ga0373923_0575592 3300035111 Bacteria 553
227 Ga0373939_0000059 3300035114 Bacteria 38006
228 Ga0373939_0114497 3300035114 Bacteria 944
229 Ga0373945_0026090 3300035116 Bacteria 2034
230 Ga0373957_0350511 3300035120 Bacteria 630
231 Ga0373960_0010777 3300035121 Bacteria 2239
232 Ga0373943_0014531 3300035170 Bacteria 3567
233 Ga0373946_0026136 3300035171 Bacteria 2300
234 Ga0373961_0017943 3300035241 Bacteria 1842
235 Ga0373931_0000334 3300035691 Bacteria 19574
236 Ga0373931_0095939 3300035691 Bacteria 1660
237 Ga0373935_0118354 3300035692 Bacteria 1767
238 Ga0373937_0384458 3300036401 Bacteria 1331
239 Ga0373925_0001458 3300037068 Bacteria 20434
240 Ga0373925_0104102 3300037068 Bacteria 2185
241 Ga0395899_0002181 3300037312 Bacteria 16076
242 Ga0395898_0051723 3300037466 Bacteria 4016
243 Ga0395905_0007569 3300037471 Bacteria 10791
244 Ga0436361_0356446 3300039447 Bacteria 920
245 Ga0439461_0002998 3300041410 Bacteria 2749
246 Ga0451793_1783535 3300041452 Bacteria 1084
247 Ga0451807_0776223 3300041486 Bacteria 694
248 Ga0451853_0636476 3300041512 Bacteria 1757
249 Ga0451853_1013450 3300041512 Bacteria 2418
250 Ga0439431_0005586 3300041997 Bacteria 2774
251 Ga0450917_000017 3300042120 Bacteria 7614
252 Ga0450920_023014 3300042122 Bacteria 1208
253 Ga0450888_001374 3300042126 Bacteria 2324
254 Ga0450890_003838 3300042127 Bacteria 1979
255 Ga0450891_004138 3300042129 Bacteria 1365
256 Ga0450891_024036 3300042129 Bacteria 610
257 Ga0450892_001235 3300042130 Bacteria 2618
258 Ga0450903_046949 3300042138 Bacteria 635
259 Ga0450889_000047 3300042144 Bacteria 10757
260 Ga0439446_0021333 3300042156 Bacteria 1830
261 Ga0439434_0091383 3300042435 Bacteria 973
262 Ga0439435_0002609 3300042436 Bacteria 3612
263 Ga0450893_0002762 3300042532 Bacteria 2746
264 Ga0451577_0003346 3300042876 Bacteria 17953
265 Ga0451577_0019387 3300042876 Bacteria 6254
266 Ga0451577_0048113 3300042876 Bacteria 3811
267 Ga0451577_0180414 3300042876 Bacteria 1903
268 Ga0451577_0199269 3300042876 Bacteria 1807
269 Ga0451577_0241630 3300042876 Bacteria 1634
270 Ga0451577_0751034 3300042876 Bacteria 882
271 Ga0451577_1360089 3300042876 Bacteria 630
272 Ga0439440_0205269 3300042993 Bacteria 586
273 Ga0453683_0521431 3300044673 Bacteria 772
274 Ga0453684_0015397 3300044712 Bacteria 12107
275 Ga0453684_0022126 3300044712 Bacteria 9454
276 Ga0453684_0029009 3300044712 Bacteria 7872
277 Ga0453684_0124991 3300044712 Bacteria 3098
278 Ga0453684_0140203 3300044712 Bacteria 2888
279 Ga0453684_0331001 3300044712 Bacteria 1722
280 Ga0453684_0645584 3300044712 Bacteria 1155
281 Ga0453684_0804846 3300044712 Bacteria 1013
282 Ga0453684_2557491 3300044712 Bacteria 503
283 Ga0451576_0000237 3300045051 Bacteria 134538
284 Ga0451576_0043050 3300045051 Bacteria 4765
285 Ga0451576_0055391 3300045051 Bacteria 4149
286 Ga0451576_0134098 3300045051 Bacteria 2582
287 Ga0451576_0188256 3300045051 Bacteria 2155
288 Ga0451576_1394399 3300045051 Bacteria 729
289 Ga0451576_2161758 3300045051 Bacteria 572
290 Ga0495603_0033834 3300046455 Bacteria 3075
291 Ga0495629_0000011 3300046459 Bacteria 268675
292 Ga0495629_0054736 3300046459 Bacteria 2791
293 Ga0495641_0463482 3300046461 Bacteria 577
294 Ga0495650_0019572 3300046471 Bacteria 3326
295 Ga0495580_0042012 3300046472 Bacteria 3258
296 Ga0495639_0000691 3300046475 Bacteria 15443
297 Ga0495662_0079542 3300046476 Bacteria 1594
298 Ga0495594_0081109 3300046499 Bacteria 1811
299 Ga0495618_0076508 3300046514 Bacteria 2133
300 Ga0495628_0303222 3300046516 Bacteria 1182
301 Ga0495628_0647288 3300046516 Bacteria 751
302 Ga0495630_0037574 3300046517 Bacteria 3621
303 Ga0495630_0590805 3300046517 Bacteria 851
304 Ga0495666_0001280 3300046526 Bacteria 12186
305 Ga0495666_0018382 3300046526 Bacteria 3479
306 Ga0495642_0575825 3300046528 Bacteria 500
307 Ga0495640_0055680 3300046533 Bacteria 2705
308 Ga0495586_0001350 3300046535 Bacteria 13620
309 Ga0495587_0207528 3300046536 Bacteria 1107
310 Ga0495621_0135750 3300046539 Bacteria 960
311 Ga0495622_0034190 3300046557 Bacteria 2371
312 Ga0495635_0003571 3300046663 Bacteria 10761
313 Ga0495635_0144275 3300046663 Bacteria 1621
314 Ga0495647_0055744 3300046681 Bacteria 1548
315 Ga0495658_0030222 3300046683 Bacteria 2940
316 Ga0495624_0014906 3300046690 Bacteria 5264
317 Ga0495624_0558623 3300046690 Bacteria 683
318 Ga0495670_0001873 3300046691 Bacteria 10349
319 Ga0495600_0035831 3300046809 Bacteria 3224
320 Ga0495581_0050736 3300047315 Bacteria 2396
321 Ga0495604_0162047 3300047317 Bacteria 1579
322 Ga0495676_0011411 3300047321 Bacteria 8020
323 Ga0495680_0002268 3300047322 Bacteria 19803
324 Ga0495685_013355 3300047447 Bacteria 2787
325 Ga0495684_0005217 3300047471 Bacteria 10128
326 Ga0495593_0110736 3300047673 Bacteria 1402
327 Ga0495602_0786064 3300048088 Bacteria 640
328 Ga0496109_0212830 3300048912 Bacteria 1818
329 Ga0496114_0172428 3300048917 Bacteria 1886
330 Ga0496121_0039158 3300048924 Bacteria 4184
331 Ga0496122_0342095 3300048925 Bacteria 785
332 Ga0496123_0262256 3300048926 Bacteria 846
333 Ga0496124_0000004 3300048927 Bacteria 976131
334 Ga0496126_0059742 3300048929 Bacteria 3432
335 Ga0496126_0771439 3300048929 Bacteria 740
336 Ga0501291_036902 3300049514 Bacteria 846
337 Ga0501293_009951 3300049516 Bacteria 817
338 Ga0501298_020863 3300049521 Bacteria 1224
339 Ga0501300_001339 3300049523 Bacteria 3717
340 Ga0501031_0763676 3300049568 Bacteria 620
341 Ga0501036_0604760 3300049572 Bacteria 909
342 Ga0501038_0329567 3300049574 Bacteria 1193
343 Ga0501074_1007302 3300049590 Bacteria 586
344 Ga0501075_0089138 3300049591 Bacteria 2339
345 Ga0501076_1077283 3300049592 Bacteria 662
346 Ga0501199_024732 3300049650 Bacteria 714
347 Ga0501201_006650 3300049651 Bacteria 1098
348 Ga0501202_115488 3300049652 Bacteria 669
349 Ga0501202_127454 3300049652 Bacteria 646
350 Ga0501211_000141 3300049658 Bacteria 5708
351 Ga0501217_021933 3300049661 Bacteria 1511
352 Ga0501227_026225 3300049665 Bacteria 1372
353 Ga0501253_107181 3300049683 Bacteria 662
354 Ga0501258_004364 3300049687 Bacteria 1335
355 Ga0501221_001332 3300049704 Bacteria 4058
356 Ga0501079_0101006 3300049741 Bacteria 2237
357 Ga0501080_0385717 3300049742 Bacteria 1262
358 Ga0501081_0963737 3300049743 Bacteria 644
359 Ga0501266_004499 3300049763 Bacteria 1726
360 Ga0501267_000198 3300049764 Bacteria 4179
361 Ga0501272_001970 3300049769 Bacteria 2012
362 Ga0501045_0139135 3300049824 Bacteria 1805
363 nmdc:mga03n38_425475_c1 3300050490 Bacteria 735
364 nmdc:mga00v17_137020_c1 3300050491 Bacteria 1568
365 nmdc:mga0k408_3497_c2 3300050493 Bacteria 5168
366 nmdc:mga0k408_538894_c1 3300050493 Bacteria 690
367 nmdc:mga07m45_125848_c1 3300050496 Bacteria 1482
368 nmdc:mga07m45_464_c1 3300050496 Bacteria 17073
369 nmdc:mga07m45_467767_c1 3300050496 Bacteria 731
370 nmdc:mga07m45_736603_c1 3300050496 Bacteria 566
371 nmdc:mga06r32_1205659_c1 3300050510 Bacteria 703
372 nmdc:mga08y16_27005_c1 3300050511 Bacteria 6050
373 nmdc:mga08x19_28522_c1 3300050514 Bacteria 3496
374 nmdc:mga08x19_49241_c1 3300050514 Bacteria 2702
375 Ga0495601_0083870 3300053077 Bacteria 2047
376 Ga0495612_0283398 3300053078 Bacteria 741
377 Ga0495619_0091878 3300053085 Bacteria 2055
378 Ga0500643_081454 3300053087 Bacteria 888
379 Ga0500644_0004116 3300053088 Bacteria 3621
380 Ga0500646_0197262 3300053090 Bacteria 689
381 Ga0500566_0060358 3300053094 Bacteria 2148
382 Ga0500650_0000260 3300053098 Bacteria 12731
383 Ga0500555_052983 3300053103 Bacteria 1106
384 Ga0500593_000657 3300053117 Bacteria 13168
385 Ga0500608_196255 3300053122 Bacteria 839
386 Ga0500618_049343 3300053125 Bacteria 955
387 Ga0500628_005438 3300053129 Bacteria 2125
388 Ga0500658_0146848 3300053134 Bacteria 1061
389 Ga0500559_0160164 3300053136 Bacteria 1058
390 Ga0500568_0099818 3300053139 Bacteria 1090
391 Ga0500568_0190494 3300053139 Bacteria 753
392 Ga0500616_0422879 3300053153 Bacteria 529
393 Ga0500622_0004155 3300053156 Bacteria 9266
394 Ga0500622_0322003 3300053156 Bacteria 651
395 Ga0500636_0002342 3300053177 Bacteria 10513
396 Ga0500645_000474 3300053730 Bacteria 27453
397 Ga0500645_005379 3300053730 Bacteria 4726
398 Ga0500645_033650 3300053730 Bacteria 1533
399 Ga0500661_007009 3300055283 Bacteria 2091

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041512 Ga0451853_1013450 Ga0451853_1013450_1703_2107 128
2 3300003322 rootL2_10019510 rootL2_100195103 129
3 3300003323 rootH1_10038457 rootH1_1003845711 129
4 3300021361 Ga0213872_10264102 Ga0213872_102641022 129
5 3300031903 Ga0307407_11010020 Ga0307407_110100202 129
6 3300032004 Ga0307414_10022528 Ga0307414_100225283 129
7 3300032005 Ga0307411_10005959 Ga0307411_100059594 129
8 3300034817 Ga0373948_0078898 Ga0373948_0078898_46_453 129
9 3300035088 Ga0373940_0019619 Ga0373940_0019619_542_949 129
10 3300035114 Ga0373939_0000059 Ga0373939_0000059_22038_22445 129
11 3300035121 Ga0373960_0010777 Ga0373960_0010777_1569_1976 129
12 3300035241 Ga0373961_0017943 Ga0373961_0017943_1265_1672 129
13 3300035691 Ga0373931_0000334 Ga0373931_0000334_4491_4898 129
14 3300036401 Ga0373937_0384458 Ga0373937_0384458_497_937 129
15 3300037471 Ga0395905_0007569 Ga0395905_0007569_4509_4916 129
16 3300039447 Ga0436361_0356446 Ga0436361_0356446_253_666 129
17 3300042122 Ga0450920_023014 Ga0450920_023014_321_728 129
18 3300045051 Ga0451576_0043050 Ga0451576_0043050_17_424 129
19 3300046557 Ga0495622_0034190 Ga0495622_0034190_963_1403 129
20 3300048926 Ga0496123_0262256 Ga0496123_0262256_44_448 129
21 3300048929 Ga0496126_0059742 Ga0496126_0059742_1040_1444 129
22 3300049665 Ga0501227_026225 Ga0501227_026225_120_527 129
23 3300049687 Ga0501258_004364 Ga0501258_004364_26_433 129
24 3300003323 rootH1_10201108 rootH1_102011082 130
25 3300003374 JGI25161J50226_1023261 JGI25161J50226_10232611 130
26 3300003771 Ga0055526_1005473 Ga0055526_10054733 130
27 3300004625 Ga0055543_1008092 Ga0055543_10080923 130
28 3300005262 Ga0065165_1000086 Ga0065165_100008651 130
29 3300005262 Ga0065165_1003210 Ga0065165_10032103 130
30 3300005577 Ga0068857_100585929 Ga0068857_1005859292 130
31 3300005614 Ga0068856_100038624 Ga0068856_1000386244 130
32 3300006353 Ga0075370_10315375 Ga0075370_103153752 130
33 3300025273 Ga0209673_1008755 Ga0209673_10087553 130
34 3300025295 Ga0209564_1000229 Ga0209564_100022968 130
35 3300025298 Ga0209050_1011041 Ga0209050_10110414 130
36 3300025303 Ga0209051_1004187 Ga0209051_10041879 130
37 3300025304 Ga0209257_1000061 Ga0209257_100006148 130
38 3300026078 Ga0207702_10042319 Ga0207702_100423193 130
39 3300031239 Ga0265328_10013425 Ga0265328_100134253 130
40 3300031250 Ga0265331_10000873 Ga0265331_1000087310 130
41 3300031251 Ga0265327_10000407 Ga0265327_1000040717 130
42 3300031548 Ga0307408_100465032 Ga0307408_1004650321 130
43 3300037068 Ga0373925_0104102 Ga0373925_0104102_341_772 130
44 3300042120 Ga0450917_000017 Ga0450917_000017_5764_6174 130
45 3300042126 Ga0450888_001374 Ga0450888_001374_1579_1989 130
46 3300042127 Ga0450890_003838 Ga0450890_003838_18_428 130
47 3300042129 Ga0450891_004138 Ga0450891_004138_899_1309 130
48 3300042130 Ga0450892_001235 Ga0450892_001235_1893_2303 130
49 3300042138 Ga0450903_046949 Ga0450903_046949_152_562 130
50 3300042144 Ga0450889_000047 Ga0450889_000047_2115_2525 130
51 3300042532 Ga0450893_0002762 Ga0450893_0002762_863_1273 130
52 3300042993 Ga0439440_0205269 Ga0439440_0205269_41_451 130
53 3300046514 Ga0495618_0076508 Ga0495618_0076508_1642_2073 130
54 3300046663 Ga0495635_0003571 Ga0495635_0003571_8118_8549 130
55 3300046690 Ga0495624_0014906 Ga0495624_0014906_4061_4492 130
56 3300046691 Ga0495670_0001873 Ga0495670_0001873_535_942 130
57 3300046809 Ga0495600_0035831 Ga0495600_0035831_151_582 130
58 3300047322 Ga0495680_0002268 Ga0495680_0002268_18629_19060 130
59 3300047471 Ga0495684_0005217 Ga0495684_0005217_4163_4594 130
60 3300048912 Ga0496109_0212830 Ga0496109_0212830_467_874 130
61 3300048929 Ga0496126_0771439 Ga0496126_0771439_104_514 130
62 3300049514 Ga0501291_036902 Ga0501291_036902_59_469 130
63 3300049516 Ga0501293_009951 Ga0501293_009951_59_469 130
64 3300049521 Ga0501298_020863 Ga0501298_020863_425_835 130
65 3300049523 Ga0501300_001339 Ga0501300_001339_926_1336 130
66 3300049651 Ga0501201_006650 Ga0501201_006650_27_437 130
67 3300049652 Ga0501202_127454 Ga0501202_127454_59_469 130
68 3300049658 Ga0501211_000141 Ga0501211_000141_2242_2652 130
69 3300049661 Ga0501217_021933 Ga0501217_021933_918_1328 130
70 3300049683 Ga0501253_107181 Ga0501253_107181_181_591 130
71 3300049704 Ga0501221_001332 Ga0501221_001332_1064_1474 130
72 3300049764 Ga0501267_000198 Ga0501267_000198_2146_2556 130
73 3300049769 Ga0501272_001970 Ga0501272_001970_594_1004 130
74 3300050496 nmdc:mga07m45_467767_c1 nmdc:mga07m45_467767_c1_52_462 130
75 3300053085 Ga0495619_0091878 Ga0495619_0091878_794_1225 130
76 3300053156 Ga0500622_0004155 Ga0500622_0004155_6344_6751 130
77 3300005339 Ga0070660_100297183 Ga0070660_1002971832 131
78 3300005455 Ga0070663_100222434 Ga0070663_1002224342 131
79 3300005539 Ga0068853_100342443 Ga0068853_1003424432 131
80 3300005614 Ga0068856_100026594 Ga0068856_1000265947 131
81 3300009174 Ga0105241_10071305 Ga0105241_100713054 131
82 3300009545 Ga0105237_10023031 Ga0105237_100230319 131
83 3300010375 Ga0105239_10174801 Ga0105239_101748011 131
84 3300013100 Ga0157373_10021602 Ga0157373_100216024 131
85 3300013102 Ga0157371_10316176 Ga0157371_103161762 131
86 3300013104 Ga0157370_11489858 Ga0157370_114898582 131
87 3300013307 Ga0157372_10301698 Ga0157372_103016983 131
88 3300046471 Ga0495650_0019572 Ga0495650_0019572_2683_3096 131
89 3300006353 Ga0075370_10020206 Ga0075370_100202065 132
90 3300046472 Ga0495580_0042012 Ga0495580_0042012_188_592 132
91 3300046526 Ga0495666_0018382 Ga0495666_0018382_578_982 132
92 3300047317 Ga0495604_0162047 Ga0495604_0162047_773_1177 132
93 3300050496 nmdc:mga07m45_464_c1 nmdc:mga07m45_464_c1_6398_6814 132
94 3300005328 Ga0070676_10543149 Ga0070676_105431491 133
95 3300005334 Ga0068869_100391081 Ga0068869_1003910812 133
96 3300005338 Ga0068868_101247870 Ga0068868_1012478701 133
97 3300005339 Ga0070660_100174917 Ga0070660_1001749173 133
98 3300005340 Ga0070689_101025634 Ga0070689_1010256341 133
99 3300005344 Ga0070661_100277788 Ga0070661_1002777882 133
100 3300005345 Ga0070692_10115399 Ga0070692_101153991 133
101 3300005367 Ga0070667_101197979 Ga0070667_1011979791 133
102 3300005444 Ga0070694_100261896 Ga0070694_1002618961 133
103 3300005445 Ga0070708_100118868 Ga0070708_1001188683 133
104 3300005458 Ga0070681_10074878 Ga0070681_100748783 133
105 3300005467 Ga0070706_100188102 Ga0070706_1001881021 133
106 3300005468 Ga0070707_100298823 Ga0070707_1002988232 133
107 3300005471 Ga0070698_100367757 Ga0070698_1003677572 133
108 3300005518 Ga0070699_100006642 Ga0070699_1000066425 133
109 3300005530 Ga0070679_100025119 Ga0070679_1000251193 133
110 3300005530 Ga0070679_101150813 Ga0070679_1011508131 133
111 3300005539 Ga0068853_100411873 Ga0068853_1004118732 133
112 3300005545 Ga0070695_100119260 Ga0070695_1001192602 133
113 3300005545 Ga0070695_100751895 Ga0070695_1007518952 133
114 3300005546 Ga0070696_100029501 Ga0070696_1000295014 133
115 3300005547 Ga0070693_100004998 Ga0070693_1000049982 133
116 3300005549 Ga0070704_100166685 Ga0070704_1001666851 133
117 3300005549 Ga0070704_100696509 Ga0070704_1006965092 133
118 3300005563 Ga0068855_100222038 Ga0068855_1002220382 133
119 3300005578 Ga0068854_100170679 Ga0068854_1001706792 133
120 3300005616 Ga0068852_100161351 Ga0068852_1001613513 133
121 3300006175 Ga0070712_100103698 Ga0070712_1001036982 133
122 3300009093 Ga0105240_10058934 Ga0105240_100589343 133
123 3300009098 Ga0105245_11900814 Ga0105245_119008141 133
124 3300009174 Ga0105241_10921652 Ga0105241_109216522 133
125 3300011119 Ga0105246_11021759 Ga0105246_110217592 133
126 3300013104 Ga0157370_10396573 Ga0157370_103965732 133
127 3300013307 Ga0157372_10317394 Ga0157372_103173942 133
128 3300025906 Ga0207699_10888364 Ga0207699_108883642 133
129 3300027378 Ga0209981_1004620 Ga0209981_10046203 133
130 3300027395 Ga0209996_1027754 Ga0209996_10277541 133
131 3300027526 Ga0209968_1023044 Ga0209968_10230441 133
132 3300027543 Ga0209999_1018619 Ga0209999_10186191 133
133 3300027695 Ga0209966_1041745 Ga0209966_10417451 133
134 3300031239 Ga0265328_10009465 Ga0265328_100094654 133
135 3300031251 Ga0265327_10000178 Ga0265327_10000178122 133
136 3300031548 Ga0307408_101123872 Ga0307408_1011238722 133
137 3300041410 Ga0439461_0002998 Ga0439461_0002998_196_603 133
138 3300042156 Ga0439446_0021333 Ga0439446_0021333_1065_1472 133
139 3300042436 Ga0439435_0002609 Ga0439435_0002609_779_1186 133
140 3300048917 Ga0496114_0172428 Ga0496114_0172428_288_692 133
141 iso_pu_bacteria 2511231002 2511245638 133
142 iso_pu_bacteria 2857542790 2857545674 133
143 3300005336 Ga0070680_100414553 Ga0070680_1004145531 134
144 3300005435 Ga0070714_100198241 Ga0070714_1001982414 134
145 3300006173 Ga0070716_101076898 Ga0070716_1010768982 134
146 3300006914 Ga0075436_100038677 Ga0075436_1000386773 134
147 3300025905 Ga0207685_10038558 Ga0207685_100385584 134
148 3300025928 Ga0207700_11079020 Ga0207700_110790201 134
149 3300025929 Ga0207664_10840075 Ga0207664_108400751 134
150 3300025939 Ga0207665_10193739 Ga0207665_101937391 134
151 3300028794 Ga0307515_10002637 Ga0307515_1000263710 134
152 3300031241 Ga0265325_10015878 Ga0265325_100158785 134
153 3300031730 Ga0307516_10000193 Ga0307516_1000019314 134
154 3300031901 Ga0307406_10861360 Ga0307406_108613601 134
155 3300042876 Ga0451577_0003346 Ga0451577_0003346_3608_4012 134
156 3300042876 Ga0451577_0241630 Ga0451577_0241630_722_1126 134
157 3300044712 Ga0453684_0015397 Ga0453684_0015397_4098_4502 134
158 3300044712 Ga0453684_0022126 Ga0453684_0022126_8122_8526 134
159 3300044712 Ga0453684_0124991 Ga0453684_0124991_1310_1726 134
160 3300044712 Ga0453684_0645584 Ga0453684_0645584_254_658 134
161 3300044712 Ga0453684_2557491 Ga0453684_2557491_82_486 134
162 3300049591 Ga0501075_0089138 Ga0501075_0089138_1694_2101 134
163 3300049592 Ga0501076_1077283 Ga0501076_1077283_81_488 134
164 3300049650 Ga0501199_024732 Ga0501199_024732_79_483 134
165 3300049652 Ga0501202_115488 Ga0501202_115488_56_460 134
166 3300049741 Ga0501079_0101006 Ga0501079_0101006_1339_1746 134
167 3300049742 Ga0501080_0385717 Ga0501080_0385717_119_526 134
168 3300049743 Ga0501081_0963737 Ga0501081_0963737_24_431 134
169 3300049824 Ga0501045_0139135 Ga0501045_0139135_807_1214 134
170 3300050514 nmdc:mga08x19_28522_c1 nmdc:mga08x19_28522_c1_777_1181 134
171 3300003316 rootH1_10095717 rootH1_100957173 135
172 3300003322 rootL2_10018177 rootL2_100181772 135
173 3300005338 Ga0068868_101247094 Ga0068868_1012470941 135
174 3300005345 Ga0070692_10011717 Ga0070692_100117172 135
175 3300005440 Ga0070705_100081299 Ga0070705_1000812992 135
176 3300005471 Ga0070698_101579766 Ga0070698_1015797661 135
177 3300005545 Ga0070695_100177844 Ga0070695_1001778442 135
178 3300005546 Ga0070696_100361669 Ga0070696_1003616692 135
179 3300005549 Ga0070704_100085515 Ga0070704_1000855152 135
180 3300005563 Ga0068855_100354446 Ga0068855_1003544462 135
181 3300005578 Ga0068854_100246728 Ga0068854_1002467282 135
182 3300005616 Ga0068852_100643750 Ga0068852_1006437501 135
183 3300005842 Ga0068858_101124858 Ga0068858_1011248582 135
184 3300006237 Ga0097621_100514741 Ga0097621_1005147412 135
185 3300006844 Ga0075428_100014718 Ga0075428_1000147182 135
186 3300006846 Ga0075430_100898052 Ga0075430_1008980522 135
187 3300006847 Ga0075431_100959915 Ga0075431_1009599151 135
188 3300006946 Ga0079104_1009955 Ga0079104_10099553 135
189 3300014326 Ga0157380_10146234 Ga0157380_101462343 135
190 3300014745 Ga0157377_10866044 Ga0157377_108660442 135
191 3300026142 Ga0207698_10460595 Ga0207698_104605952 135
192 3300027111 Ga0209281_1050747 Ga0209281_10507471 135
193 3300028794 Ga0307515_10000013 Ga0307515_10000013229 135
194 3300028794 Ga0307515_10064215 Ga0307515_100642154 135
195 3300028794 Ga0307515_10409158 Ga0307515_104091581 135
196 3300031251 Ga0265327_10000135 Ga0265327_1000013595 135
197 3300031456 Ga0307513_10027199 Ga0307513_100271997 135
198 3300032133 Ga0316583_10007765 Ga0316583_100077653 135
199 3300035111 Ga0373923_0575592 Ga0373923_0575592_92_499 135
200 3300035114 Ga0373939_0114497 Ga0373939_0114497_148_558 135
201 3300035116 Ga0373945_0026090 Ga0373945_0026090_119_559 135
202 3300035170 Ga0373943_0014531 Ga0373943_0014531_1085_1525 135
203 3300035171 Ga0373946_0026136 Ga0373946_0026136_746_1186 135
204 3300035692 Ga0373935_0118354 Ga0373935_0118354_726_1136 135
205 3300037068 Ga0373925_0001458 Ga0373925_0001458_12027_12467 135
206 3300042129 Ga0450891_024036 Ga0450891_024036_121_528 135
207 3300042876 Ga0451577_0019387 Ga0451577_0019387_699_1106 135
208 3300042876 Ga0451577_0048113 Ga0451577_0048113_1418_1837 135
209 3300044673 Ga0453683_0521431 Ga0453683_0521431_297_716 135
210 3300044712 Ga0453684_0029009 Ga0453684_0029009_2357_2770 135
211 3300044712 Ga0453684_0140203 Ga0453684_0140203_2285_2692 135
212 3300044712 Ga0453684_0331001 Ga0453684_0331001_457_876 135
213 3300045051 Ga0451576_0134098 Ga0451576_0134098_973_1380 135
214 3300046455 Ga0495603_0033834 Ga0495603_0033834_1108_1548 135
215 3300046459 Ga0495629_0000011 Ga0495629_0000011_106776_107216 135
216 3300046459 Ga0495629_0054736 Ga0495629_0054736_1648_2055 135
217 3300046461 Ga0495641_0463482 Ga0495641_0463482_45_452 135
218 3300046475 Ga0495639_0000691 Ga0495639_0000691_11662_12102 135
219 3300046476 Ga0495662_0079542 Ga0495662_0079542_835_1242 135
220 3300046499 Ga0495594_0081109 Ga0495594_0081109_214_654 135
221 3300046516 Ga0495628_0303222 Ga0495628_0303222_758_1165 135
222 3300046516 Ga0495628_0647288 Ga0495628_0647288_248_655 135
223 3300046517 Ga0495630_0037574 Ga0495630_0037574_2003_2410 135
224 3300046517 Ga0495630_0590805 Ga0495630_0590805_395_835 135
225 3300046526 Ga0495666_0001280 Ga0495666_0001280_7974_8414 135
226 3300046528 Ga0495642_0575825 Ga0495642_0575825_48_455 135
227 3300046533 Ga0495640_0055680 Ga0495640_0055680_1779_2186 135
228 3300046535 Ga0495586_0001350 Ga0495586_0001350_4776_5216 135
229 3300046536 Ga0495587_0207528 Ga0495587_0207528_29_436 135
230 3300046539 Ga0495621_0135750 Ga0495621_0135750_346_753 135
231 3300046663 Ga0495635_0144275 Ga0495635_0144275_815_1222 135
232 3300046681 Ga0495647_0055744 Ga0495647_0055744_390_830 135
233 3300046683 Ga0495658_0030222 Ga0495658_0030222_607_1047 135
234 3300046690 Ga0495624_0558623 Ga0495624_0558623_200_607 135
235 3300047315 Ga0495581_0050736 Ga0495581_0050736_1272_1712 135
236 3300047321 Ga0495676_0011411 Ga0495676_0011411_1257_1697 135
237 3300047447 Ga0495685_013355 Ga0495685_013355_27_443 135
238 3300047673 Ga0495593_0110736 Ga0495593_0110736_19_426 135
239 3300049568 Ga0501031_0763676 Ga0501031_0763676_99_506 135
240 3300049572 Ga0501036_0604760 Ga0501036_0604760_311_718 135
241 3300049574 Ga0501038_0329567 Ga0501038_0329567_162_569 135
242 3300049590 Ga0501074_1007302 Ga0501074_1007302_97_504 135
243 3300050510 nmdc:mga06r32_1205659_c1 nmdc:mga06r32_1205659_c1_257_670 135
244 3300053077 Ga0495601_0083870 Ga0495601_0083870_313_720 135
245 3300053078 Ga0495612_0283398 Ga0495612_0283398_163_570 135
246 3300053087 Ga0500643_081454 Ga0500643_081454_122_535 135
247 3300053090 Ga0500646_0197262 Ga0500646_0197262_230_637 135
248 3300053094 Ga0500566_0060358 Ga0500566_0060358_18_458 135
249 3300053098 Ga0500650_0000260 Ga0500650_0000260_9981_10400 135
250 3300053134 Ga0500658_0146848 Ga0500658_0146848_88_495 135
251 3300053139 Ga0500568_0190494 Ga0500568_0190494_48_461 135
252 3300053730 Ga0500645_000474 Ga0500645_000474_17079_17486 135
253 3300005337 Ga0070682_100028026 Ga0070682_1000280262 136
254 3300005366 Ga0070659_100874349 Ga0070659_1008743491 136
255 3300005435 Ga0070714_100015439 Ga0070714_1000154394 136
256 3300005535 Ga0070684_100081796 Ga0070684_1000817963 136
257 3300005544 Ga0070686_101086829 Ga0070686_1010868291 136
258 3300005545 Ga0070695_100294289 Ga0070695_1002942892 136
259 3300005546 Ga0070696_100591210 Ga0070696_1005912102 136
260 3300005834 Ga0068851_10110189 Ga0068851_101101892 136
261 3300006195 Ga0075366_10010288 Ga0075366_100102884 136
262 3300006195 Ga0075366_10132961 Ga0075366_101329612 136
263 3300006353 Ga0075370_10236153 Ga0075370_102361532 136
264 3300006844 Ga0075428_100320418 Ga0075428_1003204182 136
265 3300009094 Ga0111539_10014998 Ga0111539_100149986 136
266 3300009147 Ga0114129_10462972 Ga0114129_104629722 136
267 3300009551 Ga0105238_10112002 Ga0105238_101120023 136
268 3300025911 Ga0207654_10180887 Ga0207654_101808872 136
269 3300025924 Ga0207694_10600954 Ga0207694_106009542 136
270 3300025945 Ga0207679_11452055 Ga0207679_114520551 136
271 3300026116 Ga0207674_11188040 Ga0207674_111880402 136
272 3300027876 Ga0209974_10055437 Ga0209974_100554371 136
273 3300028577 Ga0265318_10039702 Ga0265318_100397022 136
274 3300031235 Ga0265330_10000062 Ga0265330_1000006266 136
275 3300031238 Ga0265332_10000001 Ga0265332_10000001404 136
276 3300031241 Ga0265325_10009916 Ga0265325_100099165 136
277 3300031247 Ga0265340_10007258 Ga0265340_100072582 136
278 3300031344 Ga0265316_10230614 Ga0265316_102306143 136
279 3300031507 Ga0307509_10000245 Ga0307509_1000024513 136
280 3300031711 Ga0265314_10000145 Ga0265314_1000014536 136
281 3300031730 Ga0307516_10035658 Ga0307516_100356582 136
282 3300035120 Ga0373957_0350511 Ga0373957_0350511_60_479 136
283 3300035691 Ga0373931_0095939 Ga0373931_0095939_132_551 136
284 3300037312 Ga0395899_0002181 Ga0395899_0002181_8370_8807 136
285 3300037466 Ga0395898_0051723 Ga0395898_0051723_295_732 136
286 3300041997 Ga0439431_0005586 Ga0439431_0005586_2184_2600 136
287 3300042435 Ga0439434_0091383 Ga0439434_0091383_518_934 136
288 3300042876 Ga0451577_0180414 Ga0451577_0180414_1234_1650 136
289 3300042876 Ga0451577_0199269 Ga0451577_0199269_778_1191 136
290 3300042876 Ga0451577_0751034 Ga0451577_0751034_376_792 136
291 3300042876 Ga0451577_1360089 Ga0451577_1360089_191_607 136
292 3300044712 Ga0453684_0804846 Ga0453684_0804846_240_656 136
293 3300045051 Ga0451576_0000237 Ga0451576_0000237_25465_25881 136
294 3300045051 Ga0451576_0055391 Ga0451576_0055391_2760_3173 136
295 3300045051 Ga0451576_0188256 Ga0451576_0188256_320_736 136
296 3300045051 Ga0451576_1394399 Ga0451576_1394399_172_591 136
297 3300045051 Ga0451576_2161758 Ga0451576_2161758_36_470 136
298 3300048088 Ga0495602_0786064 Ga0495602_0786064_60_476 136
299 3300048924 Ga0496121_0039158 Ga0496121_0039158_3062_3478 136
300 3300048925 Ga0496122_0342095 Ga0496122_0342095_49_465 136
301 3300048927 Ga0496124_0000004 Ga0496124_0000004_128066_128482 136
302 3300049763 Ga0501266_004499 Ga0501266_004499_423_866 136
303 3300050493 nmdc:mga0k408_3497_c2 nmdc:mga0k408_3497_c2_1483_1899 136
304 3300050493 nmdc:mga0k408_538894_c1 nmdc:mga0k408_538894_c1_14_424 136
305 3300050496 nmdc:mga07m45_736603_c1 nmdc:mga07m45_736603_c1_134_550 136
306 3300050511 nmdc:mga08y16_27005_c1 nmdc:mga08y16_27005_c1_1000_1431 136
307 3300053122 Ga0500608_196255 Ga0500608_196255_37_450 136
308 3300053125 Ga0500618_049343 Ga0500618_049343_111_524 136
309 3300053136 Ga0500559_0160164 Ga0500559_0160164_221_637 136
310 3300053139 Ga0500568_0099818 Ga0500568_0099818_46_456 136
311 3300053156 Ga0500622_0322003 Ga0500622_0322003_183_593 136
312 3300053177 Ga0500636_0002342 Ga0500636_0002342_1603_2019 136
313 iso_pu_bacteria 2974320154 2974322863 136
314 3300002704 JGI25155J39150_1000090 JGI25155J39150_100009046 137
315 3300002705 JGI25156J39149_1000148 JGI25156J39149_100014846 137
316 3300002738 JGI25154J39366_1000155 JGI25154J39366_100015547 137
317 3300002741 JGI25157J39369_1000183 JGI25157J39369_10001831 137
318 3300002987 JGI25159J45721_1000700 JGI25159J45721_10007007 137
319 3300002987 JGI25159J45721_1013364 JGI25159J45721_10133643 137
320 3300003187 JGI25151J46595_10001873 JGI25151J46595_100018731 137
321 3300003187 JGI25151J46595_10023375 JGI25151J46595_100233753 137
322 3300003187 JGI25151J46595_10033441 JGI25151J46595_100334412 137
323 3300003354 JGI25160J50197_1000059 JGI25160J50197_100005950 137
324 3300003354 JGI25160J50197_1029594 JGI25160J50197_10295942 137
325 3300003374 JGI25161J50226_1000109 JGI25161J50226_10001095 137
326 3300003771 Ga0055526_1007631 Ga0055526_10076311 137
327 3300003771 Ga0055526_1050996 Ga0055526_10509962 137
328 3300003773 Ga0055537_1000245 Ga0055537_10002451 137
329 3300003773 Ga0055537_1008529 Ga0055537_10085292 137
330 3300003775 Ga0055524_1000057 Ga0055524_10000571 137
331 3300003781 Ga0055536_1003494 Ga0055536_100349411 137
332 3300003784 Ga0055534_1017401 Ga0055534_10174011 137
333 3300003784 Ga0055534_1027939 Ga0055534_10279392 137
334 3300003790 Ga0055528_1032513 Ga0055528_10325131 137
335 3300003791 Ga0055530_10002076 Ga0055530_100020761 137
336 3300003791 Ga0055530_10030955 Ga0055530_100309552 137
337 3300003792 Ga0055540_1001554 Ga0055540_100155415 137
338 3300003794 Ga0055531_10002433 Ga0055531_100024331 137
339 3300004625 Ga0055543_1000138 Ga0055543_100013847 137
340 3300005262 Ga0065165_1008442 Ga0065165_10084426 137
341 3300005539 Ga0068853_100164313 Ga0068853_1001643132 137
342 3300005546 Ga0070696_100700143 Ga0070696_1007001431 137
343 3300005546 Ga0070696_101407548 Ga0070696_1014075481 137
344 3300006048 Ga0075363_100599441 Ga0075363_1005994411 137
345 3300006051 Ga0075364_10004242 Ga0075364_100042426 137
346 3300006177 Ga0075362_10032202 Ga0075362_100322022 137
347 3300006353 Ga0075370_10204696 Ga0075370_102046962 137
348 3300006353 Ga0075370_10564520 Ga0075370_105645202 137
349 3300006914 Ga0075436_100010630 Ga0075436_1000106302 137
350 3300025206 Ga0209435_100014 Ga0209435_100014192 137
351 3300025208 Ga0209436_104445 Ga0209436_1044453 137
352 3300025245 Ga0207425_1005409 Ga0207425_10054093 137
353 3300025245 Ga0207425_1036160 Ga0207425_10361602 137
354 3300025246 Ga0209646_1000001 Ga0209646_1000001192 137
355 3300025250 Ga0209026_1000137 Ga0209026_100013798 137
356 3300025256 Ga0209759_1000013 Ga0209759_1000013192 137
357 3300025258 Ga0209129_1009317 Ga0209129_10093174 137
358 3300025263 Ga0209565_1000028 Ga0209565_100002898 137
359 3300025263 Ga0209565_1001085 Ga0209565_100108510 137
360 3300025273 Ga0209673_1000035 Ga0209673_1000035237 137
361 3300025284 Ga0209130_1000052 Ga0209130_1000052154 137
362 3300025284 Ga0209130_1011570 Ga0209130_10115701 137
363 3300025291 Ga0209675_1001685 Ga0209675_10016857 137
364 3300025291 Ga0209675_1003118 Ga0209675_10031188 137
365 3300025292 Ga0209676_1000634 Ga0209676_100063423 137
366 3300025292 Ga0209676_1013887 Ga0209676_10138873 137
367 3300025294 Ga0209025_1005213 Ga0209025_100521312 137
368 3300025294 Ga0209025_1012897 Ga0209025_10128973 137
369 3300025294 Ga0209025_1023178 Ga0209025_10231781 137
370 3300025295 Ga0209564_1003759 Ga0209564_10037595 137
371 3300025295 Ga0209564_1004913 Ga0209564_10049136 137
372 3300025297 Ga0209758_1022528 Ga0209758_10225282 137
373 3300025298 Ga0209050_1000023 Ga0209050_1000023504 137
374 3300025298 Ga0209050_1013772 Ga0209050_10137724 137
375 3300025298 Ga0209050_1029475 Ga0209050_10294753 137
376 3300025299 Ga0209256_1000003 Ga0209256_10000031254 137
377 3300025302 Ga0207426_1000306 Ga0207426_100030647 137
378 3300025302 Ga0207426_1007697 Ga0207426_10076971 137
379 3300025303 Ga0209051_1000017 Ga0209051_1000017504 137
380 3300025303 Ga0209051_1030581 Ga0209051_10305812 137
381 3300025304 Ga0209257_1000041 Ga0209257_1000041504 137
382 3300025304 Ga0209257_1027053 Ga0209257_10270532 137
383 3300026041 Ga0207639_10226334 Ga0207639_102263343 137
384 3300031456 Ga0307513_10007938 Ga0307513_1000793815 137
385 3300031730 Ga0307516_10048824 Ga0307516_100488243 137
386 3300031824 Ga0307413_11719308 Ga0307413_117193081 137
387 3300031901 Ga0307406_10017929 Ga0307406_100179293 137
388 3300041452 Ga0451793_1783535 Ga0451793_1783535_656_1072 137
389 3300041486 Ga0451807_0776223 Ga0451807_0776223_59_475 137
390 3300041512 Ga0451853_0636476 Ga0451853_0636476_331_747 137
391 3300050490 nmdc:mga03n38_425475_c1 nmdc:mga03n38_425475_c1_296_712 137
392 3300050491 nmdc:mga00v17_137020_c1 nmdc:mga00v17_137020_c1_1070_1486 137
393 3300050496 nmdc:mga07m45_125848_c1 nmdc:mga07m45_125848_c1_884_1300 137
394 3300050514 nmdc:mga08x19_49241_c1 nmdc:mga08x19_49241_c1_1206_1622 137
395 3300053088 Ga0500644_0004116 Ga0500644_0004116_159_572 137
396 3300053103 Ga0500555_052983 Ga0500555_052983_631_1044 137
397 3300053117 Ga0500593_000657 Ga0500593_000657_12568_12981 137
398 3300053129 Ga0500628_005438 Ga0500628_005438_185_598 137
399 3300053153 Ga0500616_0422879 Ga0500616_0422879_24_437 137
400 3300053730 Ga0500645_005379 Ga0500645_005379_3941_4354 137
401 3300053730 Ga0500645_033650 Ga0500645_033650_749_1162 137
402 3300055283 Ga0500661_007009 Ga0500661_007009_1507_1923 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00472

RF-1

RF-1 domain

18

140

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ce4-assembly1.cif.gz_u 39s large subunit of the porcine mitochondrial ribosome 0.8559 12 100
3j7y-assembly1.cif.gz_p structure of the large ribosomal subunit from human mitochondria 0.8381 10 99
3j7y-assembly1.cif.gz_p structure of the large ribosomal subunit from human mitochondria 0.8112 10 99
2jva-assembly1.cif.gz_A nmr solution structure of peptidyl-trna hydrolase domain protein from pseudomonas syringae pv. tomato. northeast structural genomics consortium target psr211 0.7946 6 98
4ce4-assembly1.cif.gz_u 39s large subunit of the porcine mitochondrial ribosome 0.7872 12 100
ID Description Score Start End Superfamily
3j7yp00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8381 10 99 3.30.160.20
af_A0A0R0GKX2_1_61_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8378 39 96 3.30.160.20
3j7yp00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8112 10 99 3.30.160.20
1j26A01 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7954 15 99 3.30.160.20
2jvaA00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7946 6 98 3.30.160.20
ID Description Score Start End GO Terms
AF-A0A0P9H3X0-F1-model_v4 deleted 0.8791 9 98
AF-A0A1F8TTM0-F1-model_v4 Peptidyl-tRNA hydrolase 0.8458 9 100 GO:0003747
GO:0004045
GO:0043022
GO:0072344
AF-A0A1E7JBG0-F1-model_v4 Prokaryotic-type class I peptide chain release factors domain-containing protein 0.8331 9 92 GO:0003747
GO:0004045
GO:0043022
GO:0072344
AF-A0A377TQH4-F1-model_v4 Peptidyl-tRNA hydrolase domain-containing protein (EC 3.1.1.29) 0.833 6 95 GO:0003747
GO:0004045
GO:0043022
GO:0072344
AF-A0A3D4BK31-F1-model_v4 Aminoacyl-tRNA hydrolase 0.8319 25 111 GO:0004045
GO:0043022
GO:0072344

Feature Viewer

pLDDT pTM Quality
85.72 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map