F435174

General Info

Members Datasets Scaffolds Average Seq Length
402 187 400 194

Family's Representative Sequence

Representative Sequence 3300046500|Ga0495596_0116082|Ga0495596_0116082_186_809
Length 207
Sequence MARGGQLSRAAAMTNDWMLGSLYLLMAIMLVAGSLIARRERFAKMATMSLAWIAIFGAGFILFTFRDDLGYVAQRLKSEATGAPVVEGQEVRIPMAIDGHFWVEGSLNGIKVKFLVDSGATMTTIGRDTAEAAGVTIASGRGQIVRTGNGMLKVATGRADSLSVGPIERSNVGLHIADHEDLNVLGMNYLSTLQRWGVEGRWLILQS

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
3 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
138 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
139 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
140 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
141 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
142 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
155 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
160 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
161 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
162 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
174 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
175 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
176 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
177 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
178 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
179 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
180 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
181 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
182 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
183 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
184 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.99
Rhizosphere 96.77
Stem 0
Stem Tuber 0.25
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_5936473 2162886012 Bacteria 932
2 JGI24737J22298_10048257 3300001990 Unclassified 1296
3 JGI24749J21850_1000628 3300002076 Bacteria 5125
4 Ga0065715_10001324 3300005293 Bacteria 12489
5 Ga0065715_10121540 3300005293 Bacteria 2212
6 Ga0065715_10587542 3300005293 Bacteria 716
7 Ga0070658_10104339 3300005327 Bacteria 2345
8 Ga0070658_10187294 3300005327 Bacteria 1743
9 Ga0070676_10002121 3300005328 Bacteria 10094
10 Ga0070683_100013527 3300005329 Bacteria 7120
11 Ga0070670_100004992 3300005331 Bacteria 11164
12 Ga0070670_100102883 3300005331 Bacteria 2460
13 Ga0070670_100538634 3300005331 Bacteria 1041
14 Ga0070670_100541196 3300005331 Bacteria 1038
15 Ga0070677_10002637 3300005333 Bacteria 5738
16 Ga0068869_100859616 3300005334 Unclassified 783
17 Ga0070666_10007639 3300005335 Bacteria 6674
18 Ga0070666_10426992 3300005335 Unclassified 955
19 Ga0070666_10541107 3300005335 Bacteria 847
20 Ga0070680_100124379 3300005336 Bacteria 2154
21 Ga0070682_100086959 3300005337 Bacteria 2037
22 Ga0068868_100280789 3300005338 Bacteria 1409
23 Ga0068868_100701236 3300005338 Bacteria 906
24 Ga0070660_100004042 3300005339 Bacteria 10126
25 Ga0070660_100018056 3300005339 Bacteria 5147
26 Ga0070660_100036100 3300005339 Bacteria 3743
27 Ga0070660_100185967 3300005339 Bacteria 1682
28 Ga0070660_100206145 3300005339 Bacteria 1595
29 Ga0070687_100069775 3300005343 Bacteria 1883
30 Ga0070661_100037073 3300005344 Bacteria 3546
31 Ga0070661_100061536 3300005344 Bacteria 2756
32 Ga0070661_100065104 3300005344 Bacteria 2678
33 Ga0070661_100240304 3300005344 Bacteria 1394
34 Ga0070692_10088138 3300005345 Bacteria 1683
35 Ga0070668_100019010 3300005347 Bacteria 5163
36 Ga0070668_100141660 3300005347 Bacteria 1938
37 Ga0070668_100676290 3300005347 Bacteria 909
38 Ga0070669_100001225 3300005353 Bacteria 18628
39 Ga0070669_100053011 3300005353 Bacteria 2969
40 Ga0070669_100227733 3300005353 Bacteria 1476
41 Ga0070669_101016608 3300005353 Bacteria 712
42 Ga0070675_100028327 3300005354 Bacteria 4508
43 Ga0070675_100079829 3300005354 Bacteria 2727
44 Ga0070675_100090137 3300005354 Bacteria 2568
45 Ga0070675_100274715 3300005354 Bacteria 1479
46 Ga0070675_100799310 3300005354 Bacteria 862
47 Ga0070671_100012232 3300005355 Bacteria 6905
48 Ga0070671_100317605 3300005355 Bacteria 1327
49 Ga0070671_100524498 3300005355 Bacteria 1020
50 Ga0070673_100011073 3300005364 Bacteria 6146
51 Ga0070673_100100512 3300005364 Bacteria 2381
52 Ga0070659_100036699 3300005366 Bacteria 3821
53 Ga0070659_100100197 3300005366 Bacteria 2331
54 Ga0070667_100022204 3300005367 Bacteria 5265
55 Ga0070667_100110194 3300005367 Bacteria 2386
56 Ga0070667_100526606 3300005367 Bacteria 1085
57 Ga0070714_100059621 3300005435 Bacteria 3273
58 Ga0070713_100469555 3300005436 Bacteria 1184
59 Ga0070700_100518878 3300005441 Bacteria 920
60 Ga0070694_101190920 3300005444 Unclassified 638
61 Ga0070663_100055625 3300005455 Bacteria 2833
62 Ga0070663_100131680 3300005455 Unclassified 1900
63 Ga0070663_100210963 3300005455 Bacteria 1521
64 Ga0070678_100151494 3300005456 Bacteria 1868
65 Ga0070678_100442821 3300005456 Bacteria 1136
66 Ga0070662_100006571 3300005457 Bacteria 7505
67 Ga0070662_100044675 3300005457 Bacteria 3175
68 Ga0070662_100209049 3300005457 Unclassified 1552
69 Ga0070662_100635949 3300005457 Unclassified 899
70 Ga0068867_100007774 3300005459 Bacteria 7580
71 Ga0070684_100014071 3300005535 Bacteria 6471
72 Ga0068853_100089447 3300005539 Bacteria 2704
73 Ga0068853_100161968 3300005539 Bacteria 2019
74 Ga0068853_100250454 3300005539 Unclassified 1625
75 Ga0068853_100882513 3300005539 Bacteria 858
76 Ga0070672_100071600 3300005543 Bacteria 2758
77 Ga0070672_100074192 3300005543 Bacteria 2713
78 Ga0070672_100181981 3300005543 Bacteria 1752
79 Ga0070693_100114572 3300005547 Bacteria 1664
80 Ga0068855_100482850 3300005563 Bacteria 1348
81 Ga0068855_100939187 3300005563 Bacteria 912
82 Ga0070664_100022595 3300005564 Bacteria 5186
83 Ga0068857_100085897 3300005577 Bacteria 2813
84 Ga0068854_100048622 3300005578 Bacteria 3027
85 Ga0068854_100070867 3300005578 Bacteria 2548
86 Ga0068856_100073561 3300005614 Bacteria 3384
87 Ga0068856_100161461 3300005614 Bacteria 2251
88 Ga0068852_100154688 3300005616 Bacteria 2135
89 Ga0068852_100192881 3300005616 Bacteria 1923
90 Ga0068852_100373610 3300005616 Bacteria 1397
91 Ga0068859_101109475 3300005617 Bacteria 870
92 Ga0068859_101212732 3300005617 Unclassified 831
93 Ga0068864_100023128 3300005618 Bacteria 5219
94 Ga0068864_100092820 3300005618 Bacteria 2665
95 Ga0068866_10349023 3300005718 Bacteria 939
96 Ga0068851_10032499 3300005834 Bacteria 2596
97 Ga0068851_10108004 3300005834 Bacteria 1483
98 Ga0068858_100537161 3300005842 Bacteria 1131
99 Ga0068860_100138586 3300005843 Bacteria 2337
100 Ga0068860_100160858 3300005843 Bacteria 2165
101 Ga0068860_100608494 3300005843 Bacteria 1098
102 Ga0068862_100005653 3300005844 Bacteria 10437
103 Ga0068862_100164348 3300005844 Bacteria 1983
104 Ga0068862_100178119 3300005844 Bacteria 1907
105 Ga0097621_100097439 3300006237 Bacteria 2469
106 Ga0068871_100137012 3300006358 Bacteria 2079
107 Ga0075431_100026197 3300006847 Bacteria 5981
108 Ga0068865_100010420 3300006881 Bacteria 5786
109 Ga0097620_101109166 3300006931 Bacteria 870
110 Ga0097620_101213118 3300006931 Unclassified 831
111 Ga0105245_10006502 3300009098 Bacteria 10268
112 Ga0105243_10081303 3300009148 Bacteria 2645
113 Ga0105243_10138048 3300009148 Bacteria 2077
114 Ga0105242_10042103 3300009176 Bacteria 3686
115 Ga0105248_10355522 3300009177 Bacteria 1649
116 Ga0105238_10012987 3300009551 Bacteria 8406
117 Ga0105249_10044018 3300009553 Bacteria 4060
118 Ga0105249_10494550 3300009553 Bacteria 1267
119 Ga0105239_10055550 3300010375 Bacteria 4343
120 Ga0105239_10627340 3300010375 Bacteria 1227
121 Ga0157373_10137665 3300013100 Unclassified 1717
122 Ga0157371_10040551 3300013102 Bacteria 3325
123 Ga0157371_10060990 3300013102 Bacteria 2674
124 Ga0157371_10109135 3300013102 Bacteria 1964
125 Ga0157371_10337943 3300013102 Bacteria 1095
126 Ga0157370_10133948 3300013104 Bacteria 2311
127 Ga0157369_10508756 3300013105 Bacteria 1246
128 Ga0157374_10015804 3300013296 Bacteria 6630
129 Ga0157374_10499215 3300013296 Bacteria 1221
130 Ga0163162_10749414 3300013306 Bacteria 1096
131 Ga0157372_10291898 3300013307 Bacteria 1896
132 Ga0157372_10604835 3300013307 Bacteria 1278
133 Ga0157372_10693324 3300013307 Bacteria 1185
134 Ga0157372_10816108 3300013307 Bacteria 1083
135 Ga0157375_10648504 3300013308 Bacteria 1212
136 Ga0163163_10521931 3300014325 Bacteria 1250
137 Ga0157380_10012472 3300014326 Bacteria 6166
138 Ga0157380_10230921 3300014326 Bacteria 1662
139 Ga0157380_10436610 3300014326 Unclassified 1253
140 Ga0157380_10488041 3300014326 Bacteria 1193
141 Ga0157376_10096999 3300014969 Bacteria 2567
142 Ga0207697_10001226 3300025315 Bacteria 14035
143 Ga0207697_10097738 3300025315 Bacteria 1249
144 Ga0207682_10003497 3300025893 Bacteria 6810
145 Ga0207680_10162846 3300025903 Bacteria 1497
146 Ga0207680_10508617 3300025903 Unclassified 858
147 Ga0207647_10012852 3300025904 Bacteria 5816
148 Ga0207647_10252664 3300025904 Bacteria 1011
149 Ga0207647_10379735 3300025904 Unclassified 798
150 Ga0207645_10008449 3300025907 Bacteria 7182
151 Ga0207643_10050985 3300025908 Bacteria 2348
152 Ga0207705_10002032 3300025909 Bacteria 15753
153 Ga0207705_10012907 3300025909 Bacteria 6029
154 Ga0207705_10058924 3300025909 Bacteria 2770
155 Ga0207705_10088724 3300025909 Bacteria 2262
156 Ga0207705_10161965 3300025909 Bacteria 1681
157 Ga0207705_10433753 3300025909 Bacteria 1018
158 Ga0207707_10177164 3300025912 Bacteria 1862
159 Ga0207657_10003761 3300025919 Bacteria 16125
160 Ga0207657_10005542 3300025919 Bacteria 13181
161 Ga0207657_10014567 3300025919 Bacteria 7663
162 Ga0207657_10030785 3300025919 Bacteria 4866
163 Ga0207657_10179291 3300025919 Bacteria 1713
164 Ga0207649_10037024 3300025920 Bacteria 2944
165 Ga0207649_10068805 3300025920 Bacteria 2252
166 Ga0207649_10242969 3300025920 Bacteria 1293
167 Ga0207649_10614154 3300025920 Bacteria 837
168 Ga0207652_10249218 3300025921 Bacteria 1602
169 Ga0207681_10014589 3300025923 Bacteria 4888
170 Ga0207681_10086148 3300025923 Bacteria 2231
171 Ga0207681_10103232 3300025923 Bacteria 2060
172 Ga0207681_10114066 3300025923 Bacteria 1971
173 Ga0207681_10417348 3300025923 Bacteria 1087
174 Ga0207694_10012537 3300025924 Bacteria 6391
175 Ga0207650_10005412 3300025925 Bacteria 8712
176 Ga0207650_10292397 3300025925 Bacteria 1329
177 Ga0207659_10033653 3300025926 Bacteria 3530
178 Ga0207659_10134929 3300025926 Bacteria 1910
179 Ga0207659_10264070 3300025926 Bacteria 1402
180 Ga0207659_10901302 3300025926 Bacteria 760
181 Ga0207687_10055427 3300025927 Bacteria 2778
182 Ga0207700_10369899 3300025928 Bacteria 1251
183 Ga0207664_10152119 3300025929 Bacteria 1966
184 Ga0207644_10000597 3300025931 Bacteria 23001
185 Ga0207644_10216409 3300025931 Bacteria 1517
186 Ga0207690_10015275 3300025932 Bacteria 4649
187 Ga0207690_10087865 3300025932 Bacteria 2188
188 Ga0207690_10097492 3300025932 Bacteria 2092
189 Ga0207690_10114866 3300025932 Bacteria 1945
190 Ga0207690_10270333 3300025932 Bacteria 1320
191 Ga0207706_10000487 3300025933 Bacteria 42324
192 Ga0207706_10017858 3300025933 Bacteria 6388
193 Ga0207706_10088610 3300025933 Bacteria 2720
194 Ga0207706_10140382 3300025933 Bacteria 2125
195 Ga0207706_10290793 3300025933 Bacteria 1425
196 Ga0207706_10602061 3300025933 Unclassified 944
197 Ga0207686_10325145 3300025934 Bacteria 1150
198 Ga0207691_10000098 3300025940 Bacteria 76191
199 Ga0207691_10007624 3300025940 Bacteria 10413
200 Ga0207691_10026778 3300025940 Bacteria 5410
201 Ga0207691_10055642 3300025940 Bacteria 3605
202 Ga0207691_10083249 3300025940 Bacteria 2873
203 Ga0207711_10305792 3300025941 Bacteria 1467
204 Ga0207661_10488033 3300025944 Bacteria 1125
205 Ga0207661_11108530 3300025944 Unclassified 729
206 Ga0207679_10115102 3300025945 Bacteria 2130
207 Ga0207679_11334402 3300025945 Unclassified 658
208 Ga0207667_10114008 3300025949 Bacteria 2786
209 Ga0207651_10053927 3300025960 Bacteria 2751
210 Ga0207712_10467079 3300025961 Bacteria 1073
211 Ga0207712_10497833 3300025961 Bacteria 1041
212 Ga0207668_10006503 3300025972 Bacteria 6910
213 Ga0207668_10153498 3300025972 Bacteria 1786
214 Ga0207668_10198093 3300025972 Bacteria 1597
215 Ga0207640_10131704 3300025981 Bacteria 1809
216 Ga0207640_10199481 3300025981 Unclassified 1515
217 Ga0207640_10271558 3300025981 Bacteria 1327
218 Ga0207640_10304994 3300025981 Bacteria 1261
219 Ga0207640_10425815 3300025981 Unclassified 1087
220 Ga0207658_10014507 3300025986 Bacteria 5396
221 Ga0207658_10170939 3300025986 Bacteria 1790
222 Ga0207658_10479616 3300025986 Bacteria 1105
223 Ga0207639_10305144 3300026041 Unclassified 1408
224 Ga0207678_10000213 3300026067 Bacteria 51455
225 Ga0207678_10024329 3300026067 Bacteria 5290
226 Ga0207678_10036447 3300026067 Bacteria 4281
227 Ga0207678_10128233 3300026067 Bacteria 2164
228 Ga0207678_10646126 3300026067 Unclassified 929
229 Ga0207678_11123346 3300026067 Bacteria 696
230 Ga0207708_10075962 3300026075 Bacteria 2577
231 Ga0207702_10217476 3300026078 Bacteria 1779
232 Ga0207702_10316013 3300026078 Bacteria 1486
233 Ga0207648_10027990 3300026089 Bacteria 5001
234 Ga0207676_10574390 3300026095 Bacteria 1080
235 Ga0207674_10033165 3300026116 Bacteria 5407
236 Ga0207675_100042786 3300026118 Bacteria 4229
237 Ga0207683_10001404 3300026121 Bacteria 21746
238 Ga0207683_10442167 3300026121 Bacteria 1198
239 Ga0207698_10778191 3300026142 Unclassified 958
240 Ga0209974_10005144 3300027876 Bacteria 4619
241 Ga0209974_10041963 3300027876 Bacteria 1523
242 Ga0207428_10248744 3300027907 Bacteria 1326
243 Ga0268264_10037349 3300028381 Bacteria 4005
244 Ga0268264_10062265 3300028381 Bacteria 3132
245 Ga0307408_100004303 3300031548 Bacteria 9663
246 Ga0307408_100067741 3300031548 Bacteria 2626
247 Ga0307408_100212710 3300031548 Bacteria 1572
248 Ga0307408_101337650 3300031548 Bacteria 672
249 Ga0307405_10004011 3300031731 Bacteria 6903
250 Ga0307405_10260803 3300031731 Bacteria 1294
251 Ga0307413_10002223 3300031824 Bacteria 7818
252 Ga0307413_10002335 3300031824 Bacteria 7699
253 Ga0307413_10004305 3300031824 Bacteria 6173
254 Ga0307413_10168772 3300031824 Bacteria 1546
255 Ga0307413_10173623 3300031824 Bacteria 1528
256 Ga0307413_10505962 3300031824 Bacteria 971
257 Ga0307413_10841370 3300031824 Bacteria 774
258 Ga0307413_11081888 3300031824 Bacteria 691
259 Ga0307410_10002859 3300031852 Bacteria 8491
260 Ga0307410_10011851 3300031852 Bacteria 5009
261 Ga0307410_10017458 3300031852 Bacteria 4310
262 Ga0307410_10021134 3300031852 Bacteria 3999
263 Ga0307410_10021152 3300031852 Bacteria 3997
264 Ga0307410_10043118 3300031852 Bacteria 2988
265 Ga0307410_10146208 3300031852 Bacteria 1754
266 Ga0307406_10019299 3300031901 Bacteria 3999
267 Ga0307406_10079577 3300031901 Bacteria 2174
268 Ga0307406_10098086 3300031901 Bacteria 1989
269 Ga0307407_10006813 3300031903 Bacteria 5120
270 Ga0307407_10026666 3300031903 Bacteria 3063
271 Ga0307407_10049021 3300031903 Bacteria 2408
272 Ga0307412_10037778 3300031911 Bacteria 3104
273 Ga0307412_10103644 3300031911 Bacteria 2017
274 Ga0307412_10460621 3300031911 Bacteria 1050
275 Ga0307412_10861214 3300031911 Bacteria 791
276 Ga0307412_11173703 3300031911 Bacteria 686
277 Ga0307409_100002226 3300031995 Bacteria 10028
278 Ga0307409_100014080 3300031995 Bacteria 5183
279 Ga0307409_100017727 3300031995 Bacteria 4758
280 Ga0307409_100341205 3300031995 Bacteria 1410
281 Ga0307409_100504695 3300031995 Bacteria 1179
282 Ga0307409_100618752 3300031995 Bacteria 1072
283 Ga0307409_100990888 3300031995 Bacteria 858
284 Ga0307416_100232091 3300032002 Bacteria 1780
285 Ga0307416_100741109 3300032002 Bacteria 1074
286 Ga0307416_101176033 3300032002 Unclassified 872
287 Ga0307414_10001464 3300032004 Bacteria 12269
288 Ga0307414_10003837 3300032004 Bacteria 8088
289 Ga0307414_10008433 3300032004 Bacteria 5845
290 Ga0307414_10033969 3300032004 Bacteria 3376
291 Ga0307414_10036190 3300032004 Bacteria 3293
292 Ga0307414_10041291 3300032004 Bacteria 3123
293 Ga0307414_10050374 3300032004 Bacteria 2884
294 Ga0307414_10221139 3300032004 Bacteria 1555
295 Ga0307414_10284682 3300032004 Bacteria 1391
296 Ga0307414_10330604 3300032004 Bacteria 1301
297 Ga0307414_10436915 3300032004 Bacteria 1145
298 Ga0307414_10535508 3300032004 Bacteria 1041
299 Ga0307414_10694935 3300032004 Bacteria 920
300 Ga0307411_10000729 3300032005 Bacteria 12120
301 Ga0307411_10001114 3300032005 Bacteria 10469
302 Ga0307411_10010628 3300032005 Bacteria 4918
303 Ga0307411_10012212 3300032005 Bacteria 4674
304 Ga0307411_10017862 3300032005 Bacteria 4056
305 Ga0307411_10030326 3300032005 Bacteria 3313
306 Ga0307411_10221627 3300032005 Bacteria 1468
307 Ga0307411_10224331 3300032005 Bacteria 1460
308 Ga0307411_10224613 3300032005 Bacteria 1459
309 Ga0307415_100000454 3300032126 Bacteria 17607
310 Ga0307415_100007718 3300032126 Bacteria 5908
311 Ga0307415_100227913 3300032126 Bacteria 1498
312 Ga0307415_100518991 3300032126 Bacteria 1045
313 Ga0307415_100576132 3300032126 Bacteria 997
314 Ga0307415_100819059 3300032126 Bacteria 851
315 Ga0395899_0057369 3300037312 Bacteria 2875
316 Ga0395899_0155056 3300037312 Bacteria 1621
317 Ga0395900_0000568 3300037418 Bacteria 51073
318 Ga0395900_0067426 3300037418 Bacteria 3676
319 Ga0395900_0260079 3300037418 Bacteria 1734
320 Ga0395900_0326674 3300037418 Bacteria 1513
321 Ga0395900_0435899 3300037418 Bacteria 1269
322 Ga0395905_0000767 3300037471 Bacteria 42332
323 Ga0395905_0002185 3300037471 Bacteria 22103
324 Ga0395905_0009061 3300037471 Bacteria 9761
325 Ga0395905_0089130 3300037471 Bacteria 2891
326 Ga0395905_0131179 3300037471 Bacteria 2357
327 Ga0395901_0004319 3300038443 Bacteria 14350
328 Ga0395901_0178471 3300038443 Bacteria 2227
329 Ga0395901_0698838 3300038443 Unclassified 1012
330 Ga0395901_0821987 3300038443 Bacteria 916
331 Ga0439465_0220156 3300041413 Bacteria 696
332 Ga0439445_0000692 3300042004 Bacteria 7017
333 Ga0439464_0054485 3300042439 Bacteria 1162
334 Ga0466969_0219564 3300044656 Unclassified 865
335 Ga0466972_0048478 3300044658 Bacteria 2052
336 Ga0466965_0497314 3300044683 Bacteria 683
337 Ga0466966_0208451 3300044684 Unclassified 1181
338 Ga0466961_0086637 3300044693 Bacteria 1979
339 Ga0466961_0186924 3300044693 Bacteria 1285
340 Ga0466963_0005150 3300044694 Bacteria 7632
341 Ga0466964_0476130 3300044706 Unclassified 667
342 Ga0466971_0030094 3300044719 Bacteria 2429
343 Ga0466968_0017723 3300044735 Bacteria 2850
344 Ga0466957_0013693 3300044842 Bacteria 4709
345 Ga0466960_0593274 3300044901 Bacteria 657
346 Ga0466959_0048663 3300045049 Bacteria 3116
347 Ga0466959_0187220 3300045049 Bacteria 1446
348 Ga0466958_0009438 3300045836 Bacteria 5437
349 Ga0466958_0010044 3300045836 Bacteria 5290
350 Ga0466967_0073100 3300045976 Bacteria 3075
351 Ga0466967_0161024 3300045976 Bacteria 2106
352 Ga0466967_0297631 3300045976 Bacteria 1552
353 Ga0495596_0116082 3300046500 Unclassified 1040
354 Ga0495663_0002135 3300046525 Bacteria 6038
355 Ga0495663_0027615 3300046525 Bacteria 1666
356 Ga0495621_0003601 3300046539 Bacteria 4278
357 Ga0495621_0004665 3300046539 Bacteria 3875
358 Ga0495621_0010914 3300046539 Bacteria 2794
359 Ga0495621_0094822 3300046539 Bacteria 1129
360 Ga0495633_0040248 3300046558 Bacteria 2228
361 Ga0495633_0066317 3300046558 Bacteria 1686
362 Ga0495625_0559338 3300046660 Unclassified 692
363 Ga0495659_0068389 3300046664 Bacteria 1326
364 Ga0495659_0261934 3300046664 Unclassified 723
365 Ga0495670_0012506 3300046691 Bacteria 4176
366 Ga0495670_0017120 3300046691 Bacteria 3565
367 Ga0495670_0035242 3300046691 Bacteria 2494
368 Ga0495670_0203492 3300046691 Bacteria 1049
369 Ga0495670_0418896 3300046691 Unclassified 724
370 Ga0495636_0359463 3300047318 Bacteria 688
371 Ga0495677_0067550 3300047445 Unclassified 1330
372 Ga0495677_0251059 3300047445 Unclassified 692
373 Ga0496100_0008032 3300048903 Bacteria 5863
374 Ga0496102_0129604 3300048905 Bacteria 2360
375 Ga0496102_0699941 3300048905 Bacteria 936
376 Ga0496105_0162184 3300048908 Bacteria 1835
377 Ga0496106_0212441 3300048909 Bacteria 1541
378 Ga0496107_0007103 3300048910 Bacteria 7716
379 Ga0496108_0076425 3300048911 Bacteria 2830
380 Ga0496109_1195462 3300048912 Bacteria 697
381 Ga0496111_0002556 3300048914 Bacteria 10989
382 Ga0496112_0024166 3300048915 Bacteria 5816
383 Ga0496112_0026808 3300048915 Bacteria 5551
384 Ga0496113_0020586 3300048916 Bacteria 4640
385 Ga0501201_002287 3300049651 Bacteria 1755
386 Ga0501209_005003 3300049656 Bacteria 2353
387 Ga0501223_006286 3300049663 Bacteria 2463
388 Ga0501235_003745 3300049669 Bacteria 3283
389 Ga0501239_038606 3300049672 Bacteria 653
390 Ga0501242_004752 3300049674 Bacteria 1515
391 Ga0501257_056187 3300049686 Bacteria 988
392 Ga0501221_020351 3300049704 Bacteria 1296
393 Ga0501225_0029223 3300049705 Bacteria 1514
394 Ga0501267_001825 3300049764 Bacteria 1865
395 Ga0501268_045488 3300049765 Bacteria 837
396 Ga0501283_012229 3300049779 Bacteria 1288
397 nmdc:mga06r32_27850_c1 3300050510 Bacteria 5283
398 nmdc:mga08y16_67131_c1 3300050511 Bacteria 3741
399 Ga0466962_0007046 3300061719 Bacteria 5387
400 Ga0466962_0198130 3300061719 Bacteria 981

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_10648504 Ga0157375_106485042 163
2 3300038443 Ga0395901_0821987 Ga0395901_0821987_14_562 182
3 3300044901 Ga0466960_0593274 Ga0466960_0593274_73_621 182
4 3300048912 Ga0496109_1195462 Ga0496109_1195462_133_681 182
5 3300061719 Ga0466962_0198130 Ga0466962_0198130_406_954 182
6 3300026095 Ga0207676_10574390 Ga0207676_105743902 183
7 3300031548 Ga0307408_100067741 Ga0307408_1000677411 184
8 3300031548 Ga0307408_101337650 Ga0307408_1013376501 184
9 3300031731 Ga0307405_10260803 Ga0307405_102608031 184
10 3300031824 Ga0307413_10168772 Ga0307413_101687722 184
11 3300031911 Ga0307412_11173703 Ga0307412_111737031 184
12 3300032002 Ga0307416_100741109 Ga0307416_1007411092 184
13 3300032126 Ga0307415_100819059 Ga0307415_1008190591 184
14 3300025926 Ga0207659_10264070 Ga0207659_102640702 185
15 3300005844 Ga0068862_100164348 Ga0068862_1001643482 190
16 3300025315 Ga0207697_10097738 Ga0207697_100977383 190
17 3300025923 Ga0207681_10014589 Ga0207681_100145894 190
18 3300025933 Ga0207706_10290793 Ga0207706_102907932 190
19 3300025972 Ga0207668_10198093 Ga0207668_101980932 190
20 3300031824 Ga0307413_11081888 Ga0307413_110818881 190
21 3300031852 Ga0307410_10017458 Ga0307410_100174581 190
22 3300031903 Ga0307407_10026666 Ga0307407_100266665 190
23 3300031995 Ga0307409_100017727 Ga0307409_1000177274 190
24 3300032004 Ga0307414_10050374 Ga0307414_100503744 190
25 3300032005 Ga0307411_10017862 Ga0307411_100178622 190
26 3300049651 Ga0501201_002287 Ga0501201_002287_612_1184 190
27 3300049656 Ga0501209_005003 Ga0501209_005003_81_653 190
28 3300049663 Ga0501223_006286 Ga0501223_006286_214_786 190
29 3300049669 Ga0501235_003745 Ga0501235_003745_1389_1961 190
30 3300049672 Ga0501239_038606 Ga0501239_038606_58_630 190
31 3300049674 Ga0501242_004752 Ga0501242_004752_889_1461 190
32 3300049686 Ga0501257_056187 Ga0501257_056187_243_815 190
33 3300049704 Ga0501221_020351 Ga0501221_020351_60_632 190
34 3300049705 Ga0501225_0029223 Ga0501225_0029223_697_1269 190
35 3300049764 Ga0501267_001825 Ga0501267_001825_1213_1785 190
36 3300049765 Ga0501268_045488 Ga0501268_045488_192_764 190
37 3300049779 Ga0501283_012229 Ga0501283_012229_146_718 190
38 iso_pu_bacteria 2896429255 2896430354 190
39 iso_pu_bacteria 2885427238 2885428180 191
40 3300032126 Ga0307415_100518991 Ga0307415_1005189912 193
41 3300005844 Ga0068862_100178119 Ga0068862_1001781192 194
42 3300031995 Ga0307409_100990888 Ga0307409_1009908882 194
43 3300032004 Ga0307414_10436915 Ga0307414_104369152 194
44 2162886012 MBSR1b_contig_5936473 MBSR1b_0062.00007450 195
45 3300001990 JGI24737J22298_10048257 JGI24737J22298_100482572 195
46 3300002076 JGI24749J21850_1000628 JGI24749J21850_10006286 195
47 3300005293 Ga0065715_10001324 Ga0065715_100013244 195
48 3300005293 Ga0065715_10121540 Ga0065715_101215403 195
49 3300005293 Ga0065715_10587542 Ga0065715_105875421 195
50 3300005327 Ga0070658_10104339 Ga0070658_101043392 195
51 3300005327 Ga0070658_10187294 Ga0070658_101872942 195
52 3300005328 Ga0070676_10002121 Ga0070676_100021219 195
53 3300005329 Ga0070683_100013527 Ga0070683_1000135273 195
54 3300005331 Ga0070670_100004992 Ga0070670_1000049924 195
55 3300005331 Ga0070670_100102883 Ga0070670_1001028833 195
56 3300005331 Ga0070670_100538634 Ga0070670_1005386342 195
57 3300005331 Ga0070670_100541196 Ga0070670_1005411962 195
58 3300005333 Ga0070677_10002637 Ga0070677_100026374 195
59 3300005334 Ga0068869_100859616 Ga0068869_1008596161 195
60 3300005335 Ga0070666_10007639 Ga0070666_100076393 195
61 3300005335 Ga0070666_10426992 Ga0070666_104269921 195
62 3300005335 Ga0070666_10541107 Ga0070666_105411072 195
63 3300005336 Ga0070680_100124379 Ga0070680_1001243792 195
64 3300005337 Ga0070682_100086959 Ga0070682_1000869592 195
65 3300005338 Ga0068868_100280789 Ga0068868_1002807892 195
66 3300005338 Ga0068868_100701236 Ga0068868_1007012362 195
67 3300005339 Ga0070660_100004042 Ga0070660_1000040423 195
68 3300005339 Ga0070660_100018056 Ga0070660_1000180563 195
69 3300005339 Ga0070660_100036100 Ga0070660_1000361002 195
70 3300005339 Ga0070660_100185967 Ga0070660_1001859672 195
71 3300005339 Ga0070660_100206145 Ga0070660_1002061453 195
72 3300005343 Ga0070687_100069775 Ga0070687_1000697752 195
73 3300005344 Ga0070661_100037073 Ga0070661_1000370733 195
74 3300005344 Ga0070661_100061536 Ga0070661_1000615363 195
75 3300005344 Ga0070661_100065104 Ga0070661_1000651042 195
76 3300005344 Ga0070661_100240304 Ga0070661_1002403041 195
77 3300005345 Ga0070692_10088138 Ga0070692_100881382 195
78 3300005347 Ga0070668_100019010 Ga0070668_1000190106 195
79 3300005347 Ga0070668_100141660 Ga0070668_1001416603 195
80 3300005347 Ga0070668_100676290 Ga0070668_1006762902 195
81 3300005353 Ga0070669_100001225 Ga0070669_1000012259 195
82 3300005353 Ga0070669_100053011 Ga0070669_1000530113 195
83 3300005353 Ga0070669_100227733 Ga0070669_1002277332 195
84 3300005353 Ga0070669_101016608 Ga0070669_1010166081 195
85 3300005354 Ga0070675_100028327 Ga0070675_1000283275 195
86 3300005354 Ga0070675_100079829 Ga0070675_1000798293 195
87 3300005354 Ga0070675_100090137 Ga0070675_1000901373 195
88 3300005354 Ga0070675_100274715 Ga0070675_1002747153 195
89 3300005354 Ga0070675_100799310 Ga0070675_1007993102 195
90 3300005355 Ga0070671_100012232 Ga0070671_1000122322 195
91 3300005355 Ga0070671_100317605 Ga0070671_1003176052 195
92 3300005355 Ga0070671_100524498 Ga0070671_1005244981 195
93 3300005364 Ga0070673_100011073 Ga0070673_1000110733 195
94 3300005364 Ga0070673_100100512 Ga0070673_1001005123 195
95 3300005366 Ga0070659_100036699 Ga0070659_1000366992 195
96 3300005366 Ga0070659_100100197 Ga0070659_1001001972 195
97 3300005367 Ga0070667_100022204 Ga0070667_1000222042 195
98 3300005367 Ga0070667_100110194 Ga0070667_1001101942 195
99 3300005367 Ga0070667_100526606 Ga0070667_1005266062 195
100 3300005435 Ga0070714_100059621 Ga0070714_1000596213 195
101 3300005436 Ga0070713_100469555 Ga0070713_1004695552 195
102 3300005441 Ga0070700_100518878 Ga0070700_1005188782 195
103 3300005444 Ga0070694_101190920 Ga0070694_1011909201 195
104 3300005455 Ga0070663_100055625 Ga0070663_1000556251 195
105 3300005455 Ga0070663_100131680 Ga0070663_1001316801 195
106 3300005455 Ga0070663_100210963 Ga0070663_1002109632 195
107 3300005456 Ga0070678_100151494 Ga0070678_1001514942 195
108 3300005456 Ga0070678_100442821 Ga0070678_1004428212 195
109 3300005457 Ga0070662_100006571 Ga0070662_1000065713 195
110 3300005457 Ga0070662_100044675 Ga0070662_1000446752 195
111 3300005457 Ga0070662_100209049 Ga0070662_1002090493 195
112 3300005457 Ga0070662_100635949 Ga0070662_1006359491 195
113 3300005459 Ga0068867_100007774 Ga0068867_1000077744 195
114 3300005535 Ga0070684_100014071 Ga0070684_1000140717 195
115 3300005539 Ga0068853_100089447 Ga0068853_1000894473 195
116 3300005539 Ga0068853_100161968 Ga0068853_1001619682 195
117 3300005539 Ga0068853_100250454 Ga0068853_1002504543 195
118 3300005539 Ga0068853_100882513 Ga0068853_1008825131 195
119 3300005543 Ga0070672_100071600 Ga0070672_1000716001 195
120 3300005543 Ga0070672_100074192 Ga0070672_1000741924 195
121 3300005543 Ga0070672_100181981 Ga0070672_1001819812 195
122 3300005547 Ga0070693_100114572 Ga0070693_1001145722 195
123 3300005563 Ga0068855_100482850 Ga0068855_1004828502 195
124 3300005563 Ga0068855_100939187 Ga0068855_1009391872 195
125 3300005564 Ga0070664_100022595 Ga0070664_1000225955 195
126 3300005577 Ga0068857_100085897 Ga0068857_1000858972 195
127 3300005578 Ga0068854_100048622 Ga0068854_1000486223 195
128 3300005578 Ga0068854_100070867 Ga0068854_1000708673 195
129 3300005614 Ga0068856_100073561 Ga0068856_1000735613 195
130 3300005614 Ga0068856_100161461 Ga0068856_1001614613 195
131 3300005616 Ga0068852_100154688 Ga0068852_1001546882 195
132 3300005616 Ga0068852_100192881 Ga0068852_1001928813 195
133 3300005616 Ga0068852_100373610 Ga0068852_1003736101 195
134 3300005617 Ga0068859_101109475 Ga0068859_1011094752 195
135 3300005617 Ga0068859_101212732 Ga0068859_1012127322 195
136 3300005618 Ga0068864_100023128 Ga0068864_1000231282 195
137 3300005618 Ga0068864_100092820 Ga0068864_1000928203 195
138 3300005718 Ga0068866_10349023 Ga0068866_103490232 195
139 3300005834 Ga0068851_10032499 Ga0068851_100324992 195
140 3300005834 Ga0068851_10108004 Ga0068851_101080042 195
141 3300005842 Ga0068858_100537161 Ga0068858_1005371611 195
142 3300005843 Ga0068860_100138586 Ga0068860_1001385863 195
143 3300005843 Ga0068860_100160858 Ga0068860_1001608583 195
144 3300005843 Ga0068860_100608494 Ga0068860_1006084942 195
145 3300005844 Ga0068862_100005653 Ga0068862_10000565310 195
146 3300006237 Ga0097621_100097439 Ga0097621_1000974393 195
147 3300006358 Ga0068871_100137012 Ga0068871_1001370122 195
148 3300006847 Ga0075431_100026197 Ga0075431_1000261976 195
149 3300006881 Ga0068865_100010420 Ga0068865_1000104201 195
150 3300006931 Ga0097620_101109166 Ga0097620_1011091662 195
151 3300006931 Ga0097620_101213118 Ga0097620_1012131182 195
152 3300009098 Ga0105245_10006502 Ga0105245_100065028 195
153 3300009148 Ga0105243_10081303 Ga0105243_100813033 195
154 3300009148 Ga0105243_10138048 Ga0105243_101380483 195
155 3300009176 Ga0105242_10042103 Ga0105242_100421034 195
156 3300009177 Ga0105248_10355522 Ga0105248_103555222 195
157 3300009551 Ga0105238_10012987 Ga0105238_100129876 195
158 3300009553 Ga0105249_10044018 Ga0105249_100440185 195
159 3300009553 Ga0105249_10494550 Ga0105249_104945502 195
160 3300010375 Ga0105239_10055550 Ga0105239_100555502 195
161 3300010375 Ga0105239_10627340 Ga0105239_106273402 195
162 3300013100 Ga0157373_10137665 Ga0157373_101376653 195
163 3300013102 Ga0157371_10040551 Ga0157371_100405514 195
164 3300013102 Ga0157371_10060990 Ga0157371_100609903 195
165 3300013102 Ga0157371_10109135 Ga0157371_101091352 195
166 3300013102 Ga0157371_10337943 Ga0157371_103379432 195
167 3300013104 Ga0157370_10133948 Ga0157370_101339483 195
168 3300013105 Ga0157369_10508756 Ga0157369_105087562 195
169 3300013296 Ga0157374_10015804 Ga0157374_100158044 195
170 3300013296 Ga0157374_10499215 Ga0157374_104992152 195
171 3300013306 Ga0163162_10749414 Ga0163162_107494142 195
172 3300013307 Ga0157372_10291898 Ga0157372_102918982 195
173 3300013307 Ga0157372_10604835 Ga0157372_106048352 195
174 3300013307 Ga0157372_10693324 Ga0157372_106933242 195
175 3300013307 Ga0157372_10816108 Ga0157372_108161082 195
176 3300014325 Ga0163163_10521931 Ga0163163_105219312 195
177 3300014326 Ga0157380_10012472 Ga0157380_100124724 195
178 3300014326 Ga0157380_10230921 Ga0157380_102309213 195
179 3300014326 Ga0157380_10436610 Ga0157380_104366101 195
180 3300014326 Ga0157380_10488041 Ga0157380_104880411 195
181 3300014969 Ga0157376_10096999 Ga0157376_100969993 195
182 3300025315 Ga0207697_10001226 Ga0207697_100012262 195
183 3300025893 Ga0207682_10003497 Ga0207682_100034976 195
184 3300025903 Ga0207680_10162846 Ga0207680_101628462 195
185 3300025903 Ga0207680_10508617 Ga0207680_105086171 195
186 3300025904 Ga0207647_10012852 Ga0207647_100128522 195
187 3300025904 Ga0207647_10252664 Ga0207647_102526641 195
188 3300025904 Ga0207647_10379735 Ga0207647_103797352 195
189 3300025907 Ga0207645_10008449 Ga0207645_100084493 195
190 3300025908 Ga0207643_10050985 Ga0207643_100509852 195
191 3300025909 Ga0207705_10002032 Ga0207705_1000203215 195
192 3300025909 Ga0207705_10012907 Ga0207705_100129072 195
193 3300025909 Ga0207705_10058924 Ga0207705_100589241 195
194 3300025909 Ga0207705_10088724 Ga0207705_100887242 195
195 3300025909 Ga0207705_10161965 Ga0207705_101619652 195
196 3300025909 Ga0207705_10433753 Ga0207705_104337532 195
197 3300025912 Ga0207707_10177164 Ga0207707_101771642 195
198 3300025919 Ga0207657_10003761 Ga0207657_100037613 195
199 3300025919 Ga0207657_10005542 Ga0207657_100055427 195
200 3300025919 Ga0207657_10014567 Ga0207657_100145676 195
201 3300025919 Ga0207657_10030785 Ga0207657_100307854 195
202 3300025919 Ga0207657_10179291 Ga0207657_101792913 195
203 3300025920 Ga0207649_10037024 Ga0207649_100370243 195
204 3300025920 Ga0207649_10068805 Ga0207649_100688053 195
205 3300025920 Ga0207649_10242969 Ga0207649_102429691 195
206 3300025920 Ga0207649_10614154 Ga0207649_106141542 195
207 3300025921 Ga0207652_10249218 Ga0207652_102492182 195
208 3300025923 Ga0207681_10086148 Ga0207681_100861483 195
209 3300025923 Ga0207681_10103232 Ga0207681_101032322 195
210 3300025923 Ga0207681_10114066 Ga0207681_101140661 195
211 3300025923 Ga0207681_10417348 Ga0207681_104173481 195
212 3300025924 Ga0207694_10012537 Ga0207694_100125372 195
213 3300025925 Ga0207650_10005412 Ga0207650_100054124 195
214 3300025925 Ga0207650_10292397 Ga0207650_102923972 195
215 3300025926 Ga0207659_10033653 Ga0207659_100336534 195
216 3300025926 Ga0207659_10134929 Ga0207659_101349293 195
217 3300025926 Ga0207659_10901302 Ga0207659_109013022 195
218 3300025927 Ga0207687_10055427 Ga0207687_100554274 195
219 3300025928 Ga0207700_10369899 Ga0207700_103698992 195
220 3300025929 Ga0207664_10152119 Ga0207664_101521193 195
221 3300025931 Ga0207644_10000597 Ga0207644_1000059722 195
222 3300025931 Ga0207644_10216409 Ga0207644_102164093 195
223 3300025932 Ga0207690_10015275 Ga0207690_100152755 195
224 3300025932 Ga0207690_10087865 Ga0207690_100878653 195
225 3300025932 Ga0207690_10097492 Ga0207690_100974922 195
226 3300025932 Ga0207690_10114866 Ga0207690_101148661 195
227 3300025932 Ga0207690_10270333 Ga0207690_102703332 195
228 3300025933 Ga0207706_10000487 Ga0207706_1000048715 195
229 3300025933 Ga0207706_10017858 Ga0207706_100178586 195
230 3300025933 Ga0207706_10088610 Ga0207706_100886103 195
231 3300025933 Ga0207706_10140382 Ga0207706_101403823 195
232 3300025933 Ga0207706_10602061 Ga0207706_106020612 195
233 3300025934 Ga0207686_10325145 Ga0207686_103251452 195
234 3300025940 Ga0207691_10000098 Ga0207691_1000009849 195
235 3300025940 Ga0207691_10007624 Ga0207691_100076243 195
236 3300025940 Ga0207691_10026778 Ga0207691_100267783 195
237 3300025940 Ga0207691_10055642 Ga0207691_100556424 195
238 3300025940 Ga0207691_10083249 Ga0207691_100832492 195
239 3300025941 Ga0207711_10305792 Ga0207711_103057922 195
240 3300025944 Ga0207661_10488033 Ga0207661_104880331 195
241 3300025944 Ga0207661_11108530 Ga0207661_111085302 195
242 3300025945 Ga0207679_10115102 Ga0207679_101151023 195
243 3300025945 Ga0207679_11334402 Ga0207679_113344021 195
244 3300025949 Ga0207667_10114008 Ga0207667_101140082 195
245 3300025960 Ga0207651_10053927 Ga0207651_100539272 195
246 3300025961 Ga0207712_10467079 Ga0207712_104670792 195
247 3300025961 Ga0207712_10497833 Ga0207712_104978332 195
248 3300025972 Ga0207668_10006503 Ga0207668_100065036 195
249 3300025972 Ga0207668_10153498 Ga0207668_101534982 195
250 3300025981 Ga0207640_10131704 Ga0207640_101317042 195
251 3300025981 Ga0207640_10199481 Ga0207640_101994811 195
252 3300025981 Ga0207640_10271558 Ga0207640_102715582 195
253 3300025981 Ga0207640_10304994 Ga0207640_103049942 195
254 3300025981 Ga0207640_10425815 Ga0207640_104258152 195
255 3300025986 Ga0207658_10014507 Ga0207658_100145076 195
256 3300025986 Ga0207658_10170939 Ga0207658_101709392 195
257 3300025986 Ga0207658_10479616 Ga0207658_104796162 195
258 3300026041 Ga0207639_10305144 Ga0207639_103051442 195
259 3300026067 Ga0207678_10000213 Ga0207678_100002137 195
260 3300026067 Ga0207678_10024329 Ga0207678_100243293 195
261 3300026067 Ga0207678_10036447 Ga0207678_100364474 195
262 3300026067 Ga0207678_10128233 Ga0207678_101282331 195
263 3300026067 Ga0207678_10646126 Ga0207678_106461261 195
264 3300026067 Ga0207678_11123346 Ga0207678_111233461 195
265 3300026075 Ga0207708_10075962 Ga0207708_100759622 195
266 3300026078 Ga0207702_10217476 Ga0207702_102174763 195
267 3300026078 Ga0207702_10316013 Ga0207702_103160132 195
268 3300026089 Ga0207648_10027990 Ga0207648_100279905 195
269 3300026116 Ga0207674_10033165 Ga0207674_100331655 195
270 3300026118 Ga0207675_100042786 Ga0207675_1000427862 195
271 3300026121 Ga0207683_10001404 Ga0207683_1000140412 195
272 3300026121 Ga0207683_10442167 Ga0207683_104421672 195
273 3300026142 Ga0207698_10778191 Ga0207698_107781912 195
274 3300027876 Ga0209974_10005144 Ga0209974_100051445 195
275 3300027876 Ga0209974_10041963 Ga0209974_100419632 195
276 3300027907 Ga0207428_10248744 Ga0207428_102487442 195
277 3300028381 Ga0268264_10037349 Ga0268264_100373494 195
278 3300028381 Ga0268264_10062265 Ga0268264_100622653 195
279 3300031548 Ga0307408_100004303 Ga0307408_1000043039 195
280 3300031548 Ga0307408_100212710 Ga0307408_1002127102 195
281 3300031731 Ga0307405_10004011 Ga0307405_100040111 195
282 3300031824 Ga0307413_10002223 Ga0307413_100022231 195
283 3300031824 Ga0307413_10002335 Ga0307413_100023356 195
284 3300031824 Ga0307413_10004305 Ga0307413_100043056 195
285 3300031824 Ga0307413_10173623 Ga0307413_101736232 195
286 3300031824 Ga0307413_10505962 Ga0307413_105059622 195
287 3300031824 Ga0307413_10841370 Ga0307413_108413702 195
288 3300031852 Ga0307410_10002859 Ga0307410_100028595 195
289 3300031852 Ga0307410_10011851 Ga0307410_100118515 195
290 3300031852 Ga0307410_10021134 Ga0307410_100211343 195
291 3300031852 Ga0307410_10021152 Ga0307410_100211522 195
292 3300031852 Ga0307410_10043118 Ga0307410_100431183 195
293 3300031852 Ga0307410_10146208 Ga0307410_101462082 195
294 3300031901 Ga0307406_10019299 Ga0307406_100192993 195
295 3300031901 Ga0307406_10079577 Ga0307406_100795772 195
296 3300031901 Ga0307406_10098086 Ga0307406_100980863 195
297 3300031903 Ga0307407_10006813 Ga0307407_100068135 195
298 3300031903 Ga0307407_10049021 Ga0307407_100490213 195
299 3300031911 Ga0307412_10037778 Ga0307412_100377784 195
300 3300031911 Ga0307412_10103644 Ga0307412_101036444 195
301 3300031911 Ga0307412_10460621 Ga0307412_104606211 195
302 3300031911 Ga0307412_10861214 Ga0307412_108612142 195
303 3300031995 Ga0307409_100002226 Ga0307409_10000222611 195
304 3300031995 Ga0307409_100014080 Ga0307409_1000140805 195
305 3300031995 Ga0307409_100341205 Ga0307409_1003412052 195
306 3300031995 Ga0307409_100504695 Ga0307409_1005046952 195
307 3300031995 Ga0307409_100618752 Ga0307409_1006187521 195
308 3300032002 Ga0307416_100232091 Ga0307416_1002320912 195
309 3300032002 Ga0307416_101176033 Ga0307416_1011760332 195
310 3300032004 Ga0307414_10001464 Ga0307414_100014648 195
311 3300032004 Ga0307414_10003837 Ga0307414_100038373 195
312 3300032004 Ga0307414_10008433 Ga0307414_100084337 195
313 3300032004 Ga0307414_10033969 Ga0307414_100339693 195
314 3300032004 Ga0307414_10036190 Ga0307414_100361904 195
315 3300032004 Ga0307414_10041291 Ga0307414_100412913 195
316 3300032004 Ga0307414_10221139 Ga0307414_102211393 195
317 3300032004 Ga0307414_10284682 Ga0307414_102846822 195
318 3300032004 Ga0307414_10330604 Ga0307414_103306042 195
319 3300032004 Ga0307414_10535508 Ga0307414_105355082 195
320 3300032004 Ga0307414_10694935 Ga0307414_106949352 195
321 3300032005 Ga0307411_10000729 Ga0307411_1000072910 195
322 3300032005 Ga0307411_10001114 Ga0307411_100011145 195
323 3300032005 Ga0307411_10010628 Ga0307411_100106282 195
324 3300032005 Ga0307411_10012212 Ga0307411_100122121 195
325 3300032005 Ga0307411_10030326 Ga0307411_100303264 195
326 3300032005 Ga0307411_10221627 Ga0307411_102216272 195
327 3300032005 Ga0307411_10224331 Ga0307411_102243312 195
328 3300032005 Ga0307411_10224613 Ga0307411_102246132 195
329 3300032126 Ga0307415_100000454 Ga0307415_1000004547 195
330 3300032126 Ga0307415_100007718 Ga0307415_1000077182 195
331 3300032126 Ga0307415_100227913 Ga0307415_1002279132 195
332 3300032126 Ga0307415_100576132 Ga0307415_1005761322 195
333 3300037312 Ga0395899_0057369 Ga0395899_0057369_2095_2682 195
334 3300037312 Ga0395899_0155056 Ga0395899_0155056_80_670 195
335 3300037418 Ga0395900_0000568 Ga0395900_0000568_29013_29600 195
336 3300037418 Ga0395900_0067426 Ga0395900_0067426_767_1357 195
337 3300037418 Ga0395900_0260079 Ga0395900_0260079_260_847 195
338 3300037418 Ga0395900_0326674 Ga0395900_0326674_326_913 195
339 3300037418 Ga0395900_0435899 Ga0395900_0435899_98_685 195
340 3300037471 Ga0395905_0000767 Ga0395905_0000767_3387_3974 195
341 3300037471 Ga0395905_0002185 Ga0395905_0002185_3380_3967 195
342 3300037471 Ga0395905_0009061 Ga0395905_0009061_8579_9169 195
343 3300037471 Ga0395905_0089130 Ga0395905_0089130_2294_2881 195
344 3300037471 Ga0395905_0131179 Ga0395905_0131179_1568_2155 195
345 3300038443 Ga0395901_0004319 Ga0395901_0004319_10675_11262 195
346 3300038443 Ga0395901_0178471 Ga0395901_0178471_1078_1668 195
347 3300038443 Ga0395901_0698838 Ga0395901_0698838_44_634 195
348 3300041413 Ga0439465_0220156 Ga0439465_0220156_45_632 195
349 3300042004 Ga0439445_0000692 Ga0439445_0000692_5261_5848 195
350 3300042439 Ga0439464_0054485 Ga0439464_0054485_315_902 195
351 3300044656 Ga0466969_0219564 Ga0466969_0219564_172_759 195
352 3300044658 Ga0466972_0048478 Ga0466972_0048478_344_931 195
353 3300044683 Ga0466965_0497314 Ga0466965_0497314_69_656 195
354 3300044684 Ga0466966_0208451 Ga0466966_0208451_82_669 195
355 3300044693 Ga0466961_0086637 Ga0466961_0086637_1013_1600 195
356 3300044693 Ga0466961_0186924 Ga0466961_0186924_520_1107 195
357 3300044694 Ga0466963_0005150 Ga0466963_0005150_3371_3958 195
358 3300044706 Ga0466964_0476130 Ga0466964_0476130_44_634 195
359 3300044719 Ga0466971_0030094 Ga0466971_0030094_64_651 195
360 3300044735 Ga0466968_0017723 Ga0466968_0017723_2213_2803 195
361 3300044842 Ga0466957_0013693 Ga0466957_0013693_3623_4210 195
362 3300045049 Ga0466959_0048663 Ga0466959_0048663_209_796 195
363 3300045049 Ga0466959_0187220 Ga0466959_0187220_670_1260 195
364 3300045836 Ga0466958_0009438 Ga0466958_0009438_1423_2013 195
365 3300045836 Ga0466958_0010044 Ga0466958_0010044_1007_1594 195
366 3300045976 Ga0466967_0073100 Ga0466967_0073100_79_666 195
367 3300045976 Ga0466967_0161024 Ga0466967_0161024_1335_1925 195
368 3300045976 Ga0466967_0297631 Ga0466967_0297631_710_1300 195
369 3300046500 Ga0495596_0116082 Ga0495596_0116082_186_809 195
370 3300046525 Ga0495663_0002135 Ga0495663_0002135_225_812 195
371 3300046525 Ga0495663_0027615 Ga0495663_0027615_860_1447 195
372 3300046539 Ga0495621_0003601 Ga0495621_0003601_606_1193 195
373 3300046539 Ga0495621_0004665 Ga0495621_0004665_1285_1872 195
374 3300046539 Ga0495621_0010914 Ga0495621_0010914_704_1291 195
375 3300046539 Ga0495621_0094822 Ga0495621_0094822_456_1043 195
376 3300046558 Ga0495633_0040248 Ga0495633_0040248_681_1268 195
377 3300046558 Ga0495633_0066317 Ga0495633_0066317_1054_1641 195
378 3300046660 Ga0495625_0559338 Ga0495625_0559338_76_663 195
379 3300046664 Ga0495659_0068389 Ga0495659_0068389_410_997 195
380 3300046664 Ga0495659_0261934 Ga0495659_0261934_93_680 195
381 3300046691 Ga0495670_0012506 Ga0495670_0012506_1494_2117 195
382 3300046691 Ga0495670_0017120 Ga0495670_0017120_2952_3539 195
383 3300046691 Ga0495670_0035242 Ga0495670_0035242_1343_1930 195
384 3300046691 Ga0495670_0203492 Ga0495670_0203492_107_694 195
385 3300046691 Ga0495670_0418896 Ga0495670_0418896_43_630 195
386 3300047318 Ga0495636_0359463 Ga0495636_0359463_88_675 195
387 3300047445 Ga0495677_0067550 Ga0495677_0067550_45_632 195
388 3300047445 Ga0495677_0251059 Ga0495677_0251059_85_672 195
389 3300048903 Ga0496100_0008032 Ga0496100_0008032_4713_5300 195
390 3300048905 Ga0496102_0129604 Ga0496102_0129604_651_1238 195
391 3300048905 Ga0496102_0699941 Ga0496102_0699941_42_629 195
392 3300048908 Ga0496105_0162184 Ga0496105_0162184_1012_1599 195
393 3300048909 Ga0496106_0212441 Ga0496106_0212441_914_1501 195
394 3300048910 Ga0496107_0007103 Ga0496107_0007103_6019_6606 195
395 3300048911 Ga0496108_0076425 Ga0496108_0076425_1001_1588 195
396 3300048914 Ga0496111_0002556 Ga0496111_0002556_7877_8464 195
397 3300048915 Ga0496112_0024166 Ga0496112_0024166_2581_3171 195
398 3300048915 Ga0496112_0026808 Ga0496112_0026808_1243_1830 195
399 3300048916 Ga0496113_0020586 Ga0496113_0020586_3971_4558 195
400 3300050510 nmdc:mga06r32_27850_c1 nmdc:mga06r32_27850_c1_3991_4578 195
401 3300050511 nmdc:mga08y16_67131_c1 nmdc:mga08y16_67131_c1_2228_2815 195
402 3300061719 Ga0466962_0007046 Ga0466962_0007046_3078_3665 195

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13650

Asp_protease_2

Aspartyl protease

103

189

0.96

PF13975

gag-asp_proteas

gag-polyprotein putative aspartyl protease

103

192

0.95

PF09668

Asp_protease

Aspartyl protease

90

197

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5c9d-assembly1.cif.gz_A crystal structure of a retropepsin-like aspartic protease from rickettsia conorii 0.8877 77 193
5c9b-assembly1.cif.gz_D crystal structure of a retropepsin-like aspartic protease from rickettsia conorii 0.8819 77 193
2o40-assembly1.cif.gz_A crystal structure of a chemically synthesized 203 amino acid 'covalent dimer' hiv-1 protease molecule 0.8541 90 180
5c9b-assembly1.cif.gz_C crystal structure of a retropepsin-like aspartic protease from rickettsia conorii 0.8504 77 193
5c9b-assembly1.cif.gz_B crystal structure of a retropepsin-like aspartic protease from rickettsia conorii 0.8468 77 193
ID Description Score Start End Superfamily
af_Q54J95_15_120_2.40.70.10 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.8173 88 179 2.40.70.10
af_O16635_354_450_2.40.70.10 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.8168 90 180 2.40.70.10
af_A0A2R8QBY4_304_438_2.40.70.10 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.8016 82 182 2.40.70.10
5c9fB00 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.8015 71 193 2.40.70.10
3sm2B00 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.7978 90 192 2.40.70.10
ID Description Score Start End GO Terms
AF-A0A7H0GF63-F1-model_v4 deleted 0.977 70 195
AF-A0A1F3WUQ6-F1-model_v4 Aspartyl protease 0.9599 71 195
AF-A0A849R9L0-F1-model_v4 Retroviral-like aspartic protease family protein 0.9546 78 194 GO:0004190
GO:0006508
AF-A0A2S5QS68-F1-model_v4 deleted 0.9515 74 193
AF-A0A838VAM2-F1-model_v4 Retroviral-like aspartic protease family protein 0.9469 78 194 GO:0004190
GO:0006508

Feature Viewer

pLDDT pTM Quality
80.87 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map