F435140

General Info

Members Datasets Scaffolds Average Seq Length
402 226 804 190

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0709259|Ga0373937_0709259_245_886
Length 213
Sequence MTFVNRAKPNQNMVLLIDNYDSFTYNLAQYFGELGCELVVRRNDAISLKEIEALAPERICISPGPCTPRKAGISKDVILAFGARTPILGVCLGHQCIAEAYGGEIVRASRLMHGKASTITHNGNGLFSDLATSFDAGRYHSLVVKRASLPACLEITAESDDGEIMALCHREFSVYGVQFHPESVLTHDGKKILARFLTLAPKNDTRRDKTLYG

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
145 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
146 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
147 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
150 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
167 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
168 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
169 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
225 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
226 2718217752 Candidatus Xiphinematobacter sp. Idaho Grape Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 8.21
Rhizosphere 91.04
Stem 0
Stem Tuber 0
Unclassified 3.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0709259 3300036401 Bacteria 953
2 MBSR1b_contig_3836444 2162886012 Bacteria 1408
3 MBSR1b_contig_5447818 2162886012 Bacteria 1015
4 JGI24743J22301_10025934 3300001991 Bacteria 1138
5 JGI24035J26624_1000898 3300002126 Bacteria 2817
6 JGI25406J46586_10091005 3300003203 Bacteria 921
7 Ga0065704_10039053 3300005289 Bacteria 1004
8 Ga0065704_10106064 3300005289 Bacteria 2089
9 Ga0065704_10204227 3300005289 Bacteria 1134
10 Ga0065704_10295989 3300005289 Bacteria 894
11 Ga0065712_10008985 3300005290 Bacteria 3165
12 Ga0065712_10012070 3300005290 Bacteria 1781
13 Ga0065712_10079007 3300005290 Bacteria 3263
14 Ga0065712_10087869 3300005290 Bacteria 2535
15 Ga0065712_10088979 3300005290 Bacteria 2487
16 Ga0065712_10202236 3300005290 Bacteria 1095
17 Ga0065712_10203333 3300005290 Bacteria 1100
18 Ga0065715_10012020 3300005293 Bacteria 3481
19 Ga0065715_10089294 3300005293 Bacteria 11457
20 Ga0065715_10169511 3300005293 Bacteria 1558
21 Ga0065715_10208071 3300005293 Bacteria 1327
22 Ga0065715_10738814 3300005293 Bacteria 635
23 Ga0065707_10205988 3300005295 Bacteria 1288
24 Ga0065707_10662995 3300005295 Bacteria 657
25 Ga0070658_10273522 3300005327 Unclassified 1437
26 Ga0070676_10005745 3300005328 Bacteria 6613
27 Ga0070683_100027635 3300005329 Bacteria 5119
28 Ga0070683_100076559 3300005329 Bacteria 3127
29 Ga0070683_100281815 3300005329 Bacteria 1581
30 Ga0070690_100364420 3300005330 Bacteria 1052
31 Ga0070690_100524621 3300005330 Unclassified 889
32 Ga0070666_10007060 3300005335 Bacteria 6923
33 Ga0070666_10695312 3300005335 Bacteria 745
34 Ga0070680_100030939 3300005336 Bacteria 4300
35 Ga0070682_100365191 3300005337 Bacteria 1081
36 Ga0068868_100033859 3300005338 Bacteria 3941
37 Ga0068868_100119597 3300005338 Bacteria 2148
38 Ga0068868_100275029 3300005338 Unclassified 1424
39 Ga0070660_100123588 3300005339 Bacteria 2067
40 Ga0070689_100062367 3300005340 Bacteria 2901
41 Ga0070689_100426813 3300005340 Unclassified 1124
42 Ga0070687_100003056 3300005343 Bacteria 6438
43 Ga0070661_100056777 3300005344 Bacteria 2869
44 Ga0070668_100088001 3300005347 Bacteria 2444
45 Ga0070669_100009350 3300005353 Bacteria 6981
46 Ga0070675_100027219 3300005354 Bacteria 4592
47 Ga0070675_100029855 3300005354 Bacteria 4398
48 Ga0070675_100072167 3300005354 Bacteria 2866
49 Ga0070675_100227655 3300005354 Bacteria 1625
50 Ga0070671_100176960 3300005355 Bacteria 1805
51 Ga0070671_100324256 3300005355 Bacteria 1313
52 Ga0070688_100009020 3300005365 Bacteria 5437
53 Ga0070688_100759470 3300005365 Bacteria 755
54 Ga0070659_100057065 3300005366 Bacteria 3078
55 Ga0070659_100200642 3300005366 Bacteria 1642
56 Ga0070659_100719072 3300005366 Bacteria 864
57 Ga0070667_100013126 3300005367 Bacteria 6849
58 Ga0070667_100397669 3300005367 Bacteria 1254
59 Ga0070709_10306267 3300005434 Bacteria 1162
60 Ga0070709_10369311 3300005434 Bacteria 1064
61 Ga0070714_100077012 3300005435 Bacteria 2896
62 Ga0070714_100084380 3300005435 Bacteria 2772
63 Ga0070713_100134236 3300005436 Bacteria 2185
64 Ga0070713_100173684 3300005436 Bacteria 1932
65 Ga0070713_100210503 3300005436 Bacteria 1760
66 Ga0070711_100007799 3300005439 Bacteria 6522
67 Ga0070711_100030528 3300005439 Bacteria 3569
68 Ga0070711_100090775 3300005439 Bacteria 2201
69 Ga0070711_100918961 3300005439 Bacteria 747
70 Ga0070705_100050199 3300005440 Bacteria 2425
71 Ga0070705_100205828 3300005440 Bacteria 1353
72 Ga0070694_100060876 3300005444 Bacteria 2576
73 Ga0070694_100129353 3300005444 Bacteria 1822
74 Ga0070708_100025662 3300005445 Bacteria 5040
75 Ga0070708_100102471 3300005445 Bacteria 2623
76 Ga0070708_100138954 3300005445 Bacteria 2252
77 Ga0070708_100224588 3300005445 Bacteria 1762
78 Ga0070708_100473489 3300005445 Bacteria 1181
79 Ga0070663_100062955 3300005455 Bacteria 2676
80 Ga0070662_100011609 3300005457 Bacteria 5814
81 Ga0070706_100083548 3300005467 Bacteria 2958
82 Ga0070706_100119852 3300005467 Bacteria 2452
83 Ga0070706_100151719 3300005467 Bacteria 2163
84 Ga0070706_100504945 3300005467 Unclassified 1125
85 Ga0070706_100615140 3300005467 Bacteria 1009
86 Ga0070707_100006052 3300005468 Bacteria 11295
87 Ga0070707_100025781 3300005468 Bacteria 5580
88 Ga0070707_100040797 3300005468 Bacteria 4441
89 Ga0070707_100099186 3300005468 Bacteria 2822
90 Ga0070707_100245338 3300005468 Bacteria 1743
91 Ga0070707_100403769 3300005468 Unclassified 1327
92 Ga0070707_100423341 3300005468 Bacteria 1292
93 Ga0070698_100020868 3300005471 Bacteria 6865
94 Ga0070698_100302552 3300005471 Bacteria 1530
95 Ga0070698_100827931 3300005471 Bacteria 870
96 Ga0070699_100407491 3300005518 Bacteria 1230
97 Ga0070684_100003182 3300005535 Bacteria 12277
98 Ga0070684_100005720 3300005535 Bacteria 9550
99 Ga0070684_100034801 3300005535 Bacteria 4308
100 Ga0070697_100007971 3300005536 Bacteria 8257
101 Ga0070697_100008639 3300005536 Bacteria 7956
102 Ga0070697_100102971 3300005536 Bacteria 2372
103 Ga0070697_100281377 3300005536 Bacteria 1427
104 Ga0068853_100180335 3300005539 Bacteria 1915
105 Ga0070672_100101132 3300005543 Unclassified 2339
106 Ga0070672_100793346 3300005543 Bacteria 833
107 Ga0070696_100103161 3300005546 Bacteria 2046
108 Ga0070665_100010785 3300005548 Bacteria 9240
109 Ga0070665_100068090 3300005548 Bacteria 3569
110 Ga0070665_100074203 3300005548 Bacteria 3407
111 Ga0070665_100116840 3300005548 Unclassified 2670
112 Ga0070704_100010864 3300005549 Bacteria 5554
113 Ga0068855_100008559 3300005563 Bacteria 12369
114 Ga0070664_100095106 3300005564 Bacteria 2584
115 Ga0070702_100298286 3300005615 Bacteria 1114
116 Ga0068859_100062197 3300005617 Bacteria 3763
117 Ga0068859_100459752 3300005617 Bacteria 1369
118 Ga0068864_100056036 3300005618 Bacteria 3406
119 Ga0068861_100290415 3300005719 Bacteria 1412
120 Ga0068863_100330401 3300005841 Bacteria 1482
121 Ga0068858_100457241 3300005842 Bacteria 1231
122 Ga0068860_100000624 3300005843 Bacteria 41843
123 Ga0068860_100020625 3300005843 Bacteria 6384
124 Ga0068862_100340631 3300005844 Bacteria 1389
125 Ga0081455_10056273 3300005937 Bacteria 3341
126 Ga0081540_1000018 3300005983 Bacteria 164931
127 Ga0081540_1098919 3300005983 Bacteria 1262
128 Ga0081539_10017643 3300005985 Bacteria 4999
129 Ga0070717_10000840 3300006028 Bacteria 20326
130 Ga0070717_10046036 3300006028 Bacteria 3568
131 Ga0070717_10260420 3300006028 Bacteria 1534
132 Ga0070717_10311710 3300006028 Bacteria 1401
133 Ga0070717_10732715 3300006028 Bacteria 899
134 Ga0070715_10025758 3300006163 Bacteria 2333
135 Ga0070716_100044071 3300006173 Bacteria 2498
136 Ga0070716_100629778 3300006173 Bacteria 811
137 Ga0070712_100071178 3300006175 Bacteria 2487
138 Ga0070712_100132206 3300006175 Bacteria 1892
139 Ga0070712_100326078 3300006175 Bacteria 1250
140 Ga0070712_100582356 3300006175 Bacteria 945
141 Ga0068871_100312512 3300006358 Bacteria 1382
142 Ga0075428_100570877 3300006844 Bacteria 1209
143 Ga0075434_100726841 3300006871 Bacteria 1010
144 Ga0075436_100006174 3300006914 Bacteria 8219
145 Ga0097620_100062197 3300006931 Bacteria 3763
146 Ga0097620_100459757 3300006931 Bacteria 1369
147 Ga0075435_100034508 3300007076 Bacteria 4009
148 Ga0075435_101011447 3300007076 Bacteria 726
149 Ga0099795_10213647 3300007788 Bacteria 818
150 Ga0105245_10056653 3300009098 Bacteria 3523
151 Ga0105245_10121122 3300009098 Bacteria 2444
152 Ga0105247_10472236 3300009101 Bacteria 908
153 Ga0114129_10015499 3300009147 Bacteria 10839
154 Ga0114129_10126608 3300009147 Bacteria 3512
155 Ga0114129_10254449 3300009147 Bacteria 2356
156 Ga0105243_10001258 3300009148 Bacteria 22754
157 Ga0105241_10142227 3300009174 Bacteria 1955
158 Ga0105242_10529636 3300009176 Bacteria 1126
159 Ga0105237_10408781 3300009545 Bacteria 1362
160 Ga0105238_11244620 3300009551 Bacteria 769
161 Ga0105249_10020365 3300009553 Bacteria 5931
162 Ga0105249_10060817 3300009553 Bacteria 3465
163 Ga0099796_10008046 3300010159 Bacteria 2791
164 Ga0105239_10089773 3300010375 Bacteria 3389
165 Ga0105239_10210762 3300010375 Bacteria 2178
166 Ga0105239_10228339 3300010375 Bacteria 2088
167 Ga0105246_10558999 3300011119 Bacteria 982
168 Ga0157337_1002375 3300012483 Bacteria 1060
169 Ga0157370_10056540 3300013104 Bacteria 3734
170 Ga0157374_10019527 3300013296 Bacteria 5999
171 Ga0157374_10052381 3300013296 Bacteria 3801
172 Ga0157374_10066890 3300013296 Bacteria 3377
173 Ga0157374_10383173 3300013296 Unclassified 1401
174 Ga0157374_10399129 3300013296 Bacteria 1372
175 Ga0157374_10948215 3300013296 Bacteria 879
176 Ga0157374_11770381 3300013296 Bacteria 643
177 Ga0157378_10503340 3300013297 Bacteria 1210
178 Ga0163162_10123699 3300013306 Bacteria 2692
179 Ga0163162_10173689 3300013306 Unclassified 2279
180 Ga0163162_10408467 3300013306 Bacteria 1490
181 Ga0157372_10220084 3300013307 Bacteria 2201
182 Ga0157372_10542816 3300013307 Bacteria 1355
183 Ga0157375_10114557 3300013308 Bacteria 2798
184 Ga0157375_10138376 3300013308 Bacteria 2560
185 Ga0157375_10338079 3300013308 Bacteria 1671
186 Ga0157375_11253691 3300013308 Bacteria 871
187 Ga0163163_10167202 3300014325 Bacteria 2246
188 Ga0163163_10339620 3300014325 Bacteria 1557
189 Ga0157380_12083668 3300014326 Bacteria 630
190 Ga0157379_10436628 3300014968 Bacteria 1207
191 Ga0157376_10031021 3300014969 Bacteria 4275
192 Ga0157376_10087814 3300014969 Bacteria 2684
193 Ga0207666_1025512 3300025271 Bacteria 887
194 Ga0207673_1000316 3300025290 Bacteria 4866
195 Ga0207673_1004722 3300025290 Bacteria 1639
196 Ga0207697_10006019 3300025315 Bacteria 5550
197 Ga0207697_10006598 3300025315 Bacteria 5238
198 Ga0207697_10007181 3300025315 Bacteria 4978
199 Ga0207697_10011859 3300025315 Bacteria 3674
200 Ga0207697_10023308 3300025315 Bacteria 2534
201 Ga0207697_10072613 3300025315 Bacteria 1443
202 Ga0207697_10103914 3300025315 Bacteria 1213
203 Ga0207692_10563512 3300025898 Bacteria 729
204 Ga0207680_10012532 3300025903 Bacteria 4321
205 Ga0207680_10577492 3300025903 Bacteria 803
206 Ga0207647_10008810 3300025904 Bacteria 7204
207 Ga0207647_10149888 3300025904 Bacteria 1364
208 Ga0207645_10005153 3300025907 Bacteria 9554
209 Ga0207645_10102423 3300025907 Unclassified 1848
210 Ga0207684_10007107 3300025910 Bacteria 10118
211 Ga0207684_10054670 3300025910 Bacteria 3387
212 Ga0207684_10125169 3300025910 Bacteria 2205
213 Ga0207684_10408496 3300025910 Bacteria 1167
214 Ga0207684_10465176 3300025910 Bacteria 1085
215 Ga0207654_10123305 3300025911 Bacteria 1630
216 Ga0207693_10004539 3300025915 Bacteria 11722
217 Ga0207693_10054624 3300025915 Bacteria 3133
218 Ga0207693_10079550 3300025915 Bacteria 2566
219 Ga0207693_10198977 3300025915 Bacteria 1576
220 Ga0207693_10339242 3300025915 Bacteria 1176
221 Ga0207693_10612123 3300025915 Bacteria 847
222 Ga0207663_10005235 3300025916 Bacteria 6529
223 Ga0207663_10063943 3300025916 Bacteria 2346
224 Ga0207662_10002578 3300025918 Bacteria 9133
225 Ga0207662_10057306 3300025918 Bacteria 2328
226 Ga0207649_10015800 3300025920 Bacteria 4244
227 Ga0207652_10050965 3300025921 Bacteria 3547
228 Ga0207646_10022065 3300025922 Bacteria 5872
229 Ga0207646_10044905 3300025922 Bacteria 3966
230 Ga0207646_10100820 3300025922 Bacteria 2588
231 Ga0207646_10266532 3300025922 Bacteria 1548
232 Ga0207646_11351090 3300025922 Bacteria 621
233 Ga0207681_10007831 3300025923 Bacteria 6542
234 Ga0207659_10021764 3300025926 Bacteria 4262
235 Ga0207659_10069811 3300025926 Bacteria 2560
236 Ga0207659_10170898 3300025926 Bacteria 1715
237 Ga0207687_10136531 3300025927 Bacteria 1855
238 Ga0207700_10095252 3300025928 Bacteria 2361
239 Ga0207700_10653440 3300025928 Bacteria 937
240 Ga0207664_10235084 3300025929 Bacteria 1594
241 Ga0207664_10480561 3300025929 Bacteria 1111
242 Ga0207644_10472201 3300025931 Bacteria 1032
243 Ga0207690_10013889 3300025932 Bacteria 4851
244 Ga0207690_10143127 3300025932 Bacteria 1764
245 Ga0207690_10545237 3300025932 Unclassified 942
246 Ga0207706_10016852 3300025933 Bacteria 6594
247 Ga0207706_10042957 3300025933 Unclassified 4006
248 Ga0207706_10488652 3300025933 Bacteria 1063
249 Ga0207709_10001701 3300025935 Bacteria 14815
250 Ga0207670_10090988 3300025936 Unclassified 2157
251 Ga0207704_10397368 3300025938 Bacteria 1087
252 Ga0207665_10070198 3300025939 Bacteria 2390
253 Ga0207665_10274255 3300025939 Bacteria 1253
254 Ga0207691_10257164 3300025940 Unclassified 1506
255 Ga0207661_10242272 3300025944 Bacteria 1600
256 Ga0207661_10404955 3300025944 Bacteria 1238
257 Ga0207679_10059618 3300025945 Bacteria 2832
258 Ga0207679_11087742 3300025945 Bacteria 733
259 Ga0207667_10002089 3300025949 Bacteria 25037
260 Ga0207651_10033197 3300025960 Bacteria 3326
261 Ga0207651_10442153 3300025960 Bacteria 1114
262 Ga0207712_10013103 3300025961 Bacteria 5312
263 Ga0207668_10152485 3300025972 Bacteria 1791
264 Ga0207658_10013340 3300025986 Bacteria 5611
265 Ga0207658_10336478 3300025986 Bacteria 1311
266 Ga0207677_10035029 3300026023 Bacteria 3256
267 Ga0207677_10641710 3300026023 Bacteria 936
268 Ga0207677_11010044 3300026023 Bacteria 755
269 Ga0207708_10054386 3300026075 Bacteria 3052
270 Ga0207702_10027800 3300026078 Bacteria 4699
271 Ga0207676_10099424 3300026095 Bacteria 2408
272 Ga0207674_10920351 3300026116 Bacteria 843
273 Ga0207675_100072278 3300026118 Bacteria 3226
274 Ga0207675_100076347 3300026118 Bacteria 3137
275 Ga0207683_10248251 3300026121 Bacteria 1624
276 Ga0209974_10041029 3300027876 Bacteria 1541
277 Ga0268266_10163606 3300028379 Bacteria 2014
278 Ga0268266_10213578 3300028379 Bacteria 1770
279 Ga0268266_10300214 3300028379 Bacteria 1498
280 Ga0268264_10000632 3300028381 Bacteria 41845
281 Ga0268264_10132686 3300028381 Bacteria 2210
282 Ga0265327_10011756 3300031251 Bacteria 5992
283 Ga0307416_101875995 3300032002 Bacteria 703
284 Ga0307414_10066904 3300032004 Bacteria 2571
285 Ga0373926_0193998 3300035083 Bacteria 781
286 Ga0373934_0076809 3300035086 Bacteria 1340
287 Ga0373952_0009855 3300035092 Bacteria 1837
288 Ga0373923_0215903 3300035111 Bacteria 890
289 Ga0373923_0238846 3300035111 Bacteria 848
290 Ga0373936_0323825 3300035113 Bacteria 699
291 Ga0373941_0027994 3300035115 Bacteria 1651
292 Ga0373957_0067672 3300035120 Bacteria 1392
293 Ga0373943_0102722 3300035170 Bacteria 1497
294 Ga0373943_0303365 3300035170 Bacteria 907
295 Ga0373943_0444562 3300035170 Bacteria 753
296 Ga0373946_0062891 3300035171 Bacteria 1584
297 Ga0373955_0082379 3300035172 Bacteria 1820
298 Ga0373924_0025243 3300035410 Bacteria 2349
299 Ga0373931_0235007 3300035691 Bacteria 1109
300 Ga0373931_0500636 3300035691 Bacteria 784
301 Ga0373935_0006372 3300035692 Bacteria 7040
302 Ga0373927_0247332 3300035695 Bacteria 1172
303 Ga0373933_0040655 3300035724 Bacteria 2741
304 Ga0373947_0021304 3300035725 Bacteria 3751
305 Ga0373947_0123585 3300035725 Bacteria 1646
306 Ga0373947_0293650 3300035725 Bacteria 1083
307 Ga0373937_0017249 3300036401 Bacteria 6428
308 Ga0373925_0044585 3300037068 Bacteria 3293
309 Ga0395899_0124647 3300037312 Bacteria 1843
310 Ga0395900_0246936 3300037418 Bacteria 1788
311 Ga0395900_0446188 3300037418 Bacteria 1251
312 Ga0395898_0012348 3300037466 Bacteria 8834
313 Ga0395905_0263208 3300037471 Bacteria 1610
314 Ga0395905_0310416 3300037471 Bacteria 1466
315 Ga0395905_0467339 3300037471 Bacteria 1160
316 Ga0395901_0002844 3300038443 Bacteria 17473
317 Ga0395901_0069351 3300038443 Bacteria 3672
318 Ga0395901_0273320 3300038443 Bacteria 1757
319 Ga0395901_1177939 3300038443 Bacteria 733
320 Ga0451807_0226675 3300041486 Bacteria 877
321 Ga0451845_0990289 3300041501 Bacteria 687
322 Ga0439448_0228532 3300042005 Bacteria 655
323 Ga0439458_0079616 3300042157 Bacteria 835
324 Ga0451577_0011636 3300042876 Bacteria 8307
325 Ga0451577_0028210 3300042876 Bacteria 5078
326 Ga0451576_0017865 3300045051 Bacteria 7791
327 Ga0495592_0036022 3300046454 Bacteria 3727
328 Ga0495629_0148141 3300046459 Bacteria 1632
329 Ga0495651_0055496 3300046462 Bacteria 3044
330 Ga0495653_0174156 3300046463 Bacteria 1482
331 Ga0495664_0435033 3300046477 Bacteria 786
332 Ga0495584_0334002 3300046491 Bacteria 770
333 Ga0495608_0175803 3300046511 Bacteria 1356
334 Ga0495618_0035298 3300046514 Bacteria 3139
335 Ga0495628_0010446 3300046516 Bacteria 7885
336 Ga0495630_0048700 3300046517 Unclassified 3171
337 Ga0495652_0051251 3300046529 Bacteria 3525
338 Ga0495640_0377600 3300046533 Bacteria 872
339 Ga0495587_0008462 3300046536 Bacteria 6613
340 Ga0495609_0306099 3300046538 Bacteria 647
341 Ga0495645_0003457 3300046543 Bacteria 10717
342 Ga0495634_0023752 3300046642 Bacteria 4308
343 Ga0495635_0064712 3300046663 Bacteria 2510
344 Ga0495599_0031719 3300046678 Bacteria 3316
345 Ga0495623_0014728 3300046679 Bacteria 5056
346 Ga0495646_0013553 3300046680 Bacteria 5183
347 Ga0495658_0224144 3300046683 Bacteria 1178
348 Ga0495669_0135533 3300046684 Bacteria 1161
349 Ga0495613_0355157 3300046689 Bacteria 1006
350 Ga0495581_0610134 3300047315 Bacteria 632
351 Ga0495604_0023589 3300047317 Bacteria 4908
352 Ga0495674_0260635 3300047319 Bacteria 1424
353 Ga0495680_0300479 3300047322 Bacteria 1127
354 Ga0495684_0005356 3300047471 Bacteria 9991
355 Ga0495602_0202266 3300048088 Bacteria 1514
356 Ga0496100_0653841 3300048903 Bacteria 819
357 Ga0496101_0399843 3300048904 Bacteria 1082
358 Ga0496101_0601307 3300048904 Bacteria 869
359 Ga0496102_0045507 3300048905 Bacteria 3985
360 Ga0496104_0186834 3300048907 Bacteria 1983
361 Ga0496104_0242102 3300048907 Bacteria 1716
362 Ga0496104_0452003 3300048907 Bacteria 1196
363 Ga0496104_0647443 3300048907 Bacteria 966
364 Ga0496104_1072461 3300048907 Bacteria 709
365 Ga0496105_0224806 3300048908 Bacteria 1527
366 Ga0496105_0391498 3300048908 Bacteria 1104
367 Ga0496106_0047658 3300048909 Bacteria 3226
368 Ga0496107_0061378 3300048910 Bacteria 2722
369 Ga0496107_0139817 3300048910 Bacteria 1790
370 Ga0496108_0104681 3300048911 Bacteria 2415
371 Ga0496108_0121708 3300048911 Bacteria 2239
372 Ga0496108_0304779 3300048911 Bacteria 1388
373 Ga0496108_0600198 3300048911 Bacteria 959
374 Ga0496109_0022802 3300048912 Bacteria 5548
375 Ga0496109_0113908 3300048912 Bacteria 2516
376 Ga0496109_0663962 3300048912 Bacteria 980
377 Ga0496110_0185882 3300048913 Bacteria 1887
378 Ga0496111_0160318 3300048914 Bacteria 1670
379 Ga0496112_0357776 3300048915 Bacteria 1402
380 Ga0496112_0470314 3300048915 Bacteria 1194
381 Ga0496113_0334016 3300048916 Bacteria 1215
382 Ga0496113_0705820 3300048916 Bacteria 805
383 Ga0496114_0098871 3300048917 Bacteria 2488
384 Ga0496114_1128376 3300048917 Bacteria 669
385 Ga0496115_0013372 3300048918 Bacteria 6209
386 Ga0496115_0058558 3300048918 Bacteria 3100
387 Ga0496115_0091198 3300048918 Bacteria 2490
388 Ga0501032_0000083 3300049569 Bacteria 82166
389 Ga0501034_0000001 3300049571 Bacteria 2184493
390 Ga0501036_0015224 3300049572 Bacteria 6422
391 Ga0501039_0000035 3300049575 Bacteria 126278
392 Ga0501047_0976720 3300049581 Bacteria 660
393 Ga0501080_0004141 3300049742 Bacteria 12858
394 Ga0501080_0110049 3300049742 Bacteria 2553
395 nmdc:mga05p37_40983_c1 3300050507 Bacteria 5686
396 nmdc:mga05p37_572235_c1 3300050507 Bacteria 1281
397 nmdc:mga05p37_874129_c1 3300050507 Bacteria 973
398 nmdc:mga0n895_405699_c1 3300050512 Bacteria 1378
399 nmdc:mga0n895_90046_c1 3300050512 Bacteria 3069
400 Ga0495601_0042392 3300053077 Bacteria 2855
401 Ga0500645_046444 3300053730 Bacteria 1274
402 2718716203 2718217752 Bacteria 915884
403 Ga0373937_0709259
404 MBSR1b_contig_3836444
405 MBSR1b_contig_5447818
406 JGI24743J22301_10025934
407 JGI24035J26624_1000898
408 JGI25406J46586_10091005
409 Ga0065704_10039053
410 Ga0065704_10106064
411 Ga0065704_10204227
412 Ga0065704_10295989
413 Ga0065712_10008985
414 Ga0065712_10012070
415 Ga0065712_10079007
416 Ga0065712_10087869
417 Ga0065712_10088979
418 Ga0065712_10202236
419 Ga0065712_10203333
420 Ga0065715_10012020
421 Ga0065715_10089294
422 Ga0065715_10169511
423 Ga0065715_10208071
424 Ga0065715_10738814
425 Ga0065707_10205988
426 Ga0065707_10662995
427 Ga0070658_10273522
428 Ga0070676_10005745
429 Ga0070683_100027635
430 Ga0070683_100076559
431 Ga0070683_100281815
432 Ga0070690_100364420
433 Ga0070690_100524621
434 Ga0070666_10007060
435 Ga0070666_10695312
436 Ga0070680_100030939
437 Ga0070682_100365191
438 Ga0068868_100033859
439 Ga0068868_100119597
440 Ga0068868_100275029
441 Ga0070660_100123588
442 Ga0070689_100062367
443 Ga0070689_100426813
444 Ga0070687_100003056
445 Ga0070661_100056777
446 Ga0070668_100088001
447 Ga0070669_100009350
448 Ga0070675_100027219
449 Ga0070675_100029855
450 Ga0070675_100072167
451 Ga0070675_100227655
452 Ga0070671_100176960
453 Ga0070671_100324256
454 Ga0070688_100009020
455 Ga0070688_100759470
456 Ga0070659_100057065
457 Ga0070659_100200642
458 Ga0070659_100719072
459 Ga0070667_100013126
460 Ga0070667_100397669
461 Ga0070709_10306267
462 Ga0070709_10369311
463 Ga0070714_100077012
464 Ga0070714_100084380
465 Ga0070713_100134236
466 Ga0070713_100173684
467 Ga0070713_100210503
468 Ga0070711_100007799
469 Ga0070711_100030528
470 Ga0070711_100090775
471 Ga0070711_100918961
472 Ga0070705_100050199
473 Ga0070705_100205828
474 Ga0070694_100060876
475 Ga0070694_100129353
476 Ga0070708_100025662
477 Ga0070708_100102471
478 Ga0070708_100138954
479 Ga0070708_100224588
480 Ga0070708_100473489
481 Ga0070663_100062955
482 Ga0070662_100011609
483 Ga0070706_100083548
484 Ga0070706_100119852
485 Ga0070706_100151719
486 Ga0070706_100504945
487 Ga0070706_100615140
488 Ga0070707_100006052
489 Ga0070707_100025781
490 Ga0070707_100040797
491 Ga0070707_100099186
492 Ga0070707_100245338
493 Ga0070707_100403769
494 Ga0070707_100423341
495 Ga0070698_100020868
496 Ga0070698_100302552
497 Ga0070698_100827931
498 Ga0070699_100407491
499 Ga0070684_100003182
500 Ga0070684_100005720
501 Ga0070684_100034801
502 Ga0070697_100007971
503 Ga0070697_100008639
504 Ga0070697_100102971
505 Ga0070697_100281377
506 Ga0068853_100180335
507 Ga0070672_100101132
508 Ga0070672_100793346
509 Ga0070696_100103161
510 Ga0070665_100010785
511 Ga0070665_100068090
512 Ga0070665_100074203
513 Ga0070665_100116840
514 Ga0070704_100010864
515 Ga0068855_100008559
516 Ga0070664_100095106
517 Ga0070702_100298286
518 Ga0068859_100062197
519 Ga0068859_100459752
520 Ga0068864_100056036
521 Ga0068861_100290415
522 Ga0068863_100330401
523 Ga0068858_100457241
524 Ga0068860_100000624
525 Ga0068860_100020625
526 Ga0068862_100340631
527 Ga0081455_10056273
528 Ga0081540_1000018
529 Ga0081540_1098919
530 Ga0081539_10017643
531 Ga0070717_10000840
532 Ga0070717_10046036
533 Ga0070717_10260420
534 Ga0070717_10311710
535 Ga0070717_10732715
536 Ga0070715_10025758
537 Ga0070716_100044071
538 Ga0070716_100629778
539 Ga0070712_100071178
540 Ga0070712_100132206
541 Ga0070712_100326078
542 Ga0070712_100582356
543 Ga0068871_100312512
544 Ga0075428_100570877
545 Ga0075434_100726841
546 Ga0075436_100006174
547 Ga0097620_100062197
548 Ga0097620_100459757
549 Ga0075435_100034508
550 Ga0075435_101011447
551 Ga0099795_10213647
552 Ga0105245_10056653
553 Ga0105245_10121122
554 Ga0105247_10472236
555 Ga0114129_10015499
556 Ga0114129_10126608
557 Ga0114129_10254449
558 Ga0105243_10001258
559 Ga0105241_10142227
560 Ga0105242_10529636
561 Ga0105237_10408781
562 Ga0105238_11244620
563 Ga0105249_10020365
564 Ga0105249_10060817
565 Ga0099796_10008046
566 Ga0105239_10089773
567 Ga0105239_10210762
568 Ga0105239_10228339
569 Ga0105246_10558999
570 Ga0157337_1002375
571 Ga0157370_10056540
572 Ga0157374_10019527
573 Ga0157374_10052381
574 Ga0157374_10066890
575 Ga0157374_10383173
576 Ga0157374_10399129
577 Ga0157374_10948215
578 Ga0157374_11770381
579 Ga0157378_10503340
580 Ga0163162_10123699
581 Ga0163162_10173689
582 Ga0163162_10408467
583 Ga0157372_10220084
584 Ga0157372_10542816
585 Ga0157375_10114557
586 Ga0157375_10138376
587 Ga0157375_10338079
588 Ga0157375_11253691
589 Ga0163163_10167202
590 Ga0163163_10339620
591 Ga0157380_12083668
592 Ga0157379_10436628
593 Ga0157376_10031021
594 Ga0157376_10087814
595 Ga0207666_1025512
596 Ga0207673_1000316
597 Ga0207673_1004722
598 Ga0207697_10006019
599 Ga0207697_10006598
600 Ga0207697_10007181
601 Ga0207697_10011859
602 Ga0207697_10023308
603 Ga0207697_10072613
604 Ga0207697_10103914
605 Ga0207692_10563512
606 Ga0207680_10012532
607 Ga0207680_10577492
608 Ga0207647_10008810
609 Ga0207647_10149888
610 Ga0207645_10005153
611 Ga0207645_10102423
612 Ga0207684_10007107
613 Ga0207684_10054670
614 Ga0207684_10125169
615 Ga0207684_10408496
616 Ga0207684_10465176
617 Ga0207654_10123305
618 Ga0207693_10004539
619 Ga0207693_10054624
620 Ga0207693_10079550
621 Ga0207693_10198977
622 Ga0207693_10339242
623 Ga0207693_10612123
624 Ga0207663_10005235
625 Ga0207663_10063943
626 Ga0207662_10002578
627 Ga0207662_10057306
628 Ga0207649_10015800
629 Ga0207652_10050965
630 Ga0207646_10022065
631 Ga0207646_10044905
632 Ga0207646_10100820
633 Ga0207646_10266532
634 Ga0207646_11351090
635 Ga0207681_10007831
636 Ga0207659_10021764
637 Ga0207659_10069811
638 Ga0207659_10170898
639 Ga0207687_10136531
640 Ga0207700_10095252
641 Ga0207700_10653440
642 Ga0207664_10235084
643 Ga0207664_10480561
644 Ga0207644_10472201
645 Ga0207690_10013889
646 Ga0207690_10143127
647 Ga0207690_10545237
648 Ga0207706_10016852
649 Ga0207706_10042957
650 Ga0207706_10488652
651 Ga0207709_10001701
652 Ga0207670_10090988
653 Ga0207704_10397368
654 Ga0207665_10070198
655 Ga0207665_10274255
656 Ga0207691_10257164
657 Ga0207661_10242272
658 Ga0207661_10404955
659 Ga0207679_10059618
660 Ga0207679_11087742
661 Ga0207667_10002089
662 Ga0207651_10033197
663 Ga0207651_10442153
664 Ga0207712_10013103
665 Ga0207668_10152485
666 Ga0207658_10013340
667 Ga0207658_10336478
668 Ga0207677_10035029
669 Ga0207677_10641710
670 Ga0207677_11010044
671 Ga0207708_10054386
672 Ga0207702_10027800
673 Ga0207676_10099424
674 Ga0207674_10920351
675 Ga0207675_100072278
676 Ga0207675_100076347
677 Ga0207683_10248251
678 Ga0209974_10041029
679 Ga0268266_10163606
680 Ga0268266_10213578
681 Ga0268266_10300214
682 Ga0268264_10000632
683 Ga0268264_10132686
684 Ga0265327_10011756
685 Ga0307416_101875995
686 Ga0307414_10066904
687 Ga0373926_0193998
688 Ga0373934_0076809
689 Ga0373952_0009855
690 Ga0373923_0215903
691 Ga0373923_0238846
692 Ga0373936_0323825
693 Ga0373941_0027994
694 Ga0373957_0067672
695 Ga0373943_0102722
696 Ga0373943_0303365
697 Ga0373943_0444562
698 Ga0373946_0062891
699 Ga0373955_0082379
700 Ga0373924_0025243
701 Ga0373931_0235007
702 Ga0373931_0500636
703 Ga0373935_0006372
704 Ga0373927_0247332
705 Ga0373933_0040655
706 Ga0373947_0021304
707 Ga0373947_0123585
708 Ga0373947_0293650
709 Ga0373937_0017249
710 Ga0373925_0044585
711 Ga0395899_0124647
712 Ga0395900_0246936
713 Ga0395900_0446188
714 Ga0395898_0012348
715 Ga0395905_0263208
716 Ga0395905_0310416
717 Ga0395905_0467339
718 Ga0395901_0002844
719 Ga0395901_0069351
720 Ga0395901_0273320
721 Ga0395901_1177939
722 Ga0451807_0226675
723 Ga0451845_0990289
724 Ga0439448_0228532
725 Ga0439458_0079616
726 Ga0451577_0011636
727 Ga0451577_0028210
728 Ga0451576_0017865
729 Ga0495592_0036022
730 Ga0495629_0148141
731 Ga0495651_0055496
732 Ga0495653_0174156
733 Ga0495664_0435033
734 Ga0495584_0334002
735 Ga0495608_0175803
736 Ga0495618_0035298
737 Ga0495628_0010446
738 Ga0495630_0048700
739 Ga0495652_0051251
740 Ga0495640_0377600
741 Ga0495587_0008462
742 Ga0495609_0306099
743 Ga0495645_0003457
744 Ga0495634_0023752
745 Ga0495635_0064712
746 Ga0495599_0031719
747 Ga0495623_0014728
748 Ga0495646_0013553
749 Ga0495658_0224144
750 Ga0495669_0135533
751 Ga0495613_0355157
752 Ga0495581_0610134
753 Ga0495604_0023589
754 Ga0495674_0260635
755 Ga0495680_0300479
756 Ga0495684_0005356
757 Ga0495602_0202266
758 Ga0496100_0653841
759 Ga0496101_0399843
760 Ga0496101_0601307
761 Ga0496102_0045507
762 Ga0496104_0186834
763 Ga0496104_0242102
764 Ga0496104_0452003
765 Ga0496104_0647443
766 Ga0496104_1072461
767 Ga0496105_0224806
768 Ga0496105_0391498
769 Ga0496106_0047658
770 Ga0496107_0061378
771 Ga0496107_0139817
772 Ga0496108_0104681
773 Ga0496108_0121708
774 Ga0496108_0304779
775 Ga0496108_0600198
776 Ga0496109_0022802
777 Ga0496109_0113908
778 Ga0496109_0663962
779 Ga0496110_0185882
780 Ga0496111_0160318
781 Ga0496112_0357776
782 Ga0496112_0470314
783 Ga0496113_0334016
784 Ga0496113_0705820
785 Ga0496114_0098871
786 Ga0496114_1128376
787 Ga0496115_0013372
788 Ga0496115_0058558
789 Ga0496115_0091198
790 Ga0501032_0000083
791 Ga0501034_0000001
792 Ga0501036_0015224
793 Ga0501039_0000035
794 Ga0501047_0976720
795 Ga0501080_0004141
796 Ga0501080_0110049
797 nmdc:mga05p37_40983_c1
798 nmdc:mga05p37_572235_c1
799 nmdc:mga05p37_874129_c1
800 nmdc:mga0n895_405699_c1
801 nmdc:mga0n895_90046_c1
802 Ga0495601_0042392
803 Ga0500645_046444
804 2718716203

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

15

200

0.96

PF07722

Peptidase_C26

Peptidase C26

76

182

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qur-assembly1.cif.gz_A mapping the allosteric communication network of aminodeoxychorismate synthase 0.9296 1 185
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.9257 2 187
8hx6-assembly1.cif.gz_A crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae 0.9197 2 184
8hx6-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae 0.9175 2 184
8hx7-assembly1.cif.gz_A crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine 0.9167 2 187
ID Description Score Start End Superfamily
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9591 1 185 3.40.50.880
af_Q2G099_1_189_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.947 1 186 3.40.50.880
af_K7L2D7_74_267_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9458 2 187 3.40.50.880
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9441 1 185 3.40.50.880
af_Q57690_3_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9281 2 185 3.40.50.880
ID Description Score Start End GO Terms
AF-X1QNU6-F1-model_v4 Glutamine amidotransferase domain-containing protein 0.9742 27 169 GO:0000162
GO:0004049
GO:0005829
AF-A0A800BQT8-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9738 1 168 GO:0000162
GO:0004049
GO:0005829
AF-A0A2V8R0S8-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9718 23 153 GO:0000162
GO:0004049
GO:0005829
AF-A0A2N2T822-F1-model_v4 Anthranilate/aminodeoxychorismate synthase component II (EC 4.1.3.27) 0.9717 1 169 GO:0000162
GO:0004049
GO:0005829
AF-X0UEQ4-F1-model_v4 Glutamine amidotransferase domain-containing protein 0.9715 1 167 GO:0000162
GO:0004049
GO:0005829

Map