F435076

General Info

Members Datasets Scaffolds Average Seq Length
402 242 804 345

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10392477|Ga0105243_103924771
Length 382
Sequence LSLGLIGTEIRPVYNALMTPRFAAAVCALLLGLATTHGQPQTGRQFQLVADGKGYKLEMKTVARPTPGPKQVLVRVRAVSLNQRDMAVTRGQYGGTGGGAMVGKVPLSDGAGEVVAVGSGATRFRVGDRVAGIFFARWIDGHRTADTLASARGGAGMDGMLSEFVAGDENGFVKIPDYLSFEEGATLPCTGVTAYRALFVEGRLKKGEFVLLEGTGGVSTFGLQFAAAAGARPIITSSSDDKIAKVKTMGAFGTVNYRTNPDWQKEVRKLTGDAGVDHVLEVGGRDTLPRALEALAYDGHIALIGGLSGFASDLPAGRLLGMGARVTGIYVGSRADFEAMNRFMIEHKIRPLIDKVFPFEESPQAFDLMDNGSYLGKIVIKL

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
67 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
68 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
141 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
161 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
162 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
163 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
164 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
165 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
168 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
169 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
170 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
171 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
186 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
197 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
198 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
199 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
208 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
217 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
228 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
229 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
230 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
231 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
232 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
233 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
234 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
235 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
236 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
237 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
238 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
239 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
240 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
241 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified
242 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.01
Metatranscriptomes 0
Isolates 1.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.49
Nodule 0.5
Rhizoplane 1.99
Rhizosphere 90.55
Stem 0
Stem Tuber 0
Unclassified 10.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10392477 3300009148 Bacteria 1287
2 rootH1_10178630 3300003323 Bacteria 3290
3 Ga0065704_10074622 3300005289 Bacteria 6131
4 Ga0065707_10084107 3300005295 Bacteria 7681
5 Ga0070658_10002449 3300005327 Bacteria 15524
6 Ga0070676_10004357 3300005328 Bacteria 7436
7 Ga0070683_100165294 3300005329 Bacteria 2099
8 Ga0070683_100323699 3300005329 Bacteria 1467
9 Ga0070670_100007118 3300005331 Bacteria 9472
10 Ga0070670_100009785 3300005331 Bacteria 8188
11 Ga0068869_100020879 3300005334 Bacteria 4498
12 Ga0070666_10011800 3300005335 Bacteria 5493
13 Ga0070666_10027774 3300005335 Bacteria 3708
14 Ga0070680_100034364 3300005336 Bacteria 4088
15 Ga0070682_100014275 3300005337 Bacteria 4588
16 Ga0070682_100125408 3300005337 Bacteria 1729
17 Ga0068868_100024275 3300005338 Bacteria 4599
18 Ga0068868_100028688 3300005338 Bacteria 4257
19 Ga0070691_10041411 3300005341 Bacteria 2178
20 Ga0070687_100064186 3300005343 Unclassified 1950
21 Ga0070687_100076613 3300005343 Bacteria 1812
22 Ga0070661_100009397 3300005344 Bacteria 6766
23 Ga0070668_100006199 3300005347 Bacteria 8856
24 Ga0070669_100145334 3300005353 Unclassified 1832
25 Ga0070669_100176330 3300005353 Bacteria 1669
26 Ga0070675_100003673 3300005354 Bacteria 11664
27 Ga0070675_100030115 3300005354 Bacteria 4379
28 Ga0070671_100001163 3300005355 Bacteria 19618
29 Ga0070671_100143452 3300005355 Bacteria 2016
30 Ga0070673_100003826 3300005364 Bacteria 9441
31 Ga0070673_100028400 3300005364 Bacteria 4160
32 Ga0070688_100046830 3300005365 Unclassified 2679
33 Ga0070667_100015957 3300005367 Bacteria 6215
34 Ga0070667_100017935 3300005367 Bacteria 5867
35 Ga0070714_100271350 3300005435 Unclassified 1573
36 Ga0070713_100052044 3300005436 Unclassified 3389
37 Ga0070713_100082912 3300005436 Bacteria 2740
38 Ga0070701_10026504 3300005438 Bacteria 2827
39 Ga0070700_100060139 3300005441 Bacteria 2394
40 Ga0070663_100000420 3300005455 Bacteria 22378
41 Ga0070678_100093216 3300005456 Bacteria 2316
42 Ga0070681_10016203 3300005458 Bacteria 7432
43 Ga0070681_10283569 3300005458 Unclassified 1567
44 Ga0068867_100029873 3300005459 Bacteria 3929
45 Ga0068867_100147622 3300005459 Bacteria 1844
46 Ga0070685_10013788 3300005466 Bacteria 4272
47 Ga0070706_100118216 3300005467 Bacteria 2469
48 Ga0070699_100114901 3300005518 Bacteria 2365
49 Ga0070679_100003262 3300005530 Bacteria 14834
50 Ga0070679_100056130 3300005530 Bacteria 3924
51 Ga0070684_100025007 3300005535 Bacteria 5014
52 Ga0070684_100027996 3300005535 Bacteria 4764
53 Ga0068853_100292222 3300005539 Bacteria 1504
54 Ga0070672_100006726 3300005543 Bacteria 7753
55 Ga0070686_100053460 3300005544 Bacteria 2579
56 Ga0070686_100155790 3300005544 Unclassified 1604
57 Ga0070695_100080439 3300005545 Unclassified 2154
58 Ga0070665_100000011 3300005548 Bacteria 525539
59 Ga0070665_100011449 3300005548 Bacteria 8968
60 Ga0068855_100062305 3300005563 Bacteria 4354
61 Ga0068855_100101599 3300005563 Bacteria 3310
62 Ga0068855_100238462 3300005563 Bacteria 2033
63 Ga0070664_100005933 3300005564 Bacteria 9866
64 Ga0070664_100009134 3300005564 Bacteria 8047
65 Ga0068857_100011738 3300005577 Bacteria 7617
66 Ga0068856_100115516 3300005614 Unclassified 2684
67 Ga0068856_100167904 3300005614 Bacteria 2205
68 Ga0068852_100070194 3300005616 Unclassified 3073
69 Ga0068859_100028312 3300005617 Bacteria 5617
70 Ga0068859_100064104 3300005617 Bacteria 3707
71 Ga0068859_100136487 3300005617 Bacteria 2526
72 Ga0068864_100009570 3300005618 Bacteria 7991
73 Ga0068864_100028054 3300005618 Bacteria 4757
74 Ga0068861_100020458 3300005719 Bacteria 4741
75 Ga0068851_10025491 3300005834 Bacteria 2901
76 Ga0068863_100000534 3300005841 Bacteria 38896
77 Ga0068863_100016027 3300005841 Bacteria 7188
78 Ga0068863_100024156 3300005841 Bacteria 5799
79 Ga0068863_100087985 3300005841 Bacteria 2944
80 Ga0068863_100252727 3300005841 Bacteria 1703
81 Ga0068858_100004105 3300005842 Bacteria 14344
82 Ga0068858_100012417 3300005842 Bacteria 8031
83 Ga0068858_100133088 3300005842 Bacteria 2332
84 Ga0068860_100011410 3300005843 Bacteria 8755
85 Ga0068860_100017992 3300005843 Bacteria 6883
86 Ga0068860_100035517 3300005843 Bacteria 4780
87 Ga0068860_100092238 3300005843 Bacteria 2886
88 Ga0068860_100227261 3300005843 Bacteria 1813
89 Ga0068862_100092857 3300005844 Bacteria 2631
90 Ga0070717_10011440 3300006028 Bacteria 6740
91 Ga0097621_100016251 3300006237 Bacteria 5620
92 Ga0097621_100023244 3300006237 Bacteria 4822
93 Ga0068871_100007824 3300006358 Bacteria 7657
94 Ga0068871_100137901 3300006358 Unclassified 2073
95 Ga0068871_100163797 3300006358 Bacteria 1903
96 Ga0075428_100073369 3300006844 Unclassified 3737
97 Ga0075428_100195025 3300006844 Bacteria 2190
98 Ga0075430_100083304 3300006846 Bacteria 2679
99 Ga0075431_100001583 3300006847 Bacteria 21166
100 Ga0075433_10134226 3300006852 Bacteria 2200
101 Ga0075433_10170934 3300006852 Bacteria 1934
102 Ga0075434_100059280 3300006871 Bacteria 3805
103 Ga0075429_100083241 3300006880 Bacteria 2789
104 Ga0075429_100224735 3300006880 Unclassified 1644
105 Ga0075429_100306632 3300006880 Unclassified 1390
106 Ga0068865_100328484 3300006881 Bacteria 1232
107 Ga0097620_100028312 3300006931 Bacteria 5617
108 Ga0097620_100064103 3300006931 Bacteria 3707
109 Ga0097620_100136486 3300006931 Bacteria 2526
110 Ga0079104_1000014 3300006946 Bacteria 337362
111 Ga0099795_10049613 3300007788 Bacteria 1524
112 Ga0105244_10000055 3300009036 Bacteria 130164
113 Ga0105240_10003389 3300009093 Bacteria 24780
114 Ga0105240_10018292 3300009093 Bacteria 9419
115 Ga0105240_10040549 3300009093 Bacteria 5953
116 Ga0105240_10044875 3300009093 Bacteria 5612
117 Ga0105240_10140105 3300009093 Unclassified 2892
118 Ga0105240_10198532 3300009093 Bacteria 2353
119 Ga0105240_10269282 3300009093 Bacteria 1962
120 Ga0111539_10000509 3300009094 Bacteria 49359
121 Ga0111539_10011819 3300009094 Bacteria 10944
122 Ga0111539_10087531 3300009094 Bacteria 3659
123 Ga0111539_10373537 3300009094 Bacteria 1660
124 Ga0105245_10010745 3300009098 Bacteria 7965
125 Ga0105245_10018954 3300009098 Bacteria 6023
126 Ga0105245_10033146 3300009098 Bacteria 4576
127 Ga0105245_10040767 3300009098 Bacteria 4138
128 Ga0105247_10012697 3300009101 Bacteria 5054
129 Ga0114129_10670634 3300009147 Unclassified 1336
130 Ga0105241_10020485 3300009174 Bacteria 4885
131 Ga0105242_10024635 3300009176 Bacteria 4754
132 Ga0105248_10011812 3300009177 Bacteria 9634
133 Ga0105248_10023511 3300009177 Bacteria 6845
134 Ga0105248_10578338 3300009177 Bacteria 1267
135 Ga0105237_10027328 3300009545 Bacteria 5826
136 Ga0105238_10025114 3300009551 Bacteria 6072
137 Ga0105238_10031325 3300009551 Bacteria 5413
138 Ga0105238_10060678 3300009551 Unclassified 3786
139 Ga0105238_10078149 3300009551 Bacteria 3300
140 Ga0105238_10165677 3300009551 Bacteria 2186
141 Ga0105238_10257244 3300009551 Bacteria 1725
142 Ga0105239_10019163 3300010375 Bacteria 7560
143 Ga0105239_10073142 3300010375 Bacteria 3768
144 Ga0105239_10374517 3300010375 Bacteria 1609
145 Ga0105239_10399075 3300010375 Bacteria 1556
146 Ga0105246_10003339 3300011119 Bacteria 9708
147 Ga0157370_10013344 3300013104 Bacteria 8463
148 Ga0157369_10034038 3300013105 Bacteria 5595
149 Ga0157369_10045232 3300013105 Bacteria 4789
150 Ga0157369_10064276 3300013105 Bacteria 3952
151 Ga0157374_10016788 3300013296 Bacteria 6441
152 Ga0163162_10016185 3300013306 Bacteria 7293
153 Ga0163162_10119234 3300013306 Bacteria 2741
154 Ga0157372_10028281 3300013307 Bacteria 6119
155 Ga0157372_10218635 3300013307 Bacteria 2208
156 Ga0157372_10288627 3300013307 Unclassified 1908
157 Ga0157375_10010310 3300013308 Bacteria 8225
158 Ga0163163_10006452 3300014325 Bacteria 10260
159 Ga0163163_10014187 3300014325 Bacteria 7318
160 Ga0163163_10019887 3300014325 Bacteria 6314
161 Ga0163163_10239767 3300014325 Bacteria 1863
162 Ga0157380_10002109 3300014326 Bacteria 13335
163 Ga0157380_10152912 3300014326 Bacteria 1997
164 Ga0157379_10010874 3300014968 Bacteria 7932
165 Ga0157379_10031297 3300014968 Bacteria 4739
166 Ga0209025_1006935 3300025294 Bacteria 8620
167 Ga0209050_1025558 3300025298 Bacteria 2002
168 Ga0207697_10045680 3300025315 Bacteria 1803
169 Ga0207656_10016079 3300025321 Bacteria 2907
170 Ga0207655_1000004 3300025728 Bacteria 1021221
171 Ga0207682_10033296 3300025893 Bacteria 2074
172 Ga0207680_10015649 3300025903 Bacteria 3965
173 Ga0207643_10073591 3300025908 Bacteria 1970
174 Ga0207705_10000890 3300025909 Bacteria 24460
175 Ga0207684_10113865 3300025910 Bacteria 2316
176 Ga0207707_10058583 3300025912 Bacteria 3352
177 Ga0207695_10039731 3300025913 Bacteria 5054
178 Ga0207695_10055995 3300025913 Bacteria 4106
179 Ga0207695_10094912 3300025913 Bacteria 2989
180 Ga0207671_10016410 3300025914 Bacteria 5757
181 Ga0207671_10038320 3300025914 Bacteria 3552
182 Ga0207662_10083283 3300025918 Unclassified 1955
183 Ga0207662_10149119 3300025918 Bacteria 1486
184 Ga0207662_10168126 3300025918 Bacteria 1405
185 Ga0207649_10018164 3300025920 Bacteria 3994
186 Ga0207652_10070036 3300025921 Bacteria 3046
187 Ga0207652_10076496 3300025921 Unclassified 2919
188 Ga0207652_10083918 3300025921 Bacteria 2790
189 Ga0207694_10015983 3300025924 Bacteria 5664
190 Ga0207694_10018700 3300025924 Bacteria 5237
191 Ga0207694_10026609 3300025924 Bacteria 4402
192 Ga0207694_10154515 3300025924 Bacteria 1850
193 Ga0207694_10197209 3300025924 Bacteria 1637
194 Ga0207650_10005888 3300025925 Bacteria 8368
195 Ga0207650_10016546 3300025925 Bacteria 5158
196 Ga0207659_10007137 3300025926 Bacteria 6858
197 Ga0207659_10010426 3300025926 Bacteria 5841
198 Ga0207687_10006980 3300025927 Bacteria 7440
199 Ga0207687_10017055 3300025927 Bacteria 4774
200 Ga0207687_10167585 3300025927 Bacteria 1691
201 Ga0207700_10013828 3300025928 Bacteria 5268
202 Ga0207700_10262126 3300025928 Bacteria 1480
203 Ga0207644_10119094 3300025931 Bacteria 2007
204 Ga0207686_10017266 3300025934 Bacteria 4064
205 Ga0207686_10120443 3300025934 Bacteria 1785
206 Ga0207686_10150362 3300025934 Bacteria 1620
207 Ga0207686_10164085 3300025934 Bacteria 1560
208 Ga0207670_10111157 3300025936 Bacteria 1975
209 Ga0207704_10101111 3300025938 Bacteria 1922
210 Ga0207704_10107606 3300025938 Bacteria 1876
211 Ga0207691_10010581 3300025940 Bacteria 8849
212 Ga0207691_10015959 3300025940 Bacteria 7135
213 Ga0207691_10178136 3300025940 Bacteria 1858
214 Ga0207711_10014014 3300025941 Bacteria 6660
215 Ga0207711_10450733 3300025941 Bacteria 1198
216 Ga0207689_10088654 3300025942 Bacteria 2541
217 Ga0207679_10028937 3300025945 Bacteria 3852
218 Ga0207679_10041387 3300025945 Bacteria 3304
219 Ga0207667_10022329 3300025949 Bacteria 6992
220 Ga0207667_10046106 3300025949 Bacteria 4615
221 Ga0207667_10202184 3300025949 Bacteria 2038
222 Ga0207667_10247172 3300025949 Bacteria 1825
223 Ga0207667_10313124 3300025949 Bacteria 1603
224 Ga0207651_10063710 3300025960 Bacteria 2576
225 Ga0207651_10069635 3300025960 Bacteria 2485
226 Ga0207668_10051590 3300025972 Bacteria 2841
227 Ga0207668_10379410 3300025972 Bacteria 1190
228 Ga0207658_10021249 3300025986 Bacteria 4503
229 Ga0207703_10037117 3300026035 Bacteria 3881
230 Ga0207703_10038475 3300026035 Bacteria 3817
231 Ga0207639_10037317 3300026041 Bacteria 3609
232 Ga0207678_10000514 3300026067 Bacteria 35082
233 Ga0207678_10021134 3300026067 Bacteria 5704
234 Ga0207678_10163485 3300026067 Bacteria 1901
235 Ga0207708_10004413 3300026075 Bacteria 10368
236 Ga0207708_10236397 3300026075 Unclassified 1468
237 Ga0207641_10000047 3300026088 Bacteria 179977
238 Ga0207641_10034421 3300026088 Bacteria 4214
239 Ga0207641_10068714 3300026088 Unclassified 3038
240 Ga0207641_10142261 3300026088 Bacteria 2166
241 Ga0207641_10194427 3300026088 Bacteria 1866
242 Ga0207648_10000163 3300026089 Bacteria 68352
243 Ga0207648_10007528 3300026089 Bacteria 10690
244 Ga0207648_10020631 3300026089 Bacteria 5932
245 Ga0207648_10160874 3300026089 Bacteria 1983
246 Ga0207676_10003712 3300026095 Bacteria 10798
247 Ga0207676_10007400 3300026095 Bacteria 7786
248 Ga0207676_10108145 3300026095 Bacteria 2321
249 Ga0207674_10013533 3300026116 Bacteria 9045
250 Ga0207674_10118700 3300026116 Bacteria 2615
251 Ga0207675_100243305 3300026118 Bacteria 1739
252 Ga0207683_10135940 3300026121 Unclassified 2213
253 Ga0209281_1000032 3300027111 Bacteria 401727
254 Ga0207428_10000236 3300027907 Bacteria 75764
255 Ga0207428_10013853 3300027907 Bacteria 7025
256 Ga0268266_10000063 3300028379 Bacteria 253339
257 Ga0268266_10002110 3300028379 Bacteria 21956
258 Ga0268265_10145558 3300028380 Bacteria 1990
259 Ga0268264_10104480 3300028381 Bacteria 2469
260 Ga0268264_10185733 3300028381 Bacteria 1891
261 Ga0268264_10259479 3300028381 Bacteria 1618
262 Ga0265334_10051338 3300028573 Bacteria 1581
263 Ga0265338_10003114 3300028800 Bacteria 23744
264 Ga0265338_10013194 3300028800 Bacteria 9351
265 Ga0265338_10193483 3300028800 Bacteria 1539
266 Ga0265320_10026255 3300031240 Bacteria 3051
267 Ga0307509_10000177 3300031507 Bacteria 100248
268 Ga0307509_10019902 3300031507 Bacteria 7634
269 Ga0307408_100003770 3300031548 Bacteria 10322
270 Ga0265314_10000723 3300031711 Bacteria 39953
271 Ga0307405_10272463 3300031731 Bacteria 1270
272 Ga0307410_10004781 3300031852 Bacteria 7067
273 Ga0307410_10017215 3300031852 Bacteria 4334
274 Ga0307412_10006138 3300031911 Bacteria 6771
275 Ga0307409_100148699 3300031995 Bacteria 2030
276 Ga0307416_100011157 3300032002 Bacteria 5975
277 Ga0307414_10003031 3300032004 Bacteria 8906
278 Ga0307411_10001140 3300032005 Bacteria 10411
279 Ga0307411_10002736 3300032005 Bacteria 7919
280 Ga0307411_10004799 3300032005 Bacteria 6550
281 Ga0307411_10007613 3300032005 Bacteria 5539
282 Ga0307411_10053099 3300032005 Bacteria 2653
283 Ga0307507_10135975 3300033179 Bacteria 1903
284 Ga0373923_0017209 3300035111 Bacteria 2761
285 Ga0373923_0089820 3300035111 Bacteria 1342
286 Ga0373954_0108064 3300035118 Bacteria 1345
287 Ga0373935_0044718 3300035692 Bacteria 2792
288 Ga0373947_0013053 3300035725 Bacteria 4763
289 Ga0373937_0000854 3300036401 Bacteria 26110
290 Ga0373937_0039412 3300036401 Bacteria 4306
291 Ga0373937_0085911 3300036401 Bacteria 2911
292 Ga0373937_0214270 3300036401 Bacteria 1812
293 Ga0373937_0439307 3300036401 Unclassified 1239
294 Ga0373937_0570391 3300036401 Unclassified 1075
295 Ga0373925_0316642 3300037068 Bacteria 1262
296 Ga0395898_0002294 3300037466 Bacteria 22975
297 Ga0436365_0439305 3300039437 Bacteria 1356
298 Ga0436363_0069527 3300039450 Bacteria 3132
299 Ga0439462_0014781 3300042015 Bacteria 2008
300 Ga0450898_017538 3300042134 Bacteria 1232
301 Ga0439434_0003730 3300042435 Bacteria 4450
302 Ga0439435_0000942 3300042436 Bacteria 5058
303 Ga0466969_0006141 3300044656 Bacteria 6396
304 Ga0466972_0038922 3300044658 Bacteria 2322
305 Ga0453683_0000336 3300044673 Bacteria 57199
306 Ga0466965_0171467 3300044683 Bacteria 1142
307 Ga0466966_0028225 3300044684 Bacteria 3657
308 Ga0466968_0089647 3300044735 Bacteria 1361
309 Ga0466970_0070616 3300044765 Bacteria 1878
310 Ga0466957_0142732 3300044842 Bacteria 1544
311 Ga0466959_0006916 3300045049 Bacteria 7923
312 Ga0451576_0058363 3300045051 Bacteria 4033
313 Ga0495592_0074702 3300046454 Bacteria 2462
314 Ga0495651_0000170 3300046462 Bacteria 48007
315 Ga0495651_0004635 3300046462 Bacteria 10513
316 Ga0495651_0010586 3300046462 Bacteria 7091
317 Ga0495653_0004599 3300046463 Bacteria 11160
318 Ga0495653_0006517 3300046463 Bacteria 9579
319 Ga0495650_0045592 3300046471 Unclassified 1845
320 Ga0495580_0160967 3300046472 Unclassified 1553
321 Ga0495664_0020007 3300046477 Unclassified 3856
322 Ga0495664_0049118 3300046477 Bacteria 2505
323 Ga0495608_0039297 3300046511 Unclassified 3172
324 Ga0495608_0101927 3300046511 Unclassified 1850
325 Ga0495618_0003670 3300046514 Bacteria 9518
326 Ga0495628_0007934 3300046516 Bacteria 9147
327 Ga0495628_0136369 3300046516 Unclassified 1875
328 Ga0495630_0041509 3300046517 Unclassified 3435
329 Ga0495643_0003908 3300046522 Bacteria 10693
330 Ga0495642_0018441 3300046528 Bacteria 2732
331 Ga0495652_0007088 3300046529 Bacteria 10346
332 Ga0495652_0009036 3300046529 Bacteria 9066
333 Ga0495640_0150790 3300046533 Bacteria 1494
334 Ga0495586_0012021 3300046535 Bacteria 4598
335 Ga0495587_0000436 3300046536 Bacteria 29259
336 Ga0495645_0046580 3300046543 Bacteria 3160
337 Ga0495645_0057765 3300046543 Unclassified 2815
338 Ga0495633_0025796 3300046558 Bacteria 2891
339 Ga0495667_0000964 3300046559 Bacteria 18622
340 Ga0495667_0006587 3300046559 Bacteria 7884
341 Ga0495635_0094015 3300046663 Unclassified 2050
342 Ga0495635_0192767 3300046663 Unclassified 1383
343 Ga0495657_0004381 3300046675 Bacteria 11265
344 Ga0495657_0020238 3300046675 Bacteria 4786
345 Ga0495599_0019438 3300046678 Unclassified 4234
346 Ga0495623_0009634 3300046679 Bacteria 6270
347 Ga0495624_0033200 3300046690 Bacteria 3343
348 Ga0495671_0014646 3300046692 Bacteria 4215
349 Ga0495600_0005825 3300046809 Bacteria 7450
350 Ga0495600_0014915 3300046809 Bacteria 4905
351 Ga0495604_0000750 3300047317 Bacteria 27284
352 Ga0495674_0001869 3300047319 Bacteria 20745
353 Ga0495680_0002401 3300047322 Bacteria 19217
354 Ga0495675_0000237 3300047444 Bacteria 39871
355 Ga0495675_0008651 3300047444 Bacteria 6313
356 Ga0495684_0004533 3300047471 Bacteria 10853
357 Ga0495602_0034103 3300048088 Bacteria 4766
358 Ga0495602_0060138 3300048088 Unclassified 3313
359 Ga0495614_0000732 3300048089 Bacteria 13880
360 Ga0495615_0003905 3300048090 Bacteria 2546
361 Ga0496100_0061807 3300048903 Bacteria 2469
362 Ga0496105_0316056 3300048908 Bacteria 1253
363 Ga0496106_0108454 3300048909 Unclassified 2160
364 Ga0496109_0101518 3300048912 Unclassified 2670
365 Ga0496112_0021098 3300048915 Bacteria 6188
366 Ga0496113_0077150 3300048916 Unclassified 2547
367 Ga0496114_0004968 3300048917 Bacteria 10372
368 Ga0496114_0419139 3300048917 Bacteria 1186
369 Ga0496119_0001382 3300048922 Bacteria 29525
370 Ga0496120_0000197 3300048923 Bacteria 103378
371 Ga0496120_0013276 3300048923 Bacteria 5555
372 Ga0496121_0057500 3300048924 Bacteria 3223
373 Ga0496121_0172523 3300048924 Bacteria 1569
374 Ga0501034_0007394 3300049571 Bacteria 11698
375 Ga0501034_0067714 3300049571 Bacteria 3582
376 Ga0501036_0179037 3300049572 Bacteria 1785
377 Ga0501038_0183775 3300049574 Bacteria 1686
378 Ga0501042_0155245 3300049578 Unclassified 1651
379 nmdc:mga09592_284218_c1 3300050508 Unclassified 1435
380 nmdc:mga0qj67_64595_c1 3300050509 Bacteria 2912
381 nmdc:mga08y16_17995_c1 3300050511 Bacteria 7443
382 nmdc:mga08y16_243098_c1 3300050511 Bacteria 1860
383 nmdc:mga08y16_464627_c1 3300050511 Bacteria 1289
384 nmdc:mga08y16_51555_c1 3300050511 Unclassified 4305
385 nmdc:mga0a205_185375_c1 3300050515 Bacteria 1974
386 nmdc:mga0a205_475508_c1 3300050515 Bacteria 1108
387 Ga0500643_003430 3300053087 Bacteria 7640
388 Ga0500641_0066899 3300053096 Bacteria 1505
389 Ga0500608_002331 3300053122 Bacteria 6892
390 Ga0500573_0177332 3300053140 Bacteria 1148
391 Ga0500585_011589 3300053144 Bacteria 2615
392 Ga0500616_0001042 3300053153 Bacteria 29312
393 Ga0500627_0027533 3300053158 Bacteria 2353
394 Ga0500637_0085766 3300053178 Bacteria 1821
395 2617918848 2617270889 Bacteria 9064343
396 2886630619 2886627955 Bacteria 7618130
397 2913916593 2913912277 Bacteria 9037797
398 2913940661 2913939268 Bacteria 8559644
399 2919140768 2919138771 Bacteria 5281312
400 2924766023 2924762789 Bacteria 6561353
401 642601612 642555144 Bacteria 9059191
402 8003320704 8003314358 Bacteria 10575343
403 Ga0105243_10392477
404 rootH1_10178630
405 Ga0065704_10074622
406 Ga0065707_10084107
407 Ga0070658_10002449
408 Ga0070676_10004357
409 Ga0070683_100165294
410 Ga0070683_100323699
411 Ga0070670_100007118
412 Ga0070670_100009785
413 Ga0068869_100020879
414 Ga0070666_10011800
415 Ga0070666_10027774
416 Ga0070680_100034364
417 Ga0070682_100014275
418 Ga0070682_100125408
419 Ga0068868_100024275
420 Ga0068868_100028688
421 Ga0070691_10041411
422 Ga0070687_100064186
423 Ga0070687_100076613
424 Ga0070661_100009397
425 Ga0070668_100006199
426 Ga0070669_100145334
427 Ga0070669_100176330
428 Ga0070675_100003673
429 Ga0070675_100030115
430 Ga0070671_100001163
431 Ga0070671_100143452
432 Ga0070673_100003826
433 Ga0070673_100028400
434 Ga0070688_100046830
435 Ga0070667_100015957
436 Ga0070667_100017935
437 Ga0070714_100271350
438 Ga0070713_100052044
439 Ga0070713_100082912
440 Ga0070701_10026504
441 Ga0070700_100060139
442 Ga0070663_100000420
443 Ga0070678_100093216
444 Ga0070681_10016203
445 Ga0070681_10283569
446 Ga0068867_100029873
447 Ga0068867_100147622
448 Ga0070685_10013788
449 Ga0070706_100118216
450 Ga0070699_100114901
451 Ga0070679_100003262
452 Ga0070679_100056130
453 Ga0070684_100025007
454 Ga0070684_100027996
455 Ga0068853_100292222
456 Ga0070672_100006726
457 Ga0070686_100053460
458 Ga0070686_100155790
459 Ga0070695_100080439
460 Ga0070665_100000011
461 Ga0070665_100011449
462 Ga0068855_100062305
463 Ga0068855_100101599
464 Ga0068855_100238462
465 Ga0070664_100005933
466 Ga0070664_100009134
467 Ga0068857_100011738
468 Ga0068856_100115516
469 Ga0068856_100167904
470 Ga0068852_100070194
471 Ga0068859_100028312
472 Ga0068859_100064104
473 Ga0068859_100136487
474 Ga0068864_100009570
475 Ga0068864_100028054
476 Ga0068861_100020458
477 Ga0068851_10025491
478 Ga0068863_100000534
479 Ga0068863_100016027
480 Ga0068863_100024156
481 Ga0068863_100087985
482 Ga0068863_100252727
483 Ga0068858_100004105
484 Ga0068858_100012417
485 Ga0068858_100133088
486 Ga0068860_100011410
487 Ga0068860_100017992
488 Ga0068860_100035517
489 Ga0068860_100092238
490 Ga0068860_100227261
491 Ga0068862_100092857
492 Ga0070717_10011440
493 Ga0097621_100016251
494 Ga0097621_100023244
495 Ga0068871_100007824
496 Ga0068871_100137901
497 Ga0068871_100163797
498 Ga0075428_100073369
499 Ga0075428_100195025
500 Ga0075430_100083304
501 Ga0075431_100001583
502 Ga0075433_10134226
503 Ga0075433_10170934
504 Ga0075434_100059280
505 Ga0075429_100083241
506 Ga0075429_100224735
507 Ga0075429_100306632
508 Ga0068865_100328484
509 Ga0097620_100028312
510 Ga0097620_100064103
511 Ga0097620_100136486
512 Ga0079104_1000014
513 Ga0099795_10049613
514 Ga0105244_10000055
515 Ga0105240_10003389
516 Ga0105240_10018292
517 Ga0105240_10040549
518 Ga0105240_10044875
519 Ga0105240_10140105
520 Ga0105240_10198532
521 Ga0105240_10269282
522 Ga0111539_10000509
523 Ga0111539_10011819
524 Ga0111539_10087531
525 Ga0111539_10373537
526 Ga0105245_10010745
527 Ga0105245_10018954
528 Ga0105245_10033146
529 Ga0105245_10040767
530 Ga0105247_10012697
531 Ga0114129_10670634
532 Ga0105241_10020485
533 Ga0105242_10024635
534 Ga0105248_10011812
535 Ga0105248_10023511
536 Ga0105248_10578338
537 Ga0105237_10027328
538 Ga0105238_10025114
539 Ga0105238_10031325
540 Ga0105238_10060678
541 Ga0105238_10078149
542 Ga0105238_10165677
543 Ga0105238_10257244
544 Ga0105239_10019163
545 Ga0105239_10073142
546 Ga0105239_10374517
547 Ga0105239_10399075
548 Ga0105246_10003339
549 Ga0157370_10013344
550 Ga0157369_10034038
551 Ga0157369_10045232
552 Ga0157369_10064276
553 Ga0157374_10016788
554 Ga0163162_10016185
555 Ga0163162_10119234
556 Ga0157372_10028281
557 Ga0157372_10218635
558 Ga0157372_10288627
559 Ga0157375_10010310
560 Ga0163163_10006452
561 Ga0163163_10014187
562 Ga0163163_10019887
563 Ga0163163_10239767
564 Ga0157380_10002109
565 Ga0157380_10152912
566 Ga0157379_10010874
567 Ga0157379_10031297
568 Ga0209025_1006935
569 Ga0209050_1025558
570 Ga0207697_10045680
571 Ga0207656_10016079
572 Ga0207655_1000004
573 Ga0207682_10033296
574 Ga0207680_10015649
575 Ga0207643_10073591
576 Ga0207705_10000890
577 Ga0207684_10113865
578 Ga0207707_10058583
579 Ga0207695_10039731
580 Ga0207695_10055995
581 Ga0207695_10094912
582 Ga0207671_10016410
583 Ga0207671_10038320
584 Ga0207662_10083283
585 Ga0207662_10149119
586 Ga0207662_10168126
587 Ga0207649_10018164
588 Ga0207652_10070036
589 Ga0207652_10076496
590 Ga0207652_10083918
591 Ga0207694_10015983
592 Ga0207694_10018700
593 Ga0207694_10026609
594 Ga0207694_10154515
595 Ga0207694_10197209
596 Ga0207650_10005888
597 Ga0207650_10016546
598 Ga0207659_10007137
599 Ga0207659_10010426
600 Ga0207687_10006980
601 Ga0207687_10017055
602 Ga0207687_10167585
603 Ga0207700_10013828
604 Ga0207700_10262126
605 Ga0207644_10119094
606 Ga0207686_10017266
607 Ga0207686_10120443
608 Ga0207686_10150362
609 Ga0207686_10164085
610 Ga0207670_10111157
611 Ga0207704_10101111
612 Ga0207704_10107606
613 Ga0207691_10010581
614 Ga0207691_10015959
615 Ga0207691_10178136
616 Ga0207711_10014014
617 Ga0207711_10450733
618 Ga0207689_10088654
619 Ga0207679_10028937
620 Ga0207679_10041387
621 Ga0207667_10022329
622 Ga0207667_10046106
623 Ga0207667_10202184
624 Ga0207667_10247172
625 Ga0207667_10313124
626 Ga0207651_10063710
627 Ga0207651_10069635
628 Ga0207668_10051590
629 Ga0207668_10379410
630 Ga0207658_10021249
631 Ga0207703_10037117
632 Ga0207703_10038475
633 Ga0207639_10037317
634 Ga0207678_10000514
635 Ga0207678_10021134
636 Ga0207678_10163485
637 Ga0207708_10004413
638 Ga0207708_10236397
639 Ga0207641_10000047
640 Ga0207641_10034421
641 Ga0207641_10068714
642 Ga0207641_10142261
643 Ga0207641_10194427
644 Ga0207648_10000163
645 Ga0207648_10007528
646 Ga0207648_10020631
647 Ga0207648_10160874
648 Ga0207676_10003712
649 Ga0207676_10007400
650 Ga0207676_10108145
651 Ga0207674_10013533
652 Ga0207674_10118700
653 Ga0207675_100243305
654 Ga0207683_10135940
655 Ga0209281_1000032
656 Ga0207428_10000236
657 Ga0207428_10013853
658 Ga0268266_10000063
659 Ga0268266_10002110
660 Ga0268265_10145558
661 Ga0268264_10104480
662 Ga0268264_10185733
663 Ga0268264_10259479
664 Ga0265334_10051338
665 Ga0265338_10003114
666 Ga0265338_10013194
667 Ga0265338_10193483
668 Ga0265320_10026255
669 Ga0307509_10000177
670 Ga0307509_10019902
671 Ga0307408_100003770
672 Ga0265314_10000723
673 Ga0307405_10272463
674 Ga0307410_10004781
675 Ga0307410_10017215
676 Ga0307412_10006138
677 Ga0307409_100148699
678 Ga0307416_100011157
679 Ga0307414_10003031
680 Ga0307411_10001140
681 Ga0307411_10002736
682 Ga0307411_10004799
683 Ga0307411_10007613
684 Ga0307411_10053099
685 Ga0307507_10135975
686 Ga0373923_0017209
687 Ga0373923_0089820
688 Ga0373954_0108064
689 Ga0373935_0044718
690 Ga0373947_0013053
691 Ga0373937_0000854
692 Ga0373937_0039412
693 Ga0373937_0085911
694 Ga0373937_0214270
695 Ga0373937_0439307
696 Ga0373937_0570391
697 Ga0373925_0316642
698 Ga0395898_0002294
699 Ga0436365_0439305
700 Ga0436363_0069527
701 Ga0439462_0014781
702 Ga0450898_017538
703 Ga0439434_0003730
704 Ga0439435_0000942
705 Ga0466969_0006141
706 Ga0466972_0038922
707 Ga0453683_0000336
708 Ga0466965_0171467
709 Ga0466966_0028225
710 Ga0466968_0089647
711 Ga0466970_0070616
712 Ga0466957_0142732
713 Ga0466959_0006916
714 Ga0451576_0058363
715 Ga0495592_0074702
716 Ga0495651_0000170
717 Ga0495651_0004635
718 Ga0495651_0010586
719 Ga0495653_0004599
720 Ga0495653_0006517
721 Ga0495650_0045592
722 Ga0495580_0160967
723 Ga0495664_0020007
724 Ga0495664_0049118
725 Ga0495608_0039297
726 Ga0495608_0101927
727 Ga0495618_0003670
728 Ga0495628_0007934
729 Ga0495628_0136369
730 Ga0495630_0041509
731 Ga0495643_0003908
732 Ga0495642_0018441
733 Ga0495652_0007088
734 Ga0495652_0009036
735 Ga0495640_0150790
736 Ga0495586_0012021
737 Ga0495587_0000436
738 Ga0495645_0046580
739 Ga0495645_0057765
740 Ga0495633_0025796
741 Ga0495667_0000964
742 Ga0495667_0006587
743 Ga0495635_0094015
744 Ga0495635_0192767
745 Ga0495657_0004381
746 Ga0495657_0020238
747 Ga0495599_0019438
748 Ga0495623_0009634
749 Ga0495624_0033200
750 Ga0495671_0014646
751 Ga0495600_0005825
752 Ga0495600_0014915
753 Ga0495604_0000750
754 Ga0495674_0001869
755 Ga0495680_0002401
756 Ga0495675_0000237
757 Ga0495675_0008651
758 Ga0495684_0004533
759 Ga0495602_0034103
760 Ga0495602_0060138
761 Ga0495614_0000732
762 Ga0495615_0003905
763 Ga0496100_0061807
764 Ga0496105_0316056
765 Ga0496106_0108454
766 Ga0496109_0101518
767 Ga0496112_0021098
768 Ga0496113_0077150
769 Ga0496114_0004968
770 Ga0496114_0419139
771 Ga0496119_0001382
772 Ga0496120_0000197
773 Ga0496120_0013276
774 Ga0496121_0057500
775 Ga0496121_0172523
776 Ga0501034_0007394
777 Ga0501034_0067714
778 Ga0501036_0179037
779 Ga0501038_0183775
780 Ga0501042_0155245
781 nmdc:mga09592_284218_c1
782 nmdc:mga0qj67_64595_c1
783 nmdc:mga08y16_17995_c1
784 nmdc:mga08y16_243098_c1
785 nmdc:mga08y16_464627_c1
786 nmdc:mga08y16_51555_c1
787 nmdc:mga0a205_185375_c1
788 nmdc:mga0a205_475508_c1
789 Ga0500643_003430
790 Ga0500641_0066899
791 Ga0500608_002331
792 Ga0500573_0177332
793 Ga0500585_011589
794 Ga0500616_0001042
795 Ga0500627_0027533
796 Ga0500637_0085766
797 2617918848
798 2886630619
799 2913916593
800 2913940661
801 2919140768
802 2924766023
803 642601612
804 8003320704

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

217

346

0.95

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

249

380

0.83

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

68

177

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b27-assembly1.cif.gz_A dihydroprecondylocarpine acetate synthase from catharanthus roseus 0.9146 2 326
7vem-assembly1.cif.gz_B the nadph-assisted quinone oxidoreductase from phytophthora capsici 0.9089 2 326
7vem-assembly1.cif.gz_B the nadph-assisted quinone oxidoreductase from phytophthora capsici 0.8982 2 326
3uog-assembly1.cif.gz_A crystal structure of putative alcohol dehydrogenase from sinorhizobium meliloti 1021 0.8932 2 326
2eih-assembly1.cif.gz_A crystal structure of nad-dependent alcohol dehydrogenase 0.8902 1 328
ID Description Score Start End Superfamily
af_Q54UL7_143_287_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9493 133 273 3.40.50.720
af_A0A286Y901_130_273_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9381 137 273 3.40.50.720
af_P72043_133_294_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9356 146 273 3.40.50.720
3uogB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9311 133 274 3.40.50.720
af_O65423_126_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9305 138 273 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A142HFC5-F1-model_v4 deleted 0.9745 152 327
AF-A0A356CKQ3-F1-model_v4 NAD(P)-dependent alcohol dehydrogenase 0.9674 133 328 GO:0016491
AF-A0A142HFC5-F1-model_v4 deleted 0.9637 152 327
AF-A0A440IWI4-F1-model_v4 deleted 0.963 181 328
AF-A0A356CKQ3-F1-model_v4 NAD(P)-dependent alcohol dehydrogenase 0.9532 133 328 GO:0016491

Map