F435073

General Info

Members Datasets Scaffolds Average Seq Length
402 220 398 363

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10172808|Ga0114129_101728083
Length 386
Sequence VGDRGPPTSGERAGKGDELVRDPRVDNLARILVRYSTEVKEGDTCVIEGATAGEPLIAALYEEVIEAGGHPVVALSLQGQLPTFFERASDAQLEWISPLSEWAAKEADCRIAVGADTNTHELSGVDPERQQKRRAATRELMDVVMRRSADGDHRWVYTLFPTDAYAADADMSLAQFEDFYFAACMADEQDGIDAWIQASKECARLSEWVEGHEEVHVTAPGTDIRLGIANRKFIPADGKRNMPDGEFFTAPIEDAVDGEVSFHLPAMVGGREVAGVKLRFDAGKVVDASAERGEEYLISLLDTDQGARRLGELGIGTNYAIDRGTRDVLLDEKIGGTVHMAVGASYPECGGTNESAVHTDLVCDLRRGGRIEVDGESLQEDGRFLV

Samples

Sample ID Description Type Environment
1 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
2 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
3 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
4 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
143 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
156 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
157 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
158 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
214 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
217 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
220 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.76
Metatranscriptomes 0.25
Isolates 1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.97
Nodule 0
Rhizoplane 6.97
Rhizosphere 85.32
Stem 0
Stem Tuber 0
Unclassified 1.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000358 3300000549 Bacteria 7781
2 JGI25407J50210_10000948 3300003373 Bacteria 6257
3 JGI25407J50210_10007919 3300003373 Bacteria 2671
4 Ga0070658_10016785 3300005327 Bacteria 5862
5 Ga0068869_100241269 3300005334 Archaea 1440
6 Ga0070682_100042372 3300005337 Bacteria 2809
7 Ga0068868_100000141 3300005338 Bacteria 46406
8 Ga0070660_100027788 3300005339 Bacteria 4226
9 Ga0070687_100155368 3300005343 Bacteria 1347
10 Ga0070661_100036531 3300005344 Bacteria 3572
11 Ga0070661_100107954 3300005344 Bacteria 2076
12 Ga0070668_100012135 3300005347 Bacteria 6417
13 Ga0070674_100019638 3300005356 Bacteria 4297
14 Ga0070674_100024535 3300005356 Bacteria 3915
15 Ga0070673_100288701 3300005364 Bacteria 1441
16 Ga0070673_100363586 3300005364 Archaea 1287
17 Ga0070659_100004368 3300005366 Bacteria 10092
18 Ga0070701_10060272 3300005438 Unclassified 1998
19 Ga0070711_100036522 3300005439 Bacteria 3291
20 Ga0070700_100026150 3300005441 Bacteria 3443
21 Ga0070663_100146019 3300005455 Archaea 1810
22 Ga0070663_100331843 3300005455 Bacteria 1226
23 Ga0070662_100000002 3300005457 Bacteria 253208
24 Ga0070662_100005343 3300005457 Bacteria 8206
25 Ga0070681_10035341 3300005458 Bacteria 5020
26 Ga0070679_100000913 3300005530 Bacteria 25634
27 Ga0070679_100382822 3300005530 Archaea 1353
28 Ga0070684_100045957 3300005535 Bacteria 3783
29 Ga0070684_100174251 3300005535 Bacteria 1954
30 Ga0068853_100102973 3300005539 Bacteria 2527
31 Ga0070672_100068798 3300005543 Bacteria 2809
32 Ga0070693_100000470 3300005547 Bacteria 18108
33 Ga0070665_100000141 3300005548 Bacteria 135473
34 Ga0070704_100147592 3300005549 Bacteria 1845
35 Ga0070664_100007232 3300005564 Bacteria 8954
36 Ga0068857_100105622 3300005577 Bacteria 2529
37 Ga0068856_100067642 3300005614 Bacteria 3530
38 Ga0068856_100124947 3300005614 Bacteria 2576
39 Ga0070702_100028208 3300005615 Bacteria 3041
40 Ga0068852_100088281 3300005616 Bacteria 2769
41 Ga0068852_100095922 3300005616 Bacteria 2665
42 Ga0068859_100271224 3300005617 Archaea 1789
43 Ga0068864_100036710 3300005618 Bacteria 4179
44 Ga0068861_100016618 3300005719 Bacteria 5210
45 Ga0068863_100000022 3300005841 Bacteria 188278
46 Ga0068858_100000118 3300005842 Bacteria 83359
47 Ga0081455_10007865 3300005937 Bacteria 11162
48 Ga0081455_10014951 3300005937 Bacteria 7561
49 Ga0081455_10022667 3300005937 Bacteria 5860
50 Ga0081455_10062482 3300005937 Bacteria 3130
51 Ga0081455_10068114 3300005937 Bacteria 2964
52 Ga0081538_10000211 3300005981 Bacteria 64921
53 Ga0081538_10000229 3300005981 Bacteria 63078
54 Ga0081538_10000711 3300005981 Bacteria 36435
55 Ga0081538_10000812 3300005981 Bacteria 33866
56 Ga0081538_10000959 3300005981 Bacteria 30827
57 Ga0081538_10001356 3300005981 Bacteria 25202
58 Ga0081538_10001789 3300005981 Bacteria 21694
59 Ga0081538_10004566 3300005981 Bacteria 12744
60 Ga0081538_10005940 3300005981 Bacteria 10867
61 Ga0081538_10008216 3300005981 Bacteria 8901
62 Ga0081538_10009621 3300005981 Bacteria 8038
63 Ga0081538_10010366 3300005981 Bacteria 7646
64 Ga0081538_10012314 3300005981 Bacteria 6863
65 Ga0081538_10014860 3300005981 Bacteria 6066
66 Ga0081538_10028841 3300005981 Bacteria 3806
67 Ga0081538_10031143 3300005981 Bacteria 3605
68 Ga0081540_1000366 3300005983 Bacteria 45428
69 Ga0081540_1023927 3300005983 Bacteria 3556
70 Ga0081540_1029444 3300005983 Bacteria 3058
71 Ga0081539_10002507 3300005985 Bacteria 25708
72 Ga0075365_10000799 3300006038 Bacteria 12911
73 Ga0075365_10009149 3300006038 Bacteria 5675
74 Ga0075365_10009351 3300006038 Bacteria 5627
75 Ga0075365_10023804 3300006038 Bacteria 3856
76 Ga0075365_10033280 3300006038 Bacteria 3320
77 Ga0075365_10048854 3300006038 Bacteria 2786
78 Ga0075365_10079938 3300006038 Bacteria 2213
79 Ga0075363_100004886 3300006048 Bacteria 5921
80 Ga0075363_100047621 3300006048 Bacteria 2277
81 Ga0075363_100082312 3300006048 Bacteria 1762
82 Ga0075364_10009348 3300006051 Bacteria 5875
83 Ga0075364_10074444 3300006051 Bacteria 2239
84 Ga0075364_10104353 3300006051 Bacteria 1888
85 Ga0075432_10018411 3300006058 Bacteria 2383
86 Ga0070712_100032671 3300006175 Bacteria 3515
87 Ga0075367_10043214 3300006178 Bacteria 2639
88 Ga0075428_100085797 3300006844 Bacteria 3434
89 Ga0075428_100135713 3300006844 Bacteria 2675
90 Ga0075428_100151561 3300006844 Bacteria 2519
91 Ga0075428_100200433 3300006844 Bacteria 2158
92 Ga0075428_100329617 3300006844 Bacteria 1640
93 Ga0075428_100382035 3300006844 Bacteria 1510
94 Ga0075430_100001083 3300006846 Bacteria 21605
95 Ga0075430_100040801 3300006846 Bacteria 3928
96 Ga0075430_100170303 3300006846 Bacteria 1812
97 Ga0075431_100000197 3300006847 Bacteria 44284
98 Ga0075431_100004050 3300006847 Bacteria 14282
99 Ga0075431_100004755 3300006847 Bacteria 13352
100 Ga0075431_100059877 3300006847 Bacteria 3929
101 Ga0075431_100247510 3300006847 Bacteria 1812
102 Ga0075433_10013700 3300006852 Bacteria 6602
103 Ga0075433_10030255 3300006852 Bacteria 4619
104 Ga0075433_10060052 3300006852 Bacteria 3328
105 Ga0075434_100025133 3300006871 Bacteria 5827
106 Ga0075434_100238051 3300006871 Bacteria 1840
107 Ga0075429_100032178 3300006880 Bacteria 4558
108 Ga0075429_100063436 3300006880 Bacteria 3219
109 Ga0068865_100015130 3300006881 Bacteria 4916
110 Ga0097620_100271250 3300006931 Archaea 1789
111 Ga0075435_100067772 3300007076 Bacteria 2906
112 Ga0111539_10042802 3300009094 Bacteria 5434
113 Ga0111539_10048618 3300009094 Bacteria 5063
114 Ga0111539_10175528 3300009094 Bacteria 2503
115 Ga0111539_10232192 3300009094 Bacteria 2148
116 Ga0111539_10273269 3300009094 Bacteria 1967
117 Ga0105245_10000517 3300009098 Bacteria 35353
118 Ga0105245_10007239 3300009098 Bacteria 9721
119 Ga0105245_10036834 3300009098 Bacteria 4347
120 Ga0105245_10037104 3300009098 Bacteria 4332
121 Ga0105245_10151773 3300009098 Bacteria 2191
122 Ga0114129_10014759 3300009147 Bacteria 11131
123 Ga0114129_10018964 3300009147 Bacteria 9799
124 Ga0114129_10022570 3300009147 Bacteria 8927
125 Ga0114129_10068282 3300009147 Bacteria 4956
126 Ga0114129_10118100 3300009147 Bacteria 3654
127 Ga0114129_10153454 3300009147 Bacteria 3151
128 Ga0114129_10172808 3300009147 Bacteria 2945
129 Ga0114129_10305394 3300009147 Bacteria 2119
130 Ga0114129_10399312 3300009147 Bacteria 1812
131 Ga0105243_10029327 3300009148 Bacteria 4230
132 Ga0105243_10113392 3300009148 Bacteria 2273
133 Ga0105242_10169298 3300009176 Bacteria 1918
134 Ga0105248_10379187 3300009177 Bacteria 1592
135 Ga0105237_10157260 3300009545 Bacteria 2270
136 Ga0105238_10287878 3300009551 Bacteria 1625
137 Ga0105249_10101411 3300009553 Bacteria 2707
138 Ga0105239_10029010 3300010375 Bacteria 6082
139 Ga0105239_10153105 3300010375 Bacteria 2574
140 Ga0105246_10036885 3300011119 Bacteria 3277
141 Ga0157371_10095763 3300013102 Bacteria 2104
142 Ga0157374_10076498 3300013296 Bacteria 3165
143 Ga0157378_10100971 3300013297 Bacteria 2635
144 Ga0163162_10138796 3300013306 Bacteria 2543
145 Ga0163162_10235255 3300013306 Bacteria 1962
146 Ga0157372_10026838 3300013307 Bacteria 6270
147 Ga0157372_10133478 3300013307 Bacteria 2858
148 Ga0157375_10057452 3300013308 Bacteria 3846
149 Ga0157375_10144883 3300013308 Bacteria 2505
150 Ga0163163_10487364 3300014325 Bacteria 1294
151 Ga0157379_10002058 3300014968 Bacteria 16705
152 Ga0157376_10096258 3300014969 Bacteria 2576
153 Ga0163161_10017920 3300017792 Bacteria 4963
154 Ga0206353_11580202 3300020082 Bacteria 7060
155 Ga0213876_10066944 3300021384 Bacteria 1897
156 Ga0213871_10005741 3300021441 Bacteria 2584
157 Ga0207656_10077173 3300025321 Archaea 1491
158 Ga0207705_10117055 3300025909 Unclassified 1974
159 Ga0207707_10001912 3300025912 Bacteria 18946
160 Ga0207695_10078227 3300025913 Bacteria 3356
161 Ga0207671_10115976 3300025914 Bacteria 2042
162 Ga0207693_10038017 3300025915 Bacteria 3792
163 Ga0207660_10146681 3300025917 Archaea 1809
164 Ga0207662_10176373 3300025918 Bacteria 1373
165 Ga0207657_10001009 3300025919 Bacteria 29964
166 Ga0207657_10010289 3300025919 Bacteria 9340
167 Ga0207652_10003850 3300025921 Bacteria 12292
168 Ga0207652_10004774 3300025921 Bacteria 10989
169 Ga0207694_10014746 3300025924 Bacteria 5893
170 Ga0207687_10000085 3300025927 Bacteria 68919
171 Ga0207687_10006799 3300025927 Bacteria 7536
172 Ga0207687_10045229 3300025927 Bacteria 3042
173 Ga0207690_10013413 3300025932 Bacteria 4924
174 Ga0207706_10000001 3300025933 Bacteria 423014
175 Ga0207706_10001392 3300025933 Bacteria 24155
176 Ga0207669_10022841 3300025937 Bacteria 3329
177 Ga0207669_10033440 3300025937 Bacteria 2902
178 Ga0207669_10233304 3300025937 Bacteria 1359
179 Ga0207711_10418602 3300025941 Archaea 1246
180 Ga0207661_10011369 3300025944 Bacteria 6446
181 Ga0207679_10012631 3300025945 Bacteria 5512
182 Ga0207712_10037121 3300025961 Bacteria 3323
183 Ga0207668_10099654 3300025972 Bacteria 2156
184 Ga0207677_10000397 3300026023 Bacteria 29959
185 Ga0207703_10000061 3300026035 Bacteria 132671
186 Ga0207639_10042365 3300026041 Bacteria 3411
187 Ga0207678_10002796 3300026067 Bacteria 15837
188 Ga0207708_10002157 3300026075 Bacteria 14531
189 Ga0207708_10079368 3300026075 Bacteria 2521
190 Ga0207708_10175306 3300026075 Bacteria 1700
191 Ga0207702_10009958 3300026078 Bacteria 7970
192 Ga0207702_10180103 3300026078 Archaea 1946
193 Ga0207641_10000016 3300026088 Bacteria 307363
194 Ga0207648_10009319 3300026089 Bacteria 9409
195 Ga0207676_10371008 3300026095 Archaea 1329
196 Ga0207674_10140665 3300026116 Bacteria 2373
197 Ga0207675_100002675 3300026118 Bacteria 17582
198 Ga0207675_100146769 3300026118 Archaea 2243
199 Ga0207675_100304222 3300026118 Bacteria 1554
200 Ga0207683_10160140 3300026121 Unclassified 2034
201 Ga0207683_10292820 3300026121 Bacteria 1488
202 Ga0207698_10035678 3300026142 Bacteria 3641
203 Ga0207428_10047873 3300027907 Bacteria 3432
204 Ga0207428_10086741 3300027907 Bacteria 2436
205 Ga0268266_10000056 3300028379 Bacteria 289176
206 Ga0265338_10031763 3300028800 Bacteria 5169
207 Ga0265338_10112223 3300028800 Bacteria 2193
208 Ga0265339_10003763 3300031249 Bacteria 10580
209 Ga0307405_10043760 3300031731 Bacteria 2734
210 Ga0307413_10038046 3300031824 Bacteria 2785
211 Ga0307410_10002997 3300031852 Bacteria 8332
212 Ga0307410_10003343 3300031852 Bacteria 8030
213 Ga0307410_10009597 3300031852 Bacteria 5439
214 Ga0307406_10002295 3300031901 Bacteria 10406
215 Ga0307406_10029226 3300031901 Bacteria 3337
216 Ga0307406_10090185 3300031901 Bacteria 2062
217 Ga0307407_10007067 3300031903 Bacteria 5055
218 Ga0307407_10031499 3300031903 Bacteria 2872
219 Ga0307407_10083684 3300031903 Bacteria 1936
220 Ga0307407_10090647 3300031903 Bacteria 1873
221 Ga0307412_10106984 3300031911 Bacteria 1990
222 Ga0307409_100006679 3300031995 Bacteria 6815
223 Ga0307409_100018000 3300031995 Bacteria 4730
224 Ga0307409_100042489 3300031995 Bacteria 3405
225 Ga0307409_100077597 3300031995 Bacteria 2669
226 Ga0307416_100023041 3300032002 Bacteria 4510
227 Ga0307416_100038226 3300032002 Bacteria 3701
228 Ga0307416_100158525 3300032002 Bacteria 2087
229 Ga0307414_10142424 3300032004 Bacteria 1879
230 Ga0307415_100170284 3300032126 Bacteria 1697
231 Ga0373929_0023013 3300035085 Archaea 1277
232 Ga0373955_0084341 3300035172 Bacteria 1801
233 Ga0316574_0065365 3300035398 Bacteria 2290
234 Ga0373937_0005521 3300036401 Bacteria 10841
235 Ga0316584_0041292 3300036712 Bacteria 3438
236 Ga0316584_0060747 3300036712 Bacteria 2831
237 Ga0395899_0052096 3300037312 Bacteria 3035
238 Ga0395900_0098617 3300037418 Bacteria 3002
239 Ga0395900_0115518 3300037418 Bacteria 2754
240 Ga0395900_0157181 3300037418 Bacteria 2322
241 Ga0395900_0299866 3300037418 Bacteria 1594
242 Ga0395898_0023305 3300037466 Bacteria 6257
243 Ga0395898_0086927 3300037466 Bacteria 3012
244 Ga0395898_0173757 3300037466 Bacteria 2059
245 Ga0395898_0282369 3300037466 Bacteria 1584
246 Ga0395905_0056722 3300037471 Bacteria 3664
247 Ga0395905_0058891 3300037471 Bacteria 3591
248 Ga0395901_0003004 3300038443 Bacteria 17017
249 Ga0395901_0253061 3300038443 Bacteria 1835
250 Ga0395901_0428877 3300038443 Bacteria 1355
251 Ga0400484_01204 3300038725 Bacteria 8572
252 Ga0436365_0971863 3300039437 Bacteria 2845
253 Ga0436360_0328593 3300039438 Bacteria 5787
254 Ga0436362_0431055 3300039453 Bacteria 4743
255 Ga0451853_0920077 3300041512 Bacteria 3723
256 Ga0451577_0007689 3300042876 Bacteria 10575
257 Ga0439440_0020118 3300042993 Bacteria 1495
258 Ga0466963_0000004 3300044694 Bacteria 102526
259 Ga0453684_0000055 3300044712 Bacteria 532014
260 Ga0453684_0861934 3300044712 Bacteria 973
261 Ga0466967_0007625 3300045976 Bacteria 7830
262 Ga0466967_0013953 3300045976 Bacteria 6235
263 Ga0495603_0000305 3300046455 Bacteria 26162
264 Ga0495603_0009899 3300046455 Bacteria 5770
265 Ga0495641_0000005 3300046461 Bacteria 206626
266 Ga0495641_0000294 3300046461 Bacteria 39903
267 Ga0495651_0185851 3300046462 Bacteria 1467
268 Ga0495639_0086529 3300046475 Bacteria 1466
269 Ga0495594_0069986 3300046499 Bacteria 1950
270 Ga0495596_0013564 3300046500 Bacteria 3451
271 Ga0495616_0020158 3300046513 Bacteria 3632
272 Ga0495620_0001374 3300046515 Bacteria 14672
273 Ga0495631_0018818 3300046518 Bacteria 3247
274 Ga0495652_0031927 3300046529 Bacteria 4609
275 Ga0495586_0000083 3300046535 Bacteria 57851
276 Ga0495586_0102763 3300046535 Archaea 1587
277 Ga0495587_0035754 3300046536 Bacteria 2991
278 Ga0495645_0006168 3300046543 Bacteria 8300
279 Ga0495645_0084432 3300046543 Bacteria 2274
280 Ga0495656_0003268 3300046615 Bacteria 5469
281 Ga0495634_0004632 3300046642 Bacteria 10731
282 Ga0495657_0045144 3300046675 Bacteria 2992
283 Ga0495647_0005224 3300046681 Bacteria 4254
284 Ga0495624_0000019 3300046690 Bacteria 102237
285 Ga0495672_0021884 3300047320 Bacteria 4164
286 Ga0495672_0047886 3300047320 Bacteria 2539
287 Ga0495676_0000238 3300047321 Bacteria 44160
288 Ga0495676_0123114 3300047321 Bacteria 1883
289 Ga0495673_0014787 3300047469 Bacteria 4047
290 Ga0495686_0000008 3300047472 Bacteria 727479
291 Ga0495686_0008106 3300047472 Bacteria 7768
292 Ga0495686_0009963 3300047472 Bacteria 6802
293 Ga0495602_0106543 3300048088 Bacteria 2288
294 Ga0496101_0028822 3300048904 Bacteria 3879
295 Ga0496101_0248098 3300048904 Archaea 1387
296 Ga0496102_0177771 3300048905 Bacteria 2004
297 Ga0496102_0198042 3300048905 Bacteria 1893
298 Ga0496104_0038785 3300048907 Bacteria 4458
299 Ga0496106_0156444 3300048909 Bacteria 1800
300 Ga0496107_0006218 3300048910 Bacteria 8208
301 Ga0496107_0022921 3300048910 Bacteria 4415
302 Ga0496107_0173897 3300048910 Bacteria 1598
303 Ga0496108_0000006 3300048911 Bacteria 469473
304 Ga0496108_0018667 3300048911 Bacteria 5682
305 Ga0496109_0000009 3300048912 Bacteria 236561
306 Ga0496109_0003225 3300048912 Bacteria 13583
307 Ga0496109_0163582 3300048912 Bacteria 2085
308 Ga0496109_0195702 3300048912 Archaea 1900
309 Ga0496109_0416669 3300048912 Bacteria 1269
310 Ga0496110_0047614 3300048913 Bacteria 3756
311 Ga0496110_0066106 3300048913 Bacteria 3197
312 Ga0496110_0125339 3300048913 Bacteria 2317
313 Ga0496111_0025897 3300048914 Bacteria 4138
314 Ga0496111_0030798 3300048914 Bacteria 3817
315 Ga0496111_0074966 3300048914 Bacteria 2465
316 Ga0496111_0249018 3300048914 Bacteria 1319
317 Ga0496112_0000025 3300048915 Bacteria 146197
318 Ga0496112_0034220 3300048915 Bacteria 4943
319 Ga0496114_0129599 3300048917 Bacteria 2177
320 Ga0496115_0022196 3300048918 Bacteria 4914
321 Ga0496115_0439995 3300048918 Archaea 1054
322 Ga0501039_0066650 3300049575 Bacteria 2795
323 Ga0501039_0180630 3300049575 Bacteria 1659
324 Ga0501040_0068603 3300049576 Bacteria 2446
325 Ga0501040_0077000 3300049576 Bacteria 2307
326 Ga0501041_0022711 3300049577 Bacteria 3758
327 Ga0501041_0134810 3300049577 Bacteria 1539
328 Ga0501068_0026288 3300049584 Bacteria 3428
329 Ga0501069_0147260 3300049585 Bacteria 1352
330 Ga0501071_0222065 3300049587 Bacteria 1422
331 Ga0501072_0017959 3300049588 Bacteria 5438
332 Ga0501072_0091948 3300049588 Bacteria 2409
333 Ga0501072_0092356 3300049588 Bacteria 2404
334 Ga0501072_0120839 3300049588 Bacteria 2087
335 Ga0501072_0251367 3300049588 Unclassified 1408
336 Ga0501073_0004161 3300049589 Bacteria 10852
337 Ga0501074_0055084 3300049590 Bacteria 2867
338 Ga0501075_0048281 3300049591 Bacteria 3199
339 Ga0501075_0079611 3300049591 Bacteria 2480
340 Ga0501075_0242818 3300049591 Archaea 1373
341 Ga0501076_0050950 3300049592 Bacteria 3276
342 Ga0501076_0060633 3300049592 Bacteria 3010
343 Ga0501076_0089171 3300049592 Bacteria 2479
344 Ga0501077_0180708 3300049593 Bacteria 1341
345 Ga0501079_0116301 3300049741 Bacteria 2079
346 Ga0501079_0157991 3300049741 Bacteria 1767
347 Ga0501079_0280584 3300049741 Bacteria 1303
348 Ga0501079_0284780 3300049741 Bacteria 1292
349 Ga0501080_0243832 3300049742 Archaea 1640
350 Ga0501081_0048060 3300049743 Bacteria 2936
351 Ga0501081_0049796 3300049743 Bacteria 2886
352 Ga0501081_0112018 3300049743 Bacteria 1937
353 Ga0501045_0133564 3300049824 Archaea 1845
354 nmdc:mga03n38_28193_c1 3300050490 Bacteria 2338
355 nmdc:mga03n38_3909_c1 3300050490 Bacteria 4855
356 nmdc:mga00v17_25432_c1 3300050491 Bacteria 3441
357 nmdc:mga0yw44_112811_c1 3300050492 Bacteria 1744
358 nmdc:mga0yw44_69741_c1 3300050492 Bacteria 2178
359 nmdc:mga0yw44_90343_c1 3300050492 Bacteria 1934
360 nmdc:mga06z11_105243_c1 3300050494 Bacteria 1554
361 nmdc:mga06z11_136327_c1 3300050494 Bacteria 1383
362 nmdc:mga05p37_11239_c1 3300050507 Bacteria 10647
363 nmdc:mga05p37_117786_c1 3300050507 Bacteria 3263
364 nmdc:mga05p37_125329_c1 3300050507 Bacteria 3154
365 nmdc:mga05p37_255459_c1 3300050507 Bacteria 2100
366 nmdc:mga05p37_432111_c1 3300050507 Bacteria 1529
367 nmdc:mga05p37_46556_c1 3300050507 Bacteria 5333
368 nmdc:mga05p37_61160_c1 3300050507 Bacteria 4636
369 nmdc:mga05p37_65637_c1 3300050507 Bacteria 4465
370 nmdc:mga09592_17415_c1 3300050508 Bacteria 5887
371 nmdc:mga0qj67_148359_c1 3300050509 Bacteria 1902
372 nmdc:mga0qj67_39680_c1 3300050509 Bacteria 3698
373 nmdc:mga0qj67_56996_c1 3300050509 Bacteria 3098
374 nmdc:mga06r32_1974_c1 3300050510 Bacteria 18315
375 nmdc:mga06r32_32182_c1 3300050510 Bacteria 4931
376 nmdc:mga06r32_68141_c1 3300050510 Bacteria 3437
377 nmdc:mga08y16_143948_c1 3300050511 Bacteria 2478
378 nmdc:mga08y16_34091_c1 3300050511 Bacteria 3322
379 nmdc:mga08y16_6425_c1 3300050511 Bacteria 12322
380 nmdc:mga0n895_208176_c1 3300050512 Bacteria 1986
381 nmdc:mga0n895_24293_c1 3300050512 Bacteria 5709
382 nmdc:mga0n895_49089_c1 3300050512 Bacteria 4133
383 nmdc:mga0rr50_16407_c1 3300050513 Bacteria 4919
384 nmdc:mga0rr50_41374_c1 3300050513 Bacteria 3357
385 nmdc:mga0a205_6323_c1 3300050515 Bacteria 10693
386 nmdc:mga0a205_70671_c1 3300050515 Bacteria 3370
387 nmdc:mga0a205_90133_c1 3300050515 Bacteria 2963
388 Ga0495612_0039687 3300053078 Bacteria 1915
389 Ga0495655_0013334 3300053083 Bacteria 1699
390 Ga0495619_0002874 3300053085 Bacteria 11197
391 Ga0500614_000427 3300053123 Bacteria 10952
392 Ga0500628_003881 3300053129 Bacteria 2470
393 Ga0501084_0000618 3300054114 Bacteria 27070
394 Ga0501084_0024940 3300054114 Bacteria 4990
395 Ga0501084_0094305 3300054114 Bacteria 2513
396 Ga0501084_0137072 3300054114 Bacteria 2060
397 Ga0530510_0006675 3300061734 Bacteria 8048
398 Ga0530510_0014444 3300061734 Bacteria 5568

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0861934 Ga0453684_0861934_19_960 313
2 3300048918 Ga0496115_0439995 Ga0496115_0439995_21_965 314
3 3300049577 Ga0501041_0134810 Ga0501041_0134810_20_964 314
4 3300025321 Ga0207656_10077173 Ga0207656_100771731 318
5 3300048914 Ga0496111_0249018 Ga0496111_0249018_82_1185 322
6 3300036712 Ga0316584_0060747 Ga0316584_0060747_463_1566 327
7 3300005983 Ga0081540_1029444 Ga0081540_10294443 331
8 3300049585 Ga0501069_0147260 Ga0501069_0147260_17_1012 331
9 3300009147 Ga0114129_10153454 Ga0114129_101534543 335
10 3300037312 Ga0395899_0052096 Ga0395899_0052096_816_1919 337
11 3300037418 Ga0395900_0098617 Ga0395900_0098617_642_1745 337
12 3300037471 Ga0395905_0056722 Ga0395905_0056722_1653_2756 337
13 3300009551 Ga0105238_10287878 Ga0105238_102878781 338
14 3300037418 Ga0395900_0115518 Ga0395900_0115518_344_1432 343
15 3300050507 nmdc:mga05p37_432111_c1 nmdc:mga05p37_432111_c1_112_1167 343
16 3300050492 nmdc:mga0yw44_69741_c1 nmdc:mga0yw44_69741_c1_519_1589 344
17 3300005937 Ga0081455_10014951 Ga0081455_1001495111 345
18 3300005983 Ga0081540_1000366 Ga0081540_10003663 345
19 3300005618 Ga0068864_100036710 Ga0068864_1000367105 347
20 3300011119 Ga0105246_10036885 Ga0105246_100368853 347
21 3300026095 Ga0207676_10371008 Ga0207676_103710081 347
22 3300048910 Ga0496107_0173897 Ga0496107_0173897_471_1574 347
23 3300048912 Ga0496109_0163582 Ga0496109_0163582_432_1535 347
24 3300048914 Ga0496111_0074966 Ga0496111_0074966_200_1303 347
25 3300005327 Ga0070658_10016785 Ga0070658_100167854 348
26 3300005337 Ga0070682_100042372 Ga0070682_1000423722 348
27 3300005339 Ga0070660_100027788 Ga0070660_1000277883 348
28 3300005344 Ga0070661_100036531 Ga0070661_1000365313 348
29 3300005356 Ga0070674_100019638 Ga0070674_1000196383 348
30 3300005364 Ga0070673_100363586 Ga0070673_1003635862 348
31 3300005366 Ga0070659_100004368 Ga0070659_1000043689 348
32 3300005438 Ga0070701_10060272 Ga0070701_100602722 348
33 3300005441 Ga0070700_100026150 Ga0070700_1000261502 348
34 3300005455 Ga0070663_100146019 Ga0070663_1001460192 348
35 3300005535 Ga0070684_100174251 Ga0070684_1001742512 348
36 3300005543 Ga0070672_100068798 Ga0070672_1000687982 348
37 3300005564 Ga0070664_100007232 Ga0070664_1000072321 348
38 3300005614 Ga0068856_100124947 Ga0068856_1001249473 348
39 3300005615 Ga0070702_100028208 Ga0070702_1000282083 348
40 3300005616 Ga0068852_100088281 Ga0068852_1000882812 348
41 3300005617 Ga0068859_100271224 Ga0068859_1002712242 348
42 3300005937 Ga0081455_10022667 Ga0081455_100226676 348
43 3300006038 Ga0075365_10023804 Ga0075365_100238041 348
44 3300006048 Ga0075363_100047621 Ga0075363_1000476213 348
45 3300006051 Ga0075364_10009348 Ga0075364_100093483 348
46 3300006881 Ga0068865_100015130 Ga0068865_1000151304 348
47 3300006931 Ga0097620_100271250 Ga0097620_1002712501 348
48 3300009094 Ga0111539_10048618 Ga0111539_100486185 348
49 3300009098 Ga0105245_10151773 Ga0105245_101517732 348
50 3300009148 Ga0105243_10029327 Ga0105243_100293274 348
51 3300009553 Ga0105249_10101411 Ga0105249_101014113 348
52 3300010375 Ga0105239_10029010 Ga0105239_100290104 348
53 3300013307 Ga0157372_10133478 Ga0157372_101334782 348
54 3300013308 Ga0157375_10144883 Ga0157375_101448833 348
55 3300025909 Ga0207705_10117055 Ga0207705_101170553 348
56 3300025919 Ga0207657_10001009 Ga0207657_1000100917 348
57 3300025932 Ga0207690_10013413 Ga0207690_100134135 348
58 3300025937 Ga0207669_10033440 Ga0207669_100334403 348
59 3300025941 Ga0207711_10418602 Ga0207711_104186022 348
60 3300025945 Ga0207679_10012631 Ga0207679_100126315 348
61 3300025961 Ga0207712_10037121 Ga0207712_100371213 348
62 3300026067 Ga0207678_10002796 Ga0207678_1000279610 348
63 3300026075 Ga0207708_10002157 Ga0207708_100021574 348
64 3300026116 Ga0207674_10140665 Ga0207674_101406652 348
65 3300026142 Ga0207698_10035678 Ga0207698_100356783 348
66 3300037466 Ga0395898_0282369 Ga0395898_0282369_178_1281 348
67 3300041512 Ga0451853_0920077 Ga0451853_0920077_1800_2903 348
68 3300048904 Ga0496101_0248098 Ga0496101_0248098_119_1222 348
69 3300048910 Ga0496107_0022921 Ga0496107_0022921_194_1297 348
70 3300048911 Ga0496108_0018667 Ga0496108_0018667_1688_2791 348
71 3300048912 Ga0496109_0003225 Ga0496109_0003225_9000_10103 348
72 3300048913 Ga0496110_0125339 Ga0496110_0125339_1085_2188 348
73 3300048917 Ga0496114_0129599 Ga0496114_0129599_89_1192 348
74 3300050490 nmdc:mga03n38_3909_c1 nmdc:mga03n38_3909_c1_878_1981 348
75 3300050491 nmdc:mga00v17_25432_c1 nmdc:mga00v17_25432_c1_200_1303 348
76 3300049575 Ga0501039_0066650 Ga0501039_0066650_1176_2228 350
77 3300049591 Ga0501075_0079611 Ga0501075_0079611_844_1896 350
78 iso_pu_bacteria 2865002811 2865006313 351
79 iso_pu_bacteria 8057977335 8057980837 351
80 3300048912 Ga0496109_0416669 Ga0496109_0416669_161_1225 353
81 3300006038 Ga0075365_10033280 Ga0075365_100332803 354
82 3300046461 Ga0495641_0000294 Ga0495641_0000294_19556_20620 354
83 3300046675 Ga0495657_0045144 Ga0495657_0045144_1504_2568 354
84 3300050515 nmdc:mga0a205_90133_c1 nmdc:mga0a205_90133_c1_932_1996 354
85 iso_pu_bacteria 2524614857 2526063221 354
86 iso_pu_bacteria 2739367875 2740064441 354
87 3300006038 Ga0075365_10048854 Ga0075365_100488542 356
88 3300021441 Ga0213871_10005741 Ga0213871_100057413 356
89 3300039438 Ga0436360_0328593 Ga0436360_0328593_2894_3967 356
90 3300046535 Ga0495586_0102763 Ga0495586_0102763_165_1244 356
91 3300049584 Ga0501068_0026288 Ga0501068_0026288_1047_2117 356
92 3300049741 Ga0501079_0116301 Ga0501079_0116301_926_1996 356
93 3300050490 nmdc:mga03n38_28193_c1 nmdc:mga03n38_28193_c1_495_1565 356
94 3300050494 nmdc:mga06z11_105243_c1 nmdc:mga06z11_105243_c1_93_1163 356
95 3300046681 Ga0495647_0005224 Ga0495647_0005224_2544_3623 359
96 3300049591 Ga0501075_0242818 Ga0501075_0242818_210_1289 359
97 3300026121 Ga0207683_10160140 Ga0207683_101601401 361
98 3300046455 Ga0495603_0000305 Ga0495603_0000305_13580_14668 362
99 3300048905 Ga0496102_0198042 Ga0496102_0198042_553_1641 362
100 3300048913 Ga0496110_0047614 Ga0496110_0047614_873_1961 362
101 3300048914 Ga0496111_0030798 Ga0496111_0030798_883_1971 362
102 3300048915 Ga0496112_0000025 Ga0496112_0000025_129329_130417 362
103 3300049592 Ga0501076_0060633 Ga0501076_0060633_339_1427 362
104 3300050510 nmdc:mga06r32_68141_c1 nmdc:mga06r32_68141_c1_1954_3042 362
105 3300006048 Ga0075363_100004886 Ga0075363_1000048863 366
106 3300028800 Ga0265338_10031763 Ga0265338_100317633 366
107 3300031249 Ga0265339_10003763 Ga0265339_100037631 366
108 3300038443 Ga0395901_0253061 Ga0395901_0253061_113_1213 366
109 3300042876 Ga0451577_0007689 Ga0451577_0007689_6526_7674 366
110 3300044712 Ga0453684_0000055 Ga0453684_0000055_418697_419845 366
111 3300000549 LJQas_1000358 LJQas_10003584 367
112 3300003373 JGI25407J50210_10000948 JGI25407J50210_100009483 367
113 3300003373 JGI25407J50210_10007919 JGI25407J50210_100079192 367
114 3300005334 Ga0068869_100241269 Ga0068869_1002412691 367
115 3300005338 Ga0068868_100000141 Ga0068868_10000014117 367
116 3300005343 Ga0070687_100155368 Ga0070687_1001553681 367
117 3300005344 Ga0070661_100107954 Ga0070661_1001079542 367
118 3300005347 Ga0070668_100012135 Ga0070668_1000121352 367
119 3300005356 Ga0070674_100024535 Ga0070674_1000245353 367
120 3300005364 Ga0070673_100288701 Ga0070673_1002887012 367
121 3300005439 Ga0070711_100036522 Ga0070711_1000365224 367
122 3300005455 Ga0070663_100331843 Ga0070663_1003318431 367
123 3300005457 Ga0070662_100000002 Ga0070662_100000002211 367
124 3300005457 Ga0070662_100005343 Ga0070662_1000053433 367
125 3300005458 Ga0070681_10035341 Ga0070681_100353413 367
126 3300005530 Ga0070679_100000913 Ga0070679_1000009138 367
127 3300005530 Ga0070679_100382822 Ga0070679_1003828221 367
128 3300005535 Ga0070684_100045957 Ga0070684_1000459573 367
129 3300005539 Ga0068853_100102973 Ga0068853_1001029733 367
130 3300005547 Ga0070693_100000470 Ga0070693_1000004706 367
131 3300005548 Ga0070665_100000141 Ga0070665_100000141114 367
132 3300005549 Ga0070704_100147592 Ga0070704_1001475922 367
133 3300005577 Ga0068857_100105622 Ga0068857_1001056222 367
134 3300005614 Ga0068856_100067642 Ga0068856_1000676423 367
135 3300005616 Ga0068852_100095922 Ga0068852_1000959222 367
136 3300005719 Ga0068861_100016618 Ga0068861_1000166184 367
137 3300005841 Ga0068863_100000022 Ga0068863_10000002219 367
138 3300005842 Ga0068858_100000118 Ga0068858_10000011865 367
139 3300005937 Ga0081455_10007865 Ga0081455_100078659 367
140 3300005937 Ga0081455_10062482 Ga0081455_100624822 367
141 3300005937 Ga0081455_10068114 Ga0081455_100681143 367
142 3300005981 Ga0081538_10000211 Ga0081538_1000021119 367
143 3300005981 Ga0081538_10000229 Ga0081538_1000022946 367
144 3300005981 Ga0081538_10000711 Ga0081538_1000071143 367
145 3300005981 Ga0081538_10000812 Ga0081538_1000081219 367
146 3300005981 Ga0081538_10000959 Ga0081538_1000095913 367
147 3300005981 Ga0081538_10001356 Ga0081538_100013563 367
148 3300005981 Ga0081538_10001789 Ga0081538_1000178912 367
149 3300005981 Ga0081538_10004566 Ga0081538_100045665 367
150 3300005981 Ga0081538_10005940 Ga0081538_1000594010 367
151 3300005981 Ga0081538_10008216 Ga0081538_100082163 367
152 3300005981 Ga0081538_10009621 Ga0081538_100096212 367
153 3300005981 Ga0081538_10010366 Ga0081538_100103666 367
154 3300005981 Ga0081538_10012314 Ga0081538_100123144 367
155 3300005981 Ga0081538_10014860 Ga0081538_100148604 367
156 3300005981 Ga0081538_10028841 Ga0081538_100288413 367
157 3300005981 Ga0081538_10031143 Ga0081538_100311432 367
158 3300005983 Ga0081540_1023927 Ga0081540_10239273 367
159 3300005985 Ga0081539_10002507 Ga0081539_1000250711 367
160 3300006038 Ga0075365_10000799 Ga0075365_1000079917 367
161 3300006038 Ga0075365_10009149 Ga0075365_100091497 367
162 3300006038 Ga0075365_10009351 Ga0075365_100093515 367
163 3300006038 Ga0075365_10079938 Ga0075365_100799382 367
164 3300006048 Ga0075363_100082312 Ga0075363_1000823121 367
165 3300006051 Ga0075364_10074444 Ga0075364_100744442 367
166 3300006051 Ga0075364_10104353 Ga0075364_101043532 367
167 3300006058 Ga0075432_10018411 Ga0075432_100184112 367
168 3300006175 Ga0070712_100032671 Ga0070712_1000326713 367
169 3300006178 Ga0075367_10043214 Ga0075367_100432142 367
170 3300006844 Ga0075428_100085797 Ga0075428_1000857973 367
171 3300006844 Ga0075428_100135713 Ga0075428_1001357132 367
172 3300006844 Ga0075428_100151561 Ga0075428_1001515611 367
173 3300006844 Ga0075428_100200433 Ga0075428_1002004332 367
174 3300006844 Ga0075428_100329617 Ga0075428_1003296172 367
175 3300006844 Ga0075428_100382035 Ga0075428_1003820351 367
176 3300006846 Ga0075430_100001083 Ga0075430_10000108310 367
177 3300006846 Ga0075430_100040801 Ga0075430_1000408013 367
178 3300006846 Ga0075430_100170303 Ga0075430_1001703032 367
179 3300006847 Ga0075431_100000197 Ga0075431_10000019711 367
180 3300006847 Ga0075431_100004050 Ga0075431_1000040509 367
181 3300006847 Ga0075431_100004755 Ga0075431_1000047557 367
182 3300006847 Ga0075431_100059877 Ga0075431_1000598773 367
183 3300006847 Ga0075431_100247510 Ga0075431_1002475102 367
184 3300006852 Ga0075433_10013700 Ga0075433_100137003 367
185 3300006852 Ga0075433_10030255 Ga0075433_100302553 367
186 3300006852 Ga0075433_10060052 Ga0075433_100600523 367
187 3300006871 Ga0075434_100025133 Ga0075434_1000251335 367
188 3300006871 Ga0075434_100238051 Ga0075434_1002380512 367
189 3300006880 Ga0075429_100032178 Ga0075429_1000321784 367
190 3300006880 Ga0075429_100063436 Ga0075429_1000634363 367
191 3300007076 Ga0075435_100067772 Ga0075435_1000677723 367
192 3300009094 Ga0111539_10042802 Ga0111539_100428025 367
193 3300009094 Ga0111539_10175528 Ga0111539_101755282 367
194 3300009094 Ga0111539_10232192 Ga0111539_102321921 367
195 3300009094 Ga0111539_10273269 Ga0111539_102732692 367
196 3300009098 Ga0105245_10000517 Ga0105245_1000051711 367
197 3300009098 Ga0105245_10007239 Ga0105245_100072397 367
198 3300009098 Ga0105245_10036834 Ga0105245_100368345 367
199 3300009098 Ga0105245_10037104 Ga0105245_100371042 367
200 3300009147 Ga0114129_10014759 Ga0114129_100147594 367
201 3300009147 Ga0114129_10018964 Ga0114129_100189647 367
202 3300009147 Ga0114129_10022570 Ga0114129_100225706 367
203 3300009147 Ga0114129_10068282 Ga0114129_100682823 367
204 3300009147 Ga0114129_10118100 Ga0114129_101181004 367
205 3300009147 Ga0114129_10172808 Ga0114129_101728083 367
206 3300009147 Ga0114129_10305394 Ga0114129_103053941 367
207 3300009147 Ga0114129_10399312 Ga0114129_103993121 367
208 3300009148 Ga0105243_10113392 Ga0105243_101133922 367
209 3300009176 Ga0105242_10169298 Ga0105242_101692982 367
210 3300009177 Ga0105248_10379187 Ga0105248_103791871 367
211 3300009545 Ga0105237_10157260 Ga0105237_101572602 367
212 3300010375 Ga0105239_10153105 Ga0105239_101531051 367
213 3300013102 Ga0157371_10095763 Ga0157371_100957632 367
214 3300013296 Ga0157374_10076498 Ga0157374_100764983 367
215 3300013297 Ga0157378_10100971 Ga0157378_101009712 367
216 3300013306 Ga0163162_10138796 Ga0163162_101387961 367
217 3300013306 Ga0163162_10235255 Ga0163162_102352552 367
218 3300013307 Ga0157372_10026838 Ga0157372_100268383 367
219 3300013308 Ga0157375_10057452 Ga0157375_100574523 367
220 3300014325 Ga0163163_10487364 Ga0163163_104873641 367
221 3300014968 Ga0157379_10002058 Ga0157379_1000205816 367
222 3300014969 Ga0157376_10096258 Ga0157376_100962583 367
223 3300017792 Ga0163161_10017920 Ga0163161_100179202 367
224 3300020082 Ga0206353_11580202 Ga0206353_115802022 367
225 3300021384 Ga0213876_10066944 Ga0213876_100669443 367
226 3300025912 Ga0207707_10001912 Ga0207707_1000191222 367
227 3300025913 Ga0207695_10078227 Ga0207695_100782275 367
228 3300025914 Ga0207671_10115976 Ga0207671_101159762 367
229 3300025915 Ga0207693_10038017 Ga0207693_100380175 367
230 3300025917 Ga0207660_10146681 Ga0207660_101466811 367
231 3300025918 Ga0207662_10176373 Ga0207662_101763731 367
232 3300025919 Ga0207657_10010289 Ga0207657_1001028910 367
233 3300025921 Ga0207652_10003850 Ga0207652_100038508 367
234 3300025921 Ga0207652_10004774 Ga0207652_1000477414 367
235 3300025924 Ga0207694_10014746 Ga0207694_100147466 367
236 3300025927 Ga0207687_10000085 Ga0207687_1000008558 367
237 3300025927 Ga0207687_10006799 Ga0207687_100067992 367
238 3300025927 Ga0207687_10045229 Ga0207687_100452292 367
239 3300025933 Ga0207706_10000001 Ga0207706_10000001392 367
240 3300025933 Ga0207706_10001392 Ga0207706_1000139211 367
241 3300025937 Ga0207669_10022841 Ga0207669_100228412 367
242 3300025937 Ga0207669_10233304 Ga0207669_102333041 367
243 3300025944 Ga0207661_10011369 Ga0207661_100113691 367
244 3300025972 Ga0207668_10099654 Ga0207668_100996542 367
245 3300026023 Ga0207677_10000397 Ga0207677_1000039732 367
246 3300026035 Ga0207703_10000061 Ga0207703_1000006182 367
247 3300026041 Ga0207639_10042365 Ga0207639_100423652 367
248 3300026075 Ga0207708_10079368 Ga0207708_100793683 367
249 3300026075 Ga0207708_10175306 Ga0207708_101753061 367
250 3300026078 Ga0207702_10009958 Ga0207702_100099585 367
251 3300026078 Ga0207702_10180103 Ga0207702_101801032 367
252 3300026088 Ga0207641_10000016 Ga0207641_10000016140 367
253 3300026089 Ga0207648_10009319 Ga0207648_100093197 367
254 3300026118 Ga0207675_100002675 Ga0207675_1000026752 367
255 3300026118 Ga0207675_100146769 Ga0207675_1001467692 367
256 3300026118 Ga0207675_100304222 Ga0207675_1003042221 367
257 3300026121 Ga0207683_10292820 Ga0207683_102928202 367
258 3300027907 Ga0207428_10047873 Ga0207428_100478732 367
259 3300027907 Ga0207428_10086741 Ga0207428_100867412 367
260 3300028379 Ga0268266_10000056 Ga0268266_10000056121 367
261 3300028800 Ga0265338_10112223 Ga0265338_101122232 367
262 3300031731 Ga0307405_10043760 Ga0307405_100437604 367
263 3300031824 Ga0307413_10038046 Ga0307413_100380462 367
264 3300031852 Ga0307410_10002997 Ga0307410_100029973 367
265 3300031852 Ga0307410_10003343 Ga0307410_100033431 367
266 3300031852 Ga0307410_10009597 Ga0307410_100095976 367
267 3300031901 Ga0307406_10002295 Ga0307406_100022952 367
268 3300031901 Ga0307406_10029226 Ga0307406_100292264 367
269 3300031901 Ga0307406_10090185 Ga0307406_100901852 367
270 3300031903 Ga0307407_10007067 Ga0307407_100070675 367
271 3300031903 Ga0307407_10031499 Ga0307407_100314992 367
272 3300031903 Ga0307407_10083684 Ga0307407_100836841 367
273 3300031903 Ga0307407_10090647 Ga0307407_100906472 367
274 3300031911 Ga0307412_10106984 Ga0307412_101069842 367
275 3300031995 Ga0307409_100006679 Ga0307409_1000066795 367
276 3300031995 Ga0307409_100018000 Ga0307409_1000180002 367
277 3300031995 Ga0307409_100042489 Ga0307409_1000424894 367
278 3300031995 Ga0307409_100077597 Ga0307409_1000775973 367
279 3300032002 Ga0307416_100023041 Ga0307416_1000230416 367
280 3300032002 Ga0307416_100038226 Ga0307416_1000382264 367
281 3300032002 Ga0307416_100158525 Ga0307416_1001585252 367
282 3300032004 Ga0307414_10142424 Ga0307414_101424242 367
283 3300032126 Ga0307415_100170284 Ga0307415_1001702842 367
284 3300035085 Ga0373929_0023013 Ga0373929_0023013_158_1261 367
285 3300035172 Ga0373955_0084341 Ga0373955_0084341_238_1341 367
286 3300035398 Ga0316574_0065365 Ga0316574_0065365_996_2099 367
287 3300036401 Ga0373937_0005521 Ga0373937_0005521_6997_8100 367
288 3300036712 Ga0316584_0041292 Ga0316584_0041292_1199_2302 367
289 3300037418 Ga0395900_0157181 Ga0395900_0157181_809_1912 367
290 3300037418 Ga0395900_0299866 Ga0395900_0299866_278_1381 367
291 3300037466 Ga0395898_0023305 Ga0395898_0023305_3707_4810 367
292 3300037466 Ga0395898_0086927 Ga0395898_0086927_1010_2113 367
293 3300037466 Ga0395898_0173757 Ga0395898_0173757_304_1407 367
294 3300037471 Ga0395905_0058891 Ga0395905_0058891_1137_2240 367
295 3300038443 Ga0395901_0003004 Ga0395901_0003004_8024_9127 367
296 3300038443 Ga0395901_0428877 Ga0395901_0428877_48_1151 367
297 3300038725 Ga0400484_01204 Ga0400484_01204_4306_5415 367
298 3300039437 Ga0436365_0971863 Ga0436365_0971863_1418_2521 367
299 3300039453 Ga0436362_0431055 Ga0436362_0431055_1534_2637 367
300 3300042993 Ga0439440_0020118 Ga0439440_0020118_172_1275 367
301 3300044694 Ga0466963_0000004 Ga0466963_0000004_93118_94221 367
302 3300045976 Ga0466967_0007625 Ga0466967_0007625_3269_4381 367
303 3300045976 Ga0466967_0013953 Ga0466967_0013953_4829_5938 367
304 3300046455 Ga0495603_0009899 Ga0495603_0009899_4545_5648 367
305 3300046461 Ga0495641_0000005 Ga0495641_0000005_123239_124342 367
306 3300046462 Ga0495651_0185851 Ga0495651_0185851_248_1351 367
307 3300046475 Ga0495639_0086529 Ga0495639_0086529_162_1265 367
308 3300046499 Ga0495594_0069986 Ga0495594_0069986_658_1761 367
309 3300046500 Ga0495596_0013564 Ga0495596_0013564_877_1980 367
310 3300046513 Ga0495616_0020158 Ga0495616_0020158_2242_3345 367
311 3300046515 Ga0495620_0001374 Ga0495620_0001374_13308_14411 367
312 3300046518 Ga0495631_0018818 Ga0495631_0018818_394_1497 367
313 3300046529 Ga0495652_0031927 Ga0495652_0031927_591_1694 367
314 3300046535 Ga0495586_0000083 Ga0495586_0000083_14843_15946 367
315 3300046536 Ga0495587_0035754 Ga0495587_0035754_138_1241 367
316 3300046543 Ga0495645_0006168 Ga0495645_0006168_4771_5874 367
317 3300046543 Ga0495645_0084432 Ga0495645_0084432_205_1308 367
318 3300046615 Ga0495656_0003268 Ga0495656_0003268_4205_5308 367
319 3300046642 Ga0495634_0004632 Ga0495634_0004632_7989_9092 367
320 3300046690 Ga0495624_0000019 Ga0495624_0000019_31397_32500 367
321 3300047320 Ga0495672_0021884 Ga0495672_0021884_2518_3621 367
322 3300047320 Ga0495672_0047886 Ga0495672_0047886_1348_2451 367
323 3300047321 Ga0495676_0000238 Ga0495676_0000238_8877_9980 367
324 3300047321 Ga0495676_0123114 Ga0495676_0123114_94_1197 367
325 3300047469 Ga0495673_0014787 Ga0495673_0014787_805_1908 367
326 3300047472 Ga0495686_0000008 Ga0495686_0000008_172569_173672 367
327 3300047472 Ga0495686_0008106 Ga0495686_0008106_20_1126 367
328 3300047472 Ga0495686_0009963 Ga0495686_0009963_132_1235 367
329 3300048088 Ga0495602_0106543 Ga0495602_0106543_349_1452 367
330 3300048904 Ga0496101_0028822 Ga0496101_0028822_141_1244 367
331 3300048905 Ga0496102_0177771 Ga0496102_0177771_213_1316 367
332 3300048907 Ga0496104_0038785 Ga0496104_0038785_812_1915 367
333 3300048909 Ga0496106_0156444 Ga0496106_0156444_637_1740 367
334 3300048910 Ga0496107_0006218 Ga0496107_0006218_865_1968 367
335 3300048911 Ga0496108_0000006 Ga0496108_0000006_409722_410825 367
336 3300048912 Ga0496109_0000009 Ga0496109_0000009_176810_177913 367
337 3300048912 Ga0496109_0195702 Ga0496109_0195702_29_1132 367
338 3300048913 Ga0496110_0066106 Ga0496110_0066106_103_1206 367
339 3300048914 Ga0496111_0025897 Ga0496111_0025897_1201_2304 367
340 3300048915 Ga0496112_0034220 Ga0496112_0034220_164_1267 367
341 3300048918 Ga0496115_0022196 Ga0496115_0022196_3755_4858 367
342 3300049575 Ga0501039_0180630 Ga0501039_0180630_219_1322 367
343 3300049576 Ga0501040_0068603 Ga0501040_0068603_1188_2291 367
344 3300049576 Ga0501040_0077000 Ga0501040_0077000_62_1165 367
345 3300049577 Ga0501041_0022711 Ga0501041_0022711_749_1852 367
346 3300049587 Ga0501071_0222065 Ga0501071_0222065_229_1332 367
347 3300049588 Ga0501072_0017959 Ga0501072_0017959_1794_2897 367
348 3300049588 Ga0501072_0091948 Ga0501072_0091948_270_1373 367
349 3300049588 Ga0501072_0092356 Ga0501072_0092356_1281_2384 367
350 3300049588 Ga0501072_0120839 Ga0501072_0120839_816_1919 367
351 3300049588 Ga0501072_0251367 Ga0501072_0251367_183_1289 367
352 3300049589 Ga0501073_0004161 Ga0501073_0004161_8487_9590 367
353 3300049590 Ga0501074_0055084 Ga0501074_0055084_137_1240 367
354 3300049591 Ga0501075_0048281 Ga0501075_0048281_75_1178 367
355 3300049592 Ga0501076_0050950 Ga0501076_0050950_1069_2172 367
356 3300049592 Ga0501076_0089171 Ga0501076_0089171_185_1288 367
357 3300049593 Ga0501077_0180708 Ga0501077_0180708_180_1283 367
358 3300049741 Ga0501079_0157991 Ga0501079_0157991_197_1300 367
359 3300049741 Ga0501079_0280584 Ga0501079_0280584_38_1141 367
360 3300049741 Ga0501079_0284780 Ga0501079_0284780_17_1120 367
361 3300049742 Ga0501080_0243832 Ga0501080_0243832_321_1424 367
362 3300049743 Ga0501081_0048060 Ga0501081_0048060_22_1125 367
363 3300049743 Ga0501081_0049796 Ga0501081_0049796_318_1421 367
364 3300049743 Ga0501081_0112018 Ga0501081_0112018_516_1619 367
365 3300049824 Ga0501045_0133564 Ga0501045_0133564_640_1743 367
366 3300050492 nmdc:mga0yw44_112811_c1 nmdc:mga0yw44_112811_c1_142_1245 367
367 3300050492 nmdc:mga0yw44_90343_c1 nmdc:mga0yw44_90343_c1_586_1689 367
368 3300050494 nmdc:mga06z11_136327_c1 nmdc:mga06z11_136327_c1_74_1177 367
369 3300050507 nmdc:mga05p37_11239_c1 nmdc:mga05p37_11239_c1_4445_5548 367
370 3300050507 nmdc:mga05p37_117786_c1 nmdc:mga05p37_117786_c1_377_1480 367
371 3300050507 nmdc:mga05p37_125329_c1 nmdc:mga05p37_125329_c1_1611_2714 367
372 3300050507 nmdc:mga05p37_255459_c1 nmdc:mga05p37_255459_c1_407_1510 367
373 3300050507 nmdc:mga05p37_46556_c1 nmdc:mga05p37_46556_c1_2864_3967 367
374 3300050507 nmdc:mga05p37_61160_c1 nmdc:mga05p37_61160_c1_1383_2486 367
375 3300050507 nmdc:mga05p37_65637_c1 nmdc:mga05p37_65637_c1_45_1148 367
376 3300050508 nmdc:mga09592_17415_c1 nmdc:mga09592_17415_c1_444_1547 367
377 3300050509 nmdc:mga0qj67_148359_c1 nmdc:mga0qj67_148359_c1_661_1764 367
378 3300050509 nmdc:mga0qj67_39680_c1 nmdc:mga0qj67_39680_c1_2545_3648 367
379 3300050509 nmdc:mga0qj67_56996_c1 nmdc:mga0qj67_56996_c1_1520_2623 367
380 3300050510 nmdc:mga06r32_1974_c1 nmdc:mga06r32_1974_c1_16379_17482 367
381 3300050510 nmdc:mga06r32_32182_c1 nmdc:mga06r32_32182_c1_1820_2923 367
382 3300050511 nmdc:mga08y16_143948_c1 nmdc:mga08y16_143948_c1_295_1398 367
383 3300050511 nmdc:mga08y16_34091_c1 nmdc:mga08y16_34091_c1_1091_2194 367
384 3300050511 nmdc:mga08y16_6425_c1 nmdc:mga08y16_6425_c1_8601_9704 367
385 3300050512 nmdc:mga0n895_208176_c1 nmdc:mga0n895_208176_c1_521_1624 367
386 3300050512 nmdc:mga0n895_24293_c1 nmdc:mga0n895_24293_c1_289_1392 367
387 3300050512 nmdc:mga0n895_49089_c1 nmdc:mga0n895_49089_c1_1042_2202 367
388 3300050513 nmdc:mga0rr50_16407_c1 nmdc:mga0rr50_16407_c1_605_1708 367
389 3300050513 nmdc:mga0rr50_41374_c1 nmdc:mga0rr50_41374_c1_1155_2258 367
390 3300050515 nmdc:mga0a205_6323_c1 nmdc:mga0a205_6323_c1_2293_3396 367
391 3300050515 nmdc:mga0a205_70671_c1 nmdc:mga0a205_70671_c1_1335_2438 367
392 3300053078 Ga0495612_0039687 Ga0495612_0039687_438_1541 367
393 3300053083 Ga0495655_0013334 Ga0495655_0013334_114_1217 367
394 3300053085 Ga0495619_0002874 Ga0495619_0002874_2537_3640 367
395 3300053123 Ga0500614_000427 Ga0500614_000427_8558_9661 367
396 3300053129 Ga0500628_003881 Ga0500628_003881_35_1138 367
397 3300054114 Ga0501084_0000618 Ga0501084_0000618_22844_23947 367
398 3300054114 Ga0501084_0024940 Ga0501084_0024940_3688_4791 367
399 3300054114 Ga0501084_0094305 Ga0501084_0094305_378_1481 367
400 3300054114 Ga0501084_0137072 Ga0501084_0137072_141_1244 367
401 3300061734 Ga0530510_0006675 Ga0530510_0006675_6051_7154 367
402 3300061734 Ga0530510_0014444 Ga0530510_0014444_218_1321 367

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02073

Peptidase_M29

Thermophilic metalloprotease (M29)

21

384

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ayi-assembly1.cif.gz_A wild-type ampt from thermus thermophilus 0.861 5 367
2ayi-assembly1.cif.gz_A wild-type ampt from thermus thermophilus 0.8501 5 367
1zjc-assembly1.cif.gz_A-2 aminopeptidase s from s. aureus 0.846 5 366
4ics-assembly1.cif.gz_B crystal structure of peps from streptococcus pneumoniae in complex with a substrate 0.8412 5 367
4icq-assembly1.cif.gz_B structural basis for substrate recognition and reaction mechanism of bacterial aminopeptidase peps 0.839 5 367
ID Description Score Start End Superfamily
4icsB01 Alpha Beta;3-Layer(aba) Sandwich;Thermophilic metalloprotease-like;Thermophilic metalloprotease (M29) 0.8759 5 167 3.40.1830.10
1zjcA01 Alpha Beta;3-Layer(aba) Sandwich;Thermophilic metalloprotease-like;Thermophilic metalloprotease (M29) 0.8143 5 160 3.40.1830.10
2ayiA01 Alpha Beta;3-Layer(aba) Sandwich;Thermophilic metalloprotease-like;Thermophilic metalloprotease (M29) 0.7887 5 148 3.40.1830.10
4icsB01 Alpha Beta;3-Layer(aba) Sandwich;Thermophilic metalloprotease-like;Thermophilic metalloprotease (M29) 0.7834 5 167 3.40.1830.10
3chgD02 Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 0.7711 22 62 3.10.105.10
ID Description Score Start End GO Terms
AF-A0A7W1NG46-F1-model_v4 deleted 0.9985 193 366
AF-A0A535U7J3-F1-model_v4 Aminopeptidase 0.997 230 367 GO:0004177
GO:0006508
GO:0046872
AF-A0A7V8Y7T9-F1-model_v4 Aminopeptidase 0.996 202 367 GO:0004177
GO:0006508
GO:0046872
AF-A0A538CLG3-F1-model_v4 Aminopeptidase 0.9955 236 339 GO:0004177
GO:0006508
GO:0046872
AF-A0A2G2J8H0-F1-model_v4 deleted 0.9934 180 367

Feature Viewer

pLDDT pTM Quality
94.67 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map