F435056

General Info

Members Datasets Scaffolds Average Seq Length
402 192 402 408

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10064386|Ga0081539_100643862
Length 410
Sequence VSSGLQHVLPNGLTVAVDPLPGAESVALGLYASVGSRSEPAPLSGLAHLVEHMVFKGAGGRNTRALAEVIEDVGGSLNAWTARDQTVFHGRSLARDLPLVAELIADLVRNPHFDDEHLVREKQVILSELGESIDSPDDLVHDHLFEAAFEGQPIGRPVLGSEQTVRAIARQDCCDWLGQQFVPSRLVLAASGRVDPEAVLRLAEQLFGDMDPVGAPPIEPARFTGGVRNDRRSFEQAHWCLAYEGVPAADAGNPALAMFVQALGGGTSSRLFQELREERGLAYSVYAWNQAFADVGVVGIGCAAERARAAESVELAREVLAATVEGLTEAELSRARAQMEAGLLMSLETAQGRADSMARSIEVFGRILSLAELLEQIRAVTVEDARNTGGTLLKGPVAVASVGAKLALAA

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
78 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
80 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
141 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
142 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
143 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
144 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
160 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
179 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
183 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
184 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
185 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
186 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
190 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
191 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.49
Nodule 0
Rhizoplane 5.22
Rhizosphere 89.55
Stem 0
Stem Tuber 0
Unclassified 2.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10000913 3300001990 Bacteria 10487
2 JGI24737J22298_10004604 3300001990 Bacteria 4799
3 JGI24735J21928_10002162 3300002067 Bacteria 6899
4 JGI24735J21928_10009776 3300002067 Bacteria 3072
5 JGI24735J21928_10011796 3300002067 Bacteria 2767
6 JGI24738J21930_10000874 3300002075 Bacteria 8628
7 JGI25165J46597_1000040 3300003214 Bacteria 277491
8 rootH2_10037212 3300003320 Bacteria 3951
9 rootL2_10058497 3300003322 Bacteria 5386
10 rootH1_10008770 3300003323 Bacteria 8102
11 Ga0055542_1006095 3300003762 Bacteria 2624
12 Ga0070658_10016096 3300005327 Bacteria 5981
13 Ga0070658_10017721 3300005327 Bacteria 5696
14 Ga0070658_10019863 3300005327 Bacteria 5382
15 Ga0070658_10032345 3300005327 Bacteria 4206
16 Ga0070658_10064035 3300005327 Bacteria 2998
17 Ga0070658_10212764 3300005327 Bacteria 1633
18 Ga0070676_10000328 3300005328 Bacteria 21565
19 Ga0070676_10118537 3300005328 Bacteria 1658
20 Ga0070690_100009956 3300005330 Bacteria 5516
21 Ga0070690_100019031 3300005330 Bacteria 4159
22 Ga0070670_100020418 3300005331 Bacteria 5695
23 Ga0070670_100163189 3300005331 Bacteria 1931
24 Ga0068869_100001394 3300005334 Bacteria 14273
25 Ga0070666_10006211 3300005335 Bacteria 7350
26 Ga0070666_10047834 3300005335 Bacteria 2872
27 Ga0070666_10057762 3300005335 Bacteria 2622
28 Ga0070666_10059971 3300005335 Bacteria 2574
29 Ga0068868_100000594 3300005338 Bacteria 24323
30 Ga0068868_100002917 3300005338 Bacteria 11871
31 Ga0070660_100000297 3300005339 Bacteria 33169
32 Ga0070660_100011244 3300005339 Bacteria 6353
33 Ga0070660_100012473 3300005339 Bacteria 6070
34 Ga0070660_100024355 3300005339 Bacteria 4489
35 Ga0070660_100086114 3300005339 Bacteria 2472
36 Ga0070660_100096414 3300005339 Bacteria 2339
37 Ga0070660_100112325 3300005339 Bacteria 2169
38 Ga0070661_100015300 3300005344 Bacteria 5414
39 Ga0070668_100016654 3300005347 Bacteria 5495
40 Ga0070675_100011322 3300005354 Bacteria 6981
41 Ga0070671_100069212 3300005355 Bacteria 2944
42 Ga0070671_100085726 3300005355 Bacteria 2635
43 Ga0070671_100087416 3300005355 Bacteria 2608
44 Ga0070671_100098310 3300005355 Bacteria 2455
45 Ga0070671_100267723 3300005355 Bacteria 1452
46 Ga0070674_100003944 3300005356 Bacteria 8403
47 Ga0070673_100000009 3300005364 Bacteria 155005
48 Ga0070673_100106228 3300005364 Bacteria 2321
49 Ga0070673_100228154 3300005364 Bacteria 1615
50 Ga0070659_100060171 3300005366 Bacteria 3000
51 Ga0070659_100118121 3300005366 Bacteria 2145
52 Ga0070667_100124053 3300005367 Bacteria 2249
53 Ga0070667_100270625 3300005367 Bacteria 1523
54 Ga0070714_100003924 3300005435 Bacteria 11182
55 Ga0070713_100006462 3300005436 Bacteria 8128
56 Ga0070713_100016373 3300005436 Bacteria 5574
57 Ga0070713_100031313 3300005436 Bacteria 4236
58 Ga0070663_100001889 3300005455 Bacteria 11696
59 Ga0070678_100014590 3300005456 Bacteria 4965
60 Ga0070678_100015610 3300005456 Bacteria 4833
61 Ga0070678_100045757 3300005456 Bacteria 3133
62 Ga0070662_100007521 3300005457 Bacteria 7065
63 Ga0070662_100009573 3300005457 Bacteria 6340
64 Ga0070662_100021118 3300005457 Bacteria 4443
65 Ga0070662_100044680 3300005457 Bacteria 3174
66 Ga0070662_100154455 3300005457 Bacteria 1790
67 Ga0068867_100000002 3300005459 Bacteria 247206
68 Ga0070679_100057515 3300005530 Bacteria 3876
69 Ga0070679_100359741 3300005530 Bacteria 1403
70 Ga0070684_100014407 3300005535 Bacteria 6407
71 Ga0068853_100042395 3300005539 Bacteria 3891
72 Ga0068853_100094589 3300005539 Bacteria 2633
73 Ga0068853_100204586 3300005539 Bacteria 1797
74 Ga0070672_100008763 3300005543 Bacteria 6942
75 Ga0070672_100028586 3300005543 Bacteria 4172
76 Ga0070672_100186312 3300005543 Bacteria 1731
77 Ga0070695_100095557 3300005545 Bacteria 1992
78 Ga0070696_100224131 3300005546 Bacteria 1412
79 Ga0068855_100000085 3300005563 Bacteria 112108
80 Ga0068855_100024414 3300005563 Bacteria 7232
81 Ga0068855_100099838 3300005563 Bacteria 3343
82 Ga0068855_100340461 3300005563 Bacteria 1654
83 Ga0070664_100050397 3300005564 Bacteria 3523
84 Ga0070664_100055510 3300005564 Bacteria 3363
85 Ga0070664_100071046 3300005564 Bacteria 2982
86 Ga0068857_100000489 3300005577 Bacteria 28341
87 Ga0068857_100045399 3300005577 Bacteria 3898
88 Ga0068857_100056681 3300005577 Bacteria 3477
89 Ga0068857_100181077 3300005577 Bacteria 1918
90 Ga0068854_100004970 3300005578 Bacteria 8383
91 Ga0068854_100014935 3300005578 Bacteria 5129
92 Ga0068856_100010923 3300005614 Bacteria 8812
93 Ga0068856_100187969 3300005614 Bacteria 2079
94 Ga0068856_100262524 3300005614 Bacteria 1742
95 Ga0068852_100005346 3300005616 Bacteria 9172
96 Ga0068852_100046036 3300005616 Bacteria 3714
97 Ga0068852_100049863 3300005616 Bacteria 3584
98 Ga0068852_100265249 3300005616 Bacteria 1650
99 Ga0068859_100009808 3300005617 Bacteria 9671
100 Ga0068864_100020011 3300005618 Bacteria 5596
101 Ga0068864_100079811 3300005618 Bacteria 2866
102 Ga0068864_100095088 3300005618 Bacteria 2635
103 Ga0068864_100107432 3300005618 Bacteria 2482
104 Ga0068866_10031568 3300005718 Bacteria 2553
105 Ga0068863_100016153 3300005841 Bacteria 7161
106 Ga0068863_100036296 3300005841 Bacteria 4695
107 Ga0068858_100025351 3300005842 Bacteria 5518
108 Ga0068858_100041282 3300005842 Bacteria 4278
109 Ga0068860_100100112 3300005843 Bacteria 2765
110 Ga0081539_10064386 3300005985 Bacteria 1995
111 Ga0070717_10003717 3300006028 Bacteria 10962
112 Ga0097621_100017939 3300006237 Bacteria 5391
113 Ga0097621_100027033 3300006237 Bacteria 4508
114 Ga0097621_100266144 3300006237 Bacteria 1505
115 Ga0068865_100000014 3300006881 Bacteria 138727
116 Ga0068865_100004123 3300006881 Bacteria 8738
117 Ga0068865_100152563 3300006881 Bacteria 1754
118 Ga0097620_100009808 3300006931 Bacteria 9671
119 Ga0105240_10067509 3300009093 Bacteria 4432
120 Ga0105240_10264610 3300009093 Bacteria 1982
121 Ga0105240_10265161 3300009093 Bacteria 1980
122 Ga0111539_10154249 3300009094 Bacteria 2688
123 Ga0105245_10002000 3300009098 Bacteria 18502
124 Ga0105245_10038005 3300009098 Bacteria 4282
125 Ga0105245_10044701 3300009098 Bacteria 3954
126 Ga0105243_10001563 3300009148 Bacteria 20006
127 Ga0105242_10002690 3300009176 Bacteria 13904
128 Ga0105242_10059728 3300009176 Bacteria 3130
129 Ga0105248_10023597 3300009177 Bacteria 6833
130 Ga0105248_10023730 3300009177 Bacteria 6816
131 Ga0105248_10134815 3300009177 Bacteria 2786
132 Ga0105238_10007923 3300009551 Bacteria 10631
133 Ga0105249_10017644 3300009553 Bacteria 6338
134 Ga0105239_10034384 3300010375 Bacteria 5566
135 Ga0157373_10093248 3300013100 Bacteria 2121
136 Ga0157371_10171372 3300013102 Bacteria 1551
137 Ga0157370_10000189 3300013104 Bacteria 77032
138 Ga0157369_10006976 3300013105 Bacteria 13029
139 Ga0157369_10042544 3300013105 Bacteria 4955
140 Ga0157374_10145808 3300013296 Bacteria 2299
141 Ga0157374_10171385 3300013296 Bacteria 2117
142 Ga0157378_10000484 3300013297 Bacteria 37864
143 Ga0157378_10080926 3300013297 Bacteria 2935
144 Ga0157372_10008768 3300013307 Bacteria 10739
145 Ga0157372_10009862 3300013307 Bacteria 10156
146 Ga0157375_10002582 3300013308 Bacteria 15728
147 Ga0157375_10123863 3300013308 Bacteria 2697
148 Ga0163163_10195392 3300014325 Bacteria 2071
149 Ga0157377_10007809 3300014745 Bacteria 5184
150 Ga0157379_10044813 3300014968 Bacteria 3948
151 Ga0157379_10217354 3300014968 Bacteria 1731
152 Ga0157376_10000134 3300014969 Bacteria 51135
153 Ga0157376_10009190 3300014969 Bacteria 7170
154 Ga0163161_10035725 3300017792 Bacteria 3557
155 Ga0163161_10039629 3300017792 Bacteria 3383
156 Ga0207427_102516 3300025231 Bacteria 4860
157 Ga0209026_1003011 3300025250 Bacteria 5813
158 Ga0209148_1000147 3300025254 Bacteria 160231
159 Ga0209148_1001532 3300025254 Bacteria 11278
160 Ga0209233_1000003 3300025261 Bacteria 1607366
161 Ga0209455_1000472 3300025272 Bacteria 30155
162 Ga0207688_10011183 3300025901 Bacteria 4887
163 Ga0207680_10001446 3300025903 Bacteria 11267
164 Ga0207680_10108381 3300025903 Bacteria 1797
165 Ga0207647_10000783 3300025904 Bacteria 24687
166 Ga0207647_10000998 3300025904 Bacteria 21937
167 Ga0207647_10116334 3300025904 Bacteria 1578
168 Ga0207645_10000959 3300025907 Bacteria 23874
169 Ga0207705_10000042 3300025909 Bacteria 182120
170 Ga0207705_10003743 3300025909 Bacteria 11585
171 Ga0207705_10009986 3300025909 Bacteria 6910
172 Ga0207705_10026009 3300025909 Bacteria 4176
173 Ga0207705_10043007 3300025909 Bacteria 3244
174 Ga0207705_10052347 3300025909 Bacteria 2939
175 Ga0207705_10135830 3300025909 Bacteria 1833
176 Ga0207705_10159497 3300025909 Bacteria 1694
177 Ga0207695_10023302 3300025913 Bacteria 7000
178 Ga0207695_10149606 3300025913 Bacteria 2275
179 Ga0207671_10098968 3300025914 Bacteria 2206
180 Ga0207693_10027346 3300025915 Bacteria 4510
181 Ga0207657_10002905 3300025919 Bacteria 18392
182 Ga0207657_10008305 3300025919 Bacteria 10562
183 Ga0207657_10009638 3300025919 Bacteria 9691
184 Ga0207657_10014579 3300025919 Bacteria 7661
185 Ga0207657_10016949 3300025919 Bacteria 7008
186 Ga0207657_10024747 3300025919 Bacteria 5550
187 Ga0207657_10113147 3300025919 Bacteria 2239
188 Ga0207657_10185314 3300025919 Bacteria 1681
189 Ga0207649_10034981 3300025920 Bacteria 3015
190 Ga0207649_10167726 3300025920 Bacteria 1527
191 Ga0207652_10063613 3300025921 Bacteria 3191
192 Ga0207659_10168564 3300025926 Bacteria 1726
193 Ga0207687_10002886 3300025927 Bacteria 11671
194 Ga0207687_10017483 3300025927 Bacteria 4722
195 Ga0207700_10029130 3300025928 Bacteria 3893
196 Ga0207700_10130396 3300025928 Bacteria 2052
197 Ga0207664_10032740 3300025929 Bacteria 3987
198 Ga0207644_10001636 3300025931 Bacteria 14430
199 Ga0207644_10002510 3300025931 Bacteria 11811
200 Ga0207644_10036172 3300025931 Bacteria 3464
201 Ga0207644_10039591 3300025931 Bacteria 3328
202 Ga0207644_10071448 3300025931 Bacteria 2539
203 Ga0207644_10076975 3300025931 Bacteria 2456
204 Ga0207690_10004814 3300025932 Bacteria 7964
205 Ga0207690_10072248 3300025932 Bacteria 2383
206 Ga0207690_10089391 3300025932 Bacteria 2172
207 Ga0207706_10008631 3300025933 Bacteria 9389
208 Ga0207706_10013494 3300025933 Bacteria 7424
209 Ga0207706_10016069 3300025933 Bacteria 6765
210 Ga0207706_10025002 3300025933 Bacteria 5355
211 Ga0207706_10025331 3300025933 Bacteria 5316
212 Ga0207706_10029705 3300025933 Bacteria 4879
213 Ga0207706_10095766 3300025933 Bacteria 2611
214 Ga0207709_10000066 3300025935 Bacteria 189194
215 Ga0207669_10012519 3300025937 Bacteria 4175
216 Ga0207669_10016923 3300025937 Bacteria 3724
217 Ga0207704_10000002 3300025938 Bacteria 303025
218 Ga0207704_10000007 3300025938 Bacteria 211230
219 Ga0207704_10024526 3300025938 Bacteria 3273
220 Ga0207665_10018746 3300025939 Bacteria 4548
221 Ga0207691_10012138 3300025940 Bacteria 8259
222 Ga0207691_10041934 3300025940 Bacteria 4221
223 Ga0207691_10244937 3300025940 Bacteria 1549
224 Ga0207711_10003505 3300025941 Bacteria 13589
225 Ga0207711_10069183 3300025941 Bacteria 3059
226 Ga0207711_10118968 3300025941 Bacteria 2357
227 Ga0207689_10002123 3300025942 Bacteria 18648
228 Ga0207661_10001582 3300025944 Bacteria 15492
229 Ga0207679_10055450 3300025945 Bacteria 2921
230 Ga0207667_10000017 3300025949 Bacteria 390654
231 Ga0207667_10017327 3300025949 Bacteria 8111
232 Ga0207667_10114922 3300025949 Bacteria 2774
233 Ga0207651_10000004 3300025960 Bacteria 290191
234 Ga0207651_10016809 3300025960 Bacteria 4300
235 Ga0207651_10030292 3300025960 Bacteria 3443
236 Ga0207712_10027374 3300025961 Bacteria 3806
237 Ga0207668_10010244 3300025972 Bacteria 5659
238 Ga0207640_10010788 3300025981 Bacteria 5155
239 Ga0207658_10007456 3300025986 Bacteria 7455
240 Ga0207677_10000060 3300026023 Bacteria 93186
241 Ga0207677_10002385 3300026023 Bacteria 9839
242 Ga0207703_10007259 3300026035 Bacteria 8812
243 Ga0207639_10023875 3300026041 Bacteria 4419
244 Ga0207678_10009201 3300026067 Bacteria 8696
245 Ga0207702_10004093 3300026078 Bacteria 13084
246 Ga0207702_10052009 3300026078 Bacteria 3464
247 Ga0207641_10046769 3300026088 Bacteria 3648
248 Ga0207648_10000003 3300026089 Bacteria 289983
249 Ga0207648_10024720 3300026089 Bacteria 5358
250 Ga0207648_10200641 3300026089 Bacteria 1769
251 Ga0207676_10010867 3300026095 Bacteria 6494
252 Ga0207676_10050724 3300026095 Bacteria 3237
253 Ga0207676_10168231 3300026095 Bacteria 1907
254 Ga0207674_10001507 3300026116 Bacteria 30052
255 Ga0207674_10003897 3300026116 Bacteria 18153
256 Ga0207674_10006500 3300026116 Bacteria 13741
257 Ga0207683_10062474 3300026121 Bacteria 3280
258 Ga0207683_10134893 3300026121 Bacteria 2222
259 Ga0207698_10008243 3300026142 Bacteria 6578
260 Ga0207698_10264972 3300026142 Bacteria 1581
261 Ga0307405_10041480 3300031731 Bacteria 2795
262 Ga0307410_10002317 3300031852 Bacteria 9147
263 Ga0307410_10017727 3300031852 Bacteria 4284
264 Ga0307410_10073353 3300031852 Bacteria 2379
265 Ga0307409_100143562 3300031995 Bacteria 2061
266 Ga0307414_10074900 3300032004 Bacteria 2454
267 Ga0307411_10022197 3300032005 Bacteria 3732
268 Ga0307411_10071884 3300032005 Bacteria 2347
269 Ga0307415_100014070 3300032126 Bacteria 4691
270 Ga0373935_0007283 3300035692 Bacteria 6613
271 Ga0373947_0017985 3300035725 Bacteria 4067
272 Ga0373925_0011242 3300037068 Bacteria 6493
273 Ga0395899_0000669 3300037312 Bacteria 34717
274 Ga0395899_0001118 3300037312 Bacteria 23973
275 Ga0395899_0015353 3300037312 Bacteria 5837
276 Ga0395899_0016569 3300037312 Bacteria 5621
277 Ga0395899_0020519 3300037312 Bacteria 5009
278 Ga0395899_0024800 3300037312 Bacteria 4531
279 Ga0395900_0001777 3300037418 Bacteria 24746
280 Ga0395900_0003481 3300037418 Bacteria 16989
281 Ga0395900_0003962 3300037418 Bacteria 15801
282 Ga0395900_0004070 3300037418 Bacteria 15596
283 Ga0395900_0021752 3300037418 Bacteria 6557
284 Ga0395900_0048043 3300037418 Bacteria 4395
285 Ga0395900_0048748 3300037418 Bacteria 4363
286 Ga0395900_0062389 3300037418 Bacteria 3831
287 Ga0395900_0115398 3300037418 Bacteria 2755
288 Ga0395900_0133180 3300037418 Bacteria 2547
289 Ga0395898_0000315 3300037466 Bacteria 111811
290 Ga0395898_0040047 3300037466 Bacteria 4636
291 Ga0395898_0043539 3300037466 Bacteria 4423
292 Ga0395905_0000005 3300037471 Bacteria 557808
293 Ga0395905_0000038 3300037471 Bacteria 253600
294 Ga0395905_0002727 3300037471 Bacteria 19339
295 Ga0395905_0003864 3300037471 Bacteria 15805
296 Ga0395905_0016116 3300037471 Bacteria 7104
297 Ga0395905_0016985 3300037471 Bacteria 6910
298 Ga0395905_0019970 3300037471 Bacteria 6349
299 Ga0395905_0027543 3300037471 Bacteria 5359
300 Ga0395905_0033834 3300037471 Bacteria 4800
301 Ga0395905_0035511 3300037471 Bacteria 4681
302 Ga0395905_0054973 3300037471 Bacteria 3725
303 Ga0395905_0067197 3300037471 Bacteria 3358
304 Ga0395905_0068293 3300037471 Bacteria 3329
305 Ga0395905_0072927 3300037471 Bacteria 3218
306 Ga0395905_0103622 3300037471 Bacteria 2671
307 Ga0395905_0156061 3300037471 Bacteria 2147
308 Ga0436364_1387927 3300037853 Bacteria 27679
309 Ga0395901_0001728 3300038443 Bacteria 22552
310 Ga0395901_0002455 3300038443 Bacteria 18800
311 Ga0395901_0002700 3300038443 Bacteria 17881
312 Ga0395901_0017319 3300038443 Bacteria 7355
313 Ga0395901_0033979 3300038443 Bacteria 5265
314 Ga0395901_0041896 3300038443 Bacteria 4746
315 Ga0395901_0045829 3300038443 Bacteria 4540
316 Ga0395901_0203777 3300038443 Bacteria 2073
317 Ga0439448_0002361 3300042005 Bacteria 5121
318 Ga0439448_0003717 3300042005 Bacteria 4250
319 Ga0439455_0000390 3300042012 Bacteria 5784
320 Ga0439455_0005269 3300042012 Bacteria 2615
321 Ga0450889_001319 3300042144 Bacteria 2566
322 Ga0439458_0000709 3300042157 Bacteria 8609
323 Ga0439458_0000816 3300042157 Bacteria 8017
324 Ga0439458_0023382 3300042157 Bacteria 1441
325 Ga0439434_0023498 3300042435 Bacteria 1857
326 Ga0466966_0000050 3300044684 Bacteria 88948
327 Ga0466966_0092516 3300044684 Bacteria 1876
328 Ga0466961_0006099 3300044693 Bacteria 7648
329 Ga0466961_0036169 3300044693 Bacteria 3169
330 Ga0466961_0075259 3300044693 Bacteria 2140
331 Ga0466961_0075413 3300044693 Bacteria 2138
332 Ga0466963_0012597 3300044694 Bacteria 5180
333 Ga0466963_0019901 3300044694 Bacteria 4216
334 Ga0466963_0031843 3300044694 Bacteria 3410
335 Ga0466971_0003659 3300044719 Bacteria 6575
336 Ga0466971_0024077 3300044719 Bacteria 2715
337 Ga0466971_0055775 3300044719 Bacteria 1782
338 Ga0466970_0097140 3300044765 Bacteria 1602
339 Ga0466970_0117095 3300044765 Bacteria 1457
340 Ga0466957_0022499 3300044842 Bacteria 3720
341 Ga0466957_0037847 3300044842 Bacteria 2905
342 Ga0466957_0047644 3300044842 Bacteria 2604
343 Ga0466957_0104751 3300044842 Bacteria 1787
344 Ga0466959_0000255 3300045049 Bacteria 32739
345 Ga0466959_0131514 3300045049 Bacteria 1773
346 Ga0466958_0001920 3300045836 Bacteria 10169
347 Ga0466958_0008603 3300045836 Bacteria 5666
348 Ga0466958_0215199 3300045836 Bacteria 1225
349 Ga0466967_0044220 3300045976 Bacteria 3861
350 Ga0466967_0068324 3300045976 Bacteria 3173
351 Ga0466967_0106601 3300045976 Bacteria 2569
352 Ga0466967_0274372 3300045976 Bacteria 1616
353 Ga0495583_0000175 3300046506 Bacteria 108912
354 Ga0495668_0027367 3300046616 Bacteria 3231
355 Ga0495611_0050466 3300046648 Bacteria 1874
356 Ga0495669_0007454 3300046684 Bacteria 4588
357 Ga0495669_0030453 3300046684 Bacteria 2369
358 Ga0495670_0020063 3300046691 Bacteria 3294
359 Ga0495677_0050720 3300047445 Bacteria 1527
360 Ga0495673_0011678 3300047469 Bacteria 4708
361 Ga0495686_0001271 3300047472 Bacteria 28583
362 Ga0496101_0013702 3300048904 Bacteria 5437
363 Ga0496101_0168033 3300048904 Bacteria 1685
364 Ga0496102_0140848 3300048905 Bacteria 2261
365 Ga0496103_0034513 3300048906 Bacteria 3094
366 Ga0496104_0090296 3300048907 Bacteria 2927
367 Ga0496106_0026326 3300048909 Bacteria 4330
368 Ga0496107_0057182 3300048910 Bacteria 2819
369 Ga0496107_0172241 3300048910 Bacteria 1606
370 Ga0496108_0059840 3300048911 Bacteria 3203
371 Ga0496109_0148011 3300048912 Bacteria 2197
372 Ga0496110_0002065 3300048913 Bacteria 14971
373 Ga0496110_0061595 3300048913 Bacteria 3312
374 Ga0496111_0006386 3300048914 Bacteria 7650
375 Ga0496111_0016078 3300048914 Bacteria 5151
376 Ga0496112_0009336 3300048915 Bacteria 8829
377 Ga0496112_0026946 3300048915 Bacteria 5539
378 Ga0496112_0090453 3300048915 Bacteria 3029
379 Ga0496113_0005469 3300048916 Bacteria 7925
380 Ga0496113_0016450 3300048916 Bacteria 5110
381 Ga0496114_0000029 3300048917 Bacteria 175132
382 Ga0496115_0004329 3300048918 Bacteria 10274
383 Ga0496117_0056834 3300048920 Bacteria 2722
384 Ga0496118_0116361 3300048921 Bacteria 1757
385 Ga0496119_0076957 3300048922 Bacteria 1934
386 Ga0496120_0022633 3300048923 Bacteria 3951
387 Ga0496121_0012810 3300048924 Bacteria 9079
388 Ga0496125_0007578 3300048928 Bacteria 11526
389 Ga0495682_0006765 3300049460 Bacteria 4622
390 Ga0501216_005193 3300049660 Bacteria 1953
391 Ga0501233_024055 3300049668 Bacteria 1329
392 Ga0501234_003709 3300049707 Bacteria 2401
393 Ga0501268_001449 3300049765 Bacteria 2961
394 Ga0501035_0027290 3300049822 Bacteria 5219
395 Ga0501035_0145735 3300049822 Bacteria 2057
396 nmdc:mga09592_113571_c1 3300050508 Bacteria 2324
397 Ga0500555_001348 3300053103 Bacteria 7686
398 Ga0500559_0058756 3300053136 Bacteria 1711
399 Ga0500616_0015170 3300053153 Bacteria 4411
400 Ga0466962_0001497 3300061719 Bacteria 10902
401 Ga0466962_0005843 3300061719 Bacteria 5913
402 Ga0466962_0009093 3300061719 Bacteria 4758

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0067197 Ga0395905_0067197_12_1088 351
2 3300042157 Ga0439458_0023382 Ga0439458_0023382_256_1332 357
3 3300044694 Ga0466963_0012597 Ga0466963_0012597_1965_3050 360
4 3300044765 Ga0466970_0097140 Ga0466970_0097140_464_1552 361
5 3300045836 Ga0466958_0215199 Ga0466958_0215199_36_1124 361
6 3300044684 Ga0466966_0092516 Ga0466966_0092516_645_1796 382
7 3300025938 Ga0207704_10000002 Ga0207704_1000000290 383
8 3300025938 Ga0207704_10000007 Ga0207704_1000000790 383
9 3300009093 Ga0105240_10067509 Ga0105240_100675092 385
10 3300025909 Ga0207705_10000042 Ga0207705_1000004221 386
11 3300013307 Ga0157372_10009862 Ga0157372_1000986210 387
12 3300042435 Ga0439434_0023498 Ga0439434_0023498_208_1437 389
13 3300005339 Ga0070660_100096414 Ga0070660_1000964142 396
14 3300025919 Ga0207657_10185314 Ga0207657_101853142 396
15 3300005347 Ga0070668_100016654 Ga0070668_1000166544 399
16 3300025972 Ga0207668_10010244 Ga0207668_100102442 399
17 3300048922 Ga0496119_0076957 Ga0496119_0076957_434_1663 401
18 3300048923 Ga0496120_0022633 Ga0496120_0022633_486_1715 401
19 3300048928 Ga0496125_0007578 Ga0496125_0007578_9800_11029 401
20 3300053153 Ga0500616_0015170 Ga0500616_0015170_3129_4337 401
21 3300003323 rootH1_10008770 rootH1_100087707 402
22 3300005455 Ga0070663_100001889 Ga0070663_10000188911 402
23 3300005563 Ga0068855_100000085 Ga0068855_10000008596 402
24 3300005578 Ga0068854_100004970 Ga0068854_1000049706 402
25 3300005578 Ga0068854_100014935 Ga0068854_1000149352 402
26 3300006237 Ga0097621_100017939 Ga0097621_1000179392 402
27 3300010375 Ga0105239_10034384 Ga0105239_100343842 402
28 3300025949 Ga0207667_10000017 Ga0207667_10000017169 402
29 3300025981 Ga0207640_10010788 Ga0207640_100107886 402
30 3300026067 Ga0207678_10009201 Ga0207678_100092016 402
31 3300005539 Ga0068853_100094589 Ga0068853_1000945892 403
32 3300005563 Ga0068855_100024414 Ga0068855_1000244142 403
33 3300005577 Ga0068857_100045399 Ga0068857_1000453992 403
34 3300005614 Ga0068856_100187969 Ga0068856_1001879692 403
35 3300025913 Ga0207695_10023302 Ga0207695_100233029 403
36 3300025949 Ga0207667_10017327 Ga0207667_100173279 403
37 3300026078 Ga0207702_10052009 Ga0207702_100520092 403
38 3300042005 Ga0439448_0002361 Ga0439448_0002361_341_1570 403
39 3300042012 Ga0439455_0000390 Ga0439455_0000390_2809_4038 403
40 3300042157 Ga0439458_0000709 Ga0439458_0000709_1291_2520 403
41 3300044684 Ga0466966_0000050 Ga0466966_0000050_13310_14554 403
42 3300044693 Ga0466961_0006099 Ga0466961_0006099_1121_2365 403
43 3300044719 Ga0466971_0024077 Ga0466971_0024077_865_2109 403
44 3300044765 Ga0466970_0117095 Ga0466970_0117095_141_1385 403
45 3300045049 Ga0466959_0000255 Ga0466959_0000255_23968_25212 403
46 3300045836 Ga0466958_0001920 Ga0466958_0001920_8474_9718 403
47 3300061719 Ga0466962_0001497 Ga0466962_0001497_6033_7277 403
48 3300005330 Ga0070690_100009956 Ga0070690_1000099568 404
49 3300005335 Ga0070666_10006211 Ga0070666_100062118 404
50 3300005355 Ga0070671_100087416 Ga0070671_1000874162 404
51 3300005356 Ga0070674_100003944 Ga0070674_1000039448 404
52 3300005842 Ga0068858_100025351 Ga0068858_1000253514 404
53 3300005843 Ga0068860_100100112 Ga0068860_1001001123 404
54 3300009177 Ga0105248_10134815 Ga0105248_101348152 404
55 3300025903 Ga0207680_10001446 Ga0207680_1000144611 404
56 3300025931 Ga0207644_10071448 Ga0207644_100714482 404
57 3300025937 Ga0207669_10016923 Ga0207669_100169234 404
58 3300025941 Ga0207711_10069183 Ga0207711_100691833 404
59 3300025960 Ga0207651_10030292 Ga0207651_100302924 404
60 3300026035 Ga0207703_10007259 Ga0207703_100072598 404
61 3300037471 Ga0395905_0072927 Ga0395905_0072927_29_1246 404
62 3300045976 Ga0466967_0044220 Ga0466967_0044220_19_1236 404
63 3300046684 Ga0495669_0030453 Ga0495669_0030453_426_1643 404
64 3300048904 Ga0496101_0168033 Ga0496101_0168033_203_1420 404
65 3300048910 Ga0496107_0172241 Ga0496107_0172241_285_1502 404
66 3300048912 Ga0496109_0148011 Ga0496109_0148011_969_2186 404
67 3300048913 Ga0496110_0061595 Ga0496110_0061595_1128_2345 404
68 3300048914 Ga0496111_0006386 Ga0496111_0006386_4203_5420 404
69 3300048915 Ga0496112_0090453 Ga0496112_0090453_853_2070 404
70 3300048916 Ga0496113_0005469 Ga0496113_0005469_3721_4938 404
71 3300048918 Ga0496115_0004329 Ga0496115_0004329_416_1633 404
72 3300044842 Ga0466957_0037847 Ga0466957_0037847_858_2087 407
73 3300001990 JGI24737J22298_10000913 JGI24737J22298_100009132 408
74 3300001990 JGI24737J22298_10004604 JGI24737J22298_100046047 408
75 3300002067 JGI24735J21928_10002162 JGI24735J21928_100021629 408
76 3300002067 JGI24735J21928_10009776 JGI24735J21928_100097763 408
77 3300002067 JGI24735J21928_10011796 JGI24735J21928_100117962 408
78 3300002075 JGI24738J21930_10000874 JGI24738J21930_1000087410 408
79 3300003214 JGI25165J46597_1000040 JGI25165J46597_1000040178 408
80 3300003320 rootH2_10037212 rootH2_100372124 408
81 3300003322 rootL2_10058497 rootL2_100584973 408
82 3300003762 Ga0055542_1006095 Ga0055542_10060952 408
83 3300005327 Ga0070658_10016096 Ga0070658_100160966 408
84 3300005327 Ga0070658_10017721 Ga0070658_100177217 408
85 3300005327 Ga0070658_10019863 Ga0070658_100198636 408
86 3300005327 Ga0070658_10032345 Ga0070658_100323454 408
87 3300005327 Ga0070658_10064035 Ga0070658_100640354 408
88 3300005327 Ga0070658_10212764 Ga0070658_102127642 408
89 3300005328 Ga0070676_10000328 Ga0070676_1000032820 408
90 3300005328 Ga0070676_10118537 Ga0070676_101185372 408
91 3300005330 Ga0070690_100019031 Ga0070690_1000190316 408
92 3300005331 Ga0070670_100020418 Ga0070670_1000204187 408
93 3300005331 Ga0070670_100163189 Ga0070670_1001631892 408
94 3300005334 Ga0068869_100001394 Ga0068869_10000139410 408
95 3300005335 Ga0070666_10047834 Ga0070666_100478342 408
96 3300005335 Ga0070666_10057762 Ga0070666_100577622 408
97 3300005335 Ga0070666_10059971 Ga0070666_100599713 408
98 3300005338 Ga0068868_100000594 Ga0068868_10000059411 408
99 3300005338 Ga0068868_100002917 Ga0068868_10000291712 408
100 3300005339 Ga0070660_100000297 Ga0070660_1000002976 408
101 3300005339 Ga0070660_100011244 Ga0070660_1000112444 408
102 3300005339 Ga0070660_100012473 Ga0070660_1000124735 408
103 3300005339 Ga0070660_100024355 Ga0070660_1000243555 408
104 3300005339 Ga0070660_100086114 Ga0070660_1000861143 408
105 3300005339 Ga0070660_100112325 Ga0070660_1001123252 408
106 3300005344 Ga0070661_100015300 Ga0070661_1000153004 408
107 3300005354 Ga0070675_100011322 Ga0070675_1000113221 408
108 3300005355 Ga0070671_100069212 Ga0070671_1000692124 408
109 3300005355 Ga0070671_100085726 Ga0070671_1000857262 408
110 3300005355 Ga0070671_100098310 Ga0070671_1000983102 408
111 3300005355 Ga0070671_100267723 Ga0070671_1002677232 408
112 3300005364 Ga0070673_100000009 Ga0070673_100000009130 408
113 3300005364 Ga0070673_100106228 Ga0070673_1001062283 408
114 3300005364 Ga0070673_100228154 Ga0070673_1002281541 408
115 3300005366 Ga0070659_100060171 Ga0070659_1000601713 408
116 3300005366 Ga0070659_100118121 Ga0070659_1001181212 408
117 3300005367 Ga0070667_100124053 Ga0070667_1001240532 408
118 3300005367 Ga0070667_100270625 Ga0070667_1002706251 408
119 3300005435 Ga0070714_100003924 Ga0070714_10000392411 408
120 3300005436 Ga0070713_100006462 Ga0070713_1000064622 408
121 3300005436 Ga0070713_100016373 Ga0070713_1000163732 408
122 3300005436 Ga0070713_100031313 Ga0070713_1000313133 408
123 3300005456 Ga0070678_100014590 Ga0070678_1000145903 408
124 3300005456 Ga0070678_100015610 Ga0070678_1000156107 408
125 3300005456 Ga0070678_100045757 Ga0070678_1000457573 408
126 3300005457 Ga0070662_100007521 Ga0070662_1000075217 408
127 3300005457 Ga0070662_100009573 Ga0070662_1000095737 408
128 3300005457 Ga0070662_100021118 Ga0070662_1000211187 408
129 3300005457 Ga0070662_100044680 Ga0070662_1000446801 408
130 3300005457 Ga0070662_100154455 Ga0070662_1001544552 408
131 3300005459 Ga0068867_100000002 Ga0068867_100000002159 408
132 3300005530 Ga0070679_100057515 Ga0070679_1000575152 408
133 3300005530 Ga0070679_100359741 Ga0070679_1003597411 408
134 3300005535 Ga0070684_100014407 Ga0070684_1000144074 408
135 3300005539 Ga0068853_100042395 Ga0068853_1000423953 408
136 3300005539 Ga0068853_100204586 Ga0068853_1002045862 408
137 3300005543 Ga0070672_100008763 Ga0070672_1000087638 408
138 3300005543 Ga0070672_100028586 Ga0070672_1000285862 408
139 3300005543 Ga0070672_100186312 Ga0070672_1001863121 408
140 3300005545 Ga0070695_100095557 Ga0070695_1000955572 408
141 3300005546 Ga0070696_100224131 Ga0070696_1002241312 408
142 3300005563 Ga0068855_100099838 Ga0068855_1000998382 408
143 3300005563 Ga0068855_100340461 Ga0068855_1003404612 408
144 3300005564 Ga0070664_100050397 Ga0070664_1000503974 408
145 3300005564 Ga0070664_100055510 Ga0070664_1000555102 408
146 3300005564 Ga0070664_100071046 Ga0070664_1000710464 408
147 3300005577 Ga0068857_100000489 Ga0068857_1000004891 408
148 3300005577 Ga0068857_100056681 Ga0068857_1000566812 408
149 3300005577 Ga0068857_100181077 Ga0068857_1001810772 408
150 3300005614 Ga0068856_100010923 Ga0068856_1000109235 408
151 3300005614 Ga0068856_100262524 Ga0068856_1002625242 408
152 3300005616 Ga0068852_100005346 Ga0068852_10000534610 408
153 3300005616 Ga0068852_100046036 Ga0068852_1000460364 408
154 3300005616 Ga0068852_100049863 Ga0068852_1000498632 408
155 3300005616 Ga0068852_100265249 Ga0068852_1002652492 408
156 3300005617 Ga0068859_100009808 Ga0068859_1000098085 408
157 3300005618 Ga0068864_100020011 Ga0068864_1000200115 408
158 3300005618 Ga0068864_100079811 Ga0068864_1000798113 408
159 3300005618 Ga0068864_100095088 Ga0068864_1000950881 408
160 3300005618 Ga0068864_100107432 Ga0068864_1001074322 408
161 3300005718 Ga0068866_10031568 Ga0068866_100315683 408
162 3300005841 Ga0068863_100016153 Ga0068863_1000161533 408
163 3300005841 Ga0068863_100036296 Ga0068863_1000362967 408
164 3300005842 Ga0068858_100041282 Ga0068858_1000412822 408
165 3300005985 Ga0081539_10064386 Ga0081539_100643862 408
166 3300006028 Ga0070717_10003717 Ga0070717_1000371712 408
167 3300006237 Ga0097621_100027033 Ga0097621_1000270334 408
168 3300006237 Ga0097621_100266144 Ga0097621_1002661442 408
169 3300006881 Ga0068865_100000014 Ga0068865_10000001412 408
170 3300006881 Ga0068865_100004123 Ga0068865_1000041234 408
171 3300006881 Ga0068865_100152563 Ga0068865_1001525632 408
172 3300006931 Ga0097620_100009808 Ga0097620_1000098085 408
173 3300009093 Ga0105240_10264610 Ga0105240_102646101 408
174 3300009093 Ga0105240_10265161 Ga0105240_102651612 408
175 3300009094 Ga0111539_10154249 Ga0111539_101542492 408
176 3300009098 Ga0105245_10002000 Ga0105245_1000200013 408
177 3300009098 Ga0105245_10038005 Ga0105245_100380056 408
178 3300009098 Ga0105245_10044701 Ga0105245_100447016 408
179 3300009148 Ga0105243_10001563 Ga0105243_1000156313 408
180 3300009176 Ga0105242_10002690 Ga0105242_100026904 408
181 3300009176 Ga0105242_10059728 Ga0105242_100597284 408
182 3300009177 Ga0105248_10023597 Ga0105248_100235974 408
183 3300009177 Ga0105248_10023730 Ga0105248_100237307 408
184 3300009551 Ga0105238_10007923 Ga0105238_100079238 408
185 3300009553 Ga0105249_10017644 Ga0105249_100176448 408
186 3300013100 Ga0157373_10093248 Ga0157373_100932482 408
187 3300013102 Ga0157371_10171372 Ga0157371_101713722 408
188 3300013104 Ga0157370_10000189 Ga0157370_1000018924 408
189 3300013105 Ga0157369_10006976 Ga0157369_100069762 408
190 3300013105 Ga0157369_10042544 Ga0157369_100425442 408
191 3300013296 Ga0157374_10145808 Ga0157374_101458082 408
192 3300013296 Ga0157374_10171385 Ga0157374_101713852 408
193 3300013297 Ga0157378_10000484 Ga0157378_1000048414 408
194 3300013297 Ga0157378_10080926 Ga0157378_100809262 408
195 3300013307 Ga0157372_10008768 Ga0157372_100087683 408
196 3300013308 Ga0157375_10002582 Ga0157375_1000258218 408
197 3300013308 Ga0157375_10123863 Ga0157375_101238632 408
198 3300014325 Ga0163163_10195392 Ga0163163_101953923 408
199 3300014745 Ga0157377_10007809 Ga0157377_100078095 408
200 3300014968 Ga0157379_10044813 Ga0157379_100448132 408
201 3300014968 Ga0157379_10217354 Ga0157379_102173542 408
202 3300014969 Ga0157376_10000134 Ga0157376_1000013410 408
203 3300014969 Ga0157376_10009190 Ga0157376_100091906 408
204 3300017792 Ga0163161_10035725 Ga0163161_100357252 408
205 3300017792 Ga0163161_10039629 Ga0163161_100396292 408
206 3300025231 Ga0207427_102516 Ga0207427_1025161 408
207 3300025250 Ga0209026_1003011 Ga0209026_10030117 408
208 3300025254 Ga0209148_1000147 Ga0209148_100014732 408
209 3300025254 Ga0209148_1001532 Ga0209148_100153211 408
210 3300025261 Ga0209233_1000003 Ga0209233_1000003305 408
211 3300025272 Ga0209455_1000472 Ga0209455_100047215 408
212 3300025901 Ga0207688_10011183 Ga0207688_100111836 408
213 3300025903 Ga0207680_10108381 Ga0207680_101083812 408
214 3300025904 Ga0207647_10000783 Ga0207647_1000078311 408
215 3300025904 Ga0207647_10000998 Ga0207647_100009982 408
216 3300025904 Ga0207647_10116334 Ga0207647_101163342 408
217 3300025907 Ga0207645_10000959 Ga0207645_1000095920 408
218 3300025909 Ga0207705_10003743 Ga0207705_1000374311 408
219 3300025909 Ga0207705_10009986 Ga0207705_100099865 408
220 3300025909 Ga0207705_10026009 Ga0207705_100260092 408
221 3300025909 Ga0207705_10043007 Ga0207705_100430074 408
222 3300025909 Ga0207705_10052347 Ga0207705_100523473 408
223 3300025909 Ga0207705_10135830 Ga0207705_101358302 408
224 3300025909 Ga0207705_10159497 Ga0207705_101594972 408
225 3300025913 Ga0207695_10149606 Ga0207695_101496062 408
226 3300025914 Ga0207671_10098968 Ga0207671_100989682 408
227 3300025915 Ga0207693_10027346 Ga0207693_100273467 408
228 3300025919 Ga0207657_10002905 Ga0207657_1000290510 408
229 3300025919 Ga0207657_10008305 Ga0207657_100083056 408
230 3300025919 Ga0207657_10009638 Ga0207657_100096389 408
231 3300025919 Ga0207657_10014579 Ga0207657_100145797 408
232 3300025919 Ga0207657_10016949 Ga0207657_100169497 408
233 3300025919 Ga0207657_10024747 Ga0207657_100247474 408
234 3300025919 Ga0207657_10113147 Ga0207657_101131472 408
235 3300025920 Ga0207649_10034981 Ga0207649_100349812 408
236 3300025920 Ga0207649_10167726 Ga0207649_101677262 408
237 3300025921 Ga0207652_10063613 Ga0207652_100636133 408
238 3300025926 Ga0207659_10168564 Ga0207659_101685642 408
239 3300025927 Ga0207687_10002886 Ga0207687_100028862 408
240 3300025927 Ga0207687_10017483 Ga0207687_100174831 408
241 3300025928 Ga0207700_10029130 Ga0207700_100291303 408
242 3300025928 Ga0207700_10130396 Ga0207700_101303962 408
243 3300025929 Ga0207664_10032740 Ga0207664_100327402 408
244 3300025931 Ga0207644_10001636 Ga0207644_1000163617 408
245 3300025931 Ga0207644_10002510 Ga0207644_100025103 408
246 3300025931 Ga0207644_10036172 Ga0207644_100361723 408
247 3300025931 Ga0207644_10039591 Ga0207644_100395913 408
248 3300025931 Ga0207644_10076975 Ga0207644_100769753 408
249 3300025932 Ga0207690_10004814 Ga0207690_100048146 408
250 3300025932 Ga0207690_10072248 Ga0207690_100722482 408
251 3300025932 Ga0207690_10089391 Ga0207690_100893912 408
252 3300025933 Ga0207706_10008631 Ga0207706_100086319 408
253 3300025933 Ga0207706_10013494 Ga0207706_100134946 408
254 3300025933 Ga0207706_10016069 Ga0207706_100160695 408
255 3300025933 Ga0207706_10025002 Ga0207706_100250026 408
256 3300025933 Ga0207706_10025331 Ga0207706_100253312 408
257 3300025933 Ga0207706_10029705 Ga0207706_100297056 408
258 3300025933 Ga0207706_10095766 Ga0207706_100957664 408
259 3300025935 Ga0207709_10000066 Ga0207709_10000066108 408
260 3300025937 Ga0207669_10012519 Ga0207669_100125192 408
261 3300025938 Ga0207704_10024526 Ga0207704_100245263 408
262 3300025939 Ga0207665_10018746 Ga0207665_100187462 408
263 3300025940 Ga0207691_10012138 Ga0207691_100121388 408
264 3300025940 Ga0207691_10041934 Ga0207691_100419342 408
265 3300025940 Ga0207691_10244937 Ga0207691_102449372 408
266 3300025941 Ga0207711_10003505 Ga0207711_1000350516 408
267 3300025941 Ga0207711_10118968 Ga0207711_101189684 408
268 3300025942 Ga0207689_10002123 Ga0207689_1000212310 408
269 3300025944 Ga0207661_10001582 Ga0207661_100015829 408
270 3300025945 Ga0207679_10055450 Ga0207679_100554503 408
271 3300025949 Ga0207667_10114922 Ga0207667_101149222 408
272 3300025960 Ga0207651_10000004 Ga0207651_10000004159 408
273 3300025960 Ga0207651_10016809 Ga0207651_100168092 408
274 3300025961 Ga0207712_10027374 Ga0207712_100273742 408
275 3300025986 Ga0207658_10007456 Ga0207658_100074566 408
276 3300026023 Ga0207677_10000060 Ga0207677_1000006028 408
277 3300026023 Ga0207677_10002385 Ga0207677_100023859 408
278 3300026041 Ga0207639_10023875 Ga0207639_100238752 408
279 3300026078 Ga0207702_10004093 Ga0207702_100040938 408
280 3300026088 Ga0207641_10046769 Ga0207641_100467695 408
281 3300026089 Ga0207648_10000003 Ga0207648_10000003130 408
282 3300026089 Ga0207648_10024720 Ga0207648_100247203 408
283 3300026089 Ga0207648_10200641 Ga0207648_102006412 408
284 3300026095 Ga0207676_10010867 Ga0207676_100108673 408
285 3300026095 Ga0207676_10050724 Ga0207676_100507242 408
286 3300026095 Ga0207676_10168231 Ga0207676_101682312 408
287 3300026116 Ga0207674_10001507 Ga0207674_1000150711 408
288 3300026116 Ga0207674_10003897 Ga0207674_1000389720 408
289 3300026116 Ga0207674_10006500 Ga0207674_1000650012 408
290 3300026121 Ga0207683_10062474 Ga0207683_100624744 408
291 3300026121 Ga0207683_10134893 Ga0207683_101348931 408
292 3300026142 Ga0207698_10008243 Ga0207698_100082433 408
293 3300026142 Ga0207698_10264972 Ga0207698_102649722 408
294 3300031731 Ga0307405_10041480 Ga0307405_100414802 408
295 3300031852 Ga0307410_10002317 Ga0307410_100023176 408
296 3300031852 Ga0307410_10017727 Ga0307410_100177277 408
297 3300031852 Ga0307410_10073353 Ga0307410_100733532 408
298 3300031995 Ga0307409_100143562 Ga0307409_1001435623 408
299 3300032004 Ga0307414_10074900 Ga0307414_100749002 408
300 3300032005 Ga0307411_10022197 Ga0307411_100221972 408
301 3300032005 Ga0307411_10071884 Ga0307411_100718842 408
302 3300032126 Ga0307415_100014070 Ga0307415_1000140704 408
303 3300035692 Ga0373935_0007283 Ga0373935_0007283_132_1361 408
304 3300035725 Ga0373947_0017985 Ga0373947_0017985_746_1975 408
305 3300037068 Ga0373925_0011242 Ga0373925_0011242_1538_2767 408
306 3300037312 Ga0395899_0000669 Ga0395899_0000669_14868_16097 408
307 3300037312 Ga0395899_0001118 Ga0395899_0001118_21081_22310 408
308 3300037312 Ga0395899_0015353 Ga0395899_0015353_1117_2346 408
309 3300037312 Ga0395899_0016569 Ga0395899_0016569_606_1835 408
310 3300037312 Ga0395899_0020519 Ga0395899_0020519_1810_3042 408
311 3300037312 Ga0395899_0024800 Ga0395899_0024800_1723_2952 408
312 3300037418 Ga0395900_0001777 Ga0395900_0001777_21455_22684 408
313 3300037418 Ga0395900_0003481 Ga0395900_0003481_2347_3576 408
314 3300037418 Ga0395900_0003962 Ga0395900_0003962_9902_11131 408
315 3300037418 Ga0395900_0004070 Ga0395900_0004070_10681_11910 408
316 3300037418 Ga0395900_0021752 Ga0395900_0021752_537_1766 408
317 3300037418 Ga0395900_0048043 Ga0395900_0048043_2337_3569 408
318 3300037418 Ga0395900_0048748 Ga0395900_0048748_2371_3600 408
319 3300037418 Ga0395900_0062389 Ga0395900_0062389_2125_3354 408
320 3300037418 Ga0395900_0115398 Ga0395900_0115398_374_1603 408
321 3300037418 Ga0395900_0133180 Ga0395900_0133180_639_1868 408
322 3300037466 Ga0395898_0000315 Ga0395898_0000315_109835_111064 408
323 3300037466 Ga0395898_0040047 Ga0395898_0040047_3217_4446 408
324 3300037466 Ga0395898_0043539 Ga0395898_0043539_634_1863 408
325 3300037471 Ga0395905_0000005 Ga0395905_0000005_470609_471838 408
326 3300037471 Ga0395905_0000038 Ga0395905_0000038_62392_63651 408
327 3300037471 Ga0395905_0002727 Ga0395905_0002727_271_1500 408
328 3300037471 Ga0395905_0003864 Ga0395905_0003864_1514_2743 408
329 3300037471 Ga0395905_0016116 Ga0395905_0016116_1244_2473 408
330 3300037471 Ga0395905_0016985 Ga0395905_0016985_4280_5509 408
331 3300037471 Ga0395905_0019970 Ga0395905_0019970_3566_4798 408
332 3300037471 Ga0395905_0027543 Ga0395905_0027543_2027_3259 408
333 3300037471 Ga0395905_0033834 Ga0395905_0033834_1186_2415 408
334 3300037471 Ga0395905_0035511 Ga0395905_0035511_825_2054 408
335 3300037471 Ga0395905_0054973 Ga0395905_0054973_1605_2834 408
336 3300037471 Ga0395905_0068293 Ga0395905_0068293_280_1509 408
337 3300037471 Ga0395905_0103622 Ga0395905_0103622_1190_2419 408
338 3300037471 Ga0395905_0156061 Ga0395905_0156061_610_1839 408
339 3300037853 Ga0436364_1387927 Ga0436364_1387927_13350_14579 408
340 3300038443 Ga0395901_0001728 Ga0395901_0001728_10079_11308 408
341 3300038443 Ga0395901_0002455 Ga0395901_0002455_16670_17899 408
342 3300038443 Ga0395901_0002700 Ga0395901_0002700_14456_15685 408
343 3300038443 Ga0395901_0017319 Ga0395901_0017319_5679_6908 408
344 3300038443 Ga0395901_0033979 Ga0395901_0033979_840_2069 408
345 3300038443 Ga0395901_0041896 Ga0395901_0041896_2118_3347 408
346 3300038443 Ga0395901_0045829 Ga0395901_0045829_2630_3862 408
347 3300038443 Ga0395901_0203777 Ga0395901_0203777_722_1951 408
348 3300042005 Ga0439448_0003717 Ga0439448_0003717_218_1447 408
349 3300042012 Ga0439455_0005269 Ga0439455_0005269_855_2084 408
350 3300042144 Ga0450889_001319 Ga0450889_001319_342_1571 408
351 3300042157 Ga0439458_0000816 Ga0439458_0000816_3480_4709 408
352 3300044693 Ga0466961_0036169 Ga0466961_0036169_1066_2295 408
353 3300044693 Ga0466961_0075259 Ga0466961_0075259_493_1722 408
354 3300044693 Ga0466961_0075413 Ga0466961_0075413_326_1555 408
355 3300044694 Ga0466963_0019901 Ga0466963_0019901_334_1563 408
356 3300044694 Ga0466963_0031843 Ga0466963_0031843_479_1708 408
357 3300044719 Ga0466971_0003659 Ga0466971_0003659_1360_2589 408
358 3300044719 Ga0466971_0055775 Ga0466971_0055775_51_1310 408
359 3300044842 Ga0466957_0022499 Ga0466957_0022499_55_1284 408
360 3300044842 Ga0466957_0047644 Ga0466957_0047644_1297_2526 408
361 3300044842 Ga0466957_0104751 Ga0466957_0104751_494_1723 408
362 3300045049 Ga0466959_0131514 Ga0466959_0131514_168_1427 408
363 3300045836 Ga0466958_0008603 Ga0466958_0008603_3918_5147 408
364 3300045976 Ga0466967_0068324 Ga0466967_0068324_1436_2665 408
365 3300045976 Ga0466967_0106601 Ga0466967_0106601_610_1839 408
366 3300045976 Ga0466967_0274372 Ga0466967_0274372_322_1551 408
367 3300046506 Ga0495583_0000175 Ga0495583_0000175_5251_6480 408
368 3300046616 Ga0495668_0027367 Ga0495668_0027367_1394_2623 408
369 3300046648 Ga0495611_0050466 Ga0495611_0050466_328_1557 408
370 3300046684 Ga0495669_0007454 Ga0495669_0007454_2477_3706 408
371 3300046691 Ga0495670_0020063 Ga0495670_0020063_43_1272 408
372 3300047445 Ga0495677_0050720 Ga0495677_0050720_35_1264 408
373 3300047469 Ga0495673_0011678 Ga0495673_0011678_55_1284 408
374 3300047472 Ga0495686_0001271 Ga0495686_0001271_20526_21755 408
375 3300048904 Ga0496101_0013702 Ga0496101_0013702_3388_4617 408
376 3300048905 Ga0496102_0140848 Ga0496102_0140848_91_1320 408
377 3300048906 Ga0496103_0034513 Ga0496103_0034513_959_2188 408
378 3300048907 Ga0496104_0090296 Ga0496104_0090296_1175_2404 408
379 3300048909 Ga0496106_0026326 Ga0496106_0026326_2640_3869 408
380 3300048910 Ga0496107_0057182 Ga0496107_0057182_1101_2330 408
381 3300048911 Ga0496108_0059840 Ga0496108_0059840_1101_2330 408
382 3300048913 Ga0496110_0002065 Ga0496110_0002065_5030_6259 408
383 3300048914 Ga0496111_0016078 Ga0496111_0016078_879_2108 408
384 3300048915 Ga0496112_0009336 Ga0496112_0009336_2308_3537 408
385 3300048915 Ga0496112_0026946 Ga0496112_0026946_1642_2871 408
386 3300048916 Ga0496113_0016450 Ga0496113_0016450_1837_3066 408
387 3300048917 Ga0496114_0000029 Ga0496114_0000029_43776_45005 408
388 3300048920 Ga0496117_0056834 Ga0496117_0056834_300_1529 408
389 3300048921 Ga0496118_0116361 Ga0496118_0116361_19_1248 408
390 3300048924 Ga0496121_0012810 Ga0496121_0012810_6371_7600 408
391 3300049460 Ga0495682_0006765 Ga0495682_0006765_521_1750 408
392 3300049660 Ga0501216_005193 Ga0501216_005193_627_1856 408
393 3300049668 Ga0501233_024055 Ga0501233_024055_12_1241 408
394 3300049707 Ga0501234_003709 Ga0501234_003709_827_2056 408
395 3300049765 Ga0501268_001449 Ga0501268_001449_1705_2934 408
396 3300049822 Ga0501035_0027290 Ga0501035_0027290_654_1910 408
397 3300049822 Ga0501035_0145735 Ga0501035_0145735_674_1954 408
398 3300050508 nmdc:mga09592_113571_c1 nmdc:mga09592_113571_c1_41_1270 408
399 3300053103 Ga0500555_001348 Ga0500555_001348_6306_7535 408
400 3300053136 Ga0500559_0058756 Ga0500559_0058756_84_1349 408
401 3300061719 Ga0466962_0005843 Ga0466962_0005843_3492_4721 408
402 3300061719 Ga0466962_0009093 Ga0466962_0009093_1888_3117 408

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00675

Peptidase_M16

Insulinase (Peptidase family M16)

14

162

0.97

PF05193

Peptidase_M16_C

Peptidase M16 inactive domain

167

339

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hdi-assembly1.cif.gz_B crystal structure of bacillus halodurans metallo peptidase 0.9544 4 400
3h1h-assembly1.cif.gz_A cytochrome bc1 complex from chicken 0.9502 2 400
6zfs-assembly1.cif.gz_A crystal structure of bovine cytochrome bc1 in complex with quinolone inhibitor wdh-1u-4 0.9484 2 403
1bcc-assembly1.cif.gz_A cytochrome bc1 complex from chicken 0.948 2 400
7jrg-assembly1.cif.gz_B plant mitochondrial complex iii2 from vigna radiata 0.9475 2 400
ID Description Score Start End Superfamily
af_P9WHT5_241_428_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9678 222 400 3.30.830.10
af_P9WHT5_3_225_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9675 2 206 3.30.830.10
af_A0A1D6G373_49_271_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.9647 2 209 3.30.830.10
af_Q4W6B5_16_247_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.964 2 214 3.30.830.10
af_Q23295_11_239_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.961 2 212 3.30.830.10
ID Description Score Start End GO Terms
AF-A0A1F3A1P4-F1-model_v4 Peptidase M16 0.9816 3 398 GO:0004222
GO:0006508
GO:0046872
AF-A0A2E0PUZ1-F1-model_v4 Peptidase M16 0.9812 1 400 GO:0004222
GO:0006508
GO:0046872
AF-A0A258JNK0-F1-model_v4 Peptidase M16 0.9792 67 406 GO:0046872
AF-A0A2E0GGD9-F1-model_v4 Peptidase M16 0.9786 2 400 GO:0004222
GO:0006508
GO:0046872
AF-A0A1F2XG09-F1-model_v4 Peptidase M16 0.9774 1 403 GO:0004222
GO:0006508
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.85 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map