F435045

General Info

Members Datasets Scaffolds Average Seq Length
402 181 804 174

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100184129|Ga0070696_1001841292
Length 193
Sequence VPRRGRLRRCGAEHAPDVAANVPDTLVLKRHRDLEGYHRSVIWVRRAVLALIAAFAVLGLLNLFGQRPVTATANADAASLALYAPAHLRGGLLFSARFHIRAKRDLKKATLVLDPGWAEGMAINTIEPSPVGEGSRDGRLVLELGHIPAGSSYLLFMQFQVNPTNVGRRSQDVELDDGGTRILHIDRTVTIWP

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
107 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
120 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
121 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
122 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
146 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
147 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
166 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
181 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.27
Metatranscriptomes 3.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.95
Rhizosphere 88.06
Stem 0
Stem Tuber 0
Unclassified 18.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_100184129 3300005546 Bacteria 1551
2 JGI25407J50210_10007154 3300003373 Bacteria 2793
3 Ga0070658_10022886 3300005327 Bacteria 5015
4 Ga0070658_10855552 3300005327 Bacteria 790
5 Ga0070683_100267943 3300005329 Unclassified 1624
6 Ga0070683_100279974 3300005329 Bacteria 1586
7 Ga0070683_100398455 3300005329 Bacteria 1312
8 Ga0070683_100870267 3300005329 Unclassified 864
9 Ga0070680_100020648 3300005336 Bacteria 5229
10 Ga0070680_100036319 3300005336 Bacteria 3980
11 Ga0070680_100380574 3300005336 Bacteria 1202
12 Ga0070680_100607753 3300005336 Bacteria 939
13 Ga0070682_100124291 3300005337 Bacteria 1737
14 Ga0070660_100045995 3300005339 Bacteria 3344
15 Ga0070660_100059769 3300005339 Bacteria 2956
16 Ga0070660_100480257 3300005339 Bacteria 1033
17 Ga0070661_100021648 3300005344 Bacteria 4595
18 Ga0070661_100135069 3300005344 Unclassified 1855
19 Ga0070661_100436069 3300005344 Unclassified 1040
20 Ga0070661_100501208 3300005344 Unclassified 972
21 Ga0070671_100391704 3300005355 Bacteria 1188
22 Ga0070659_100098463 3300005366 Bacteria 2352
23 Ga0070659_100165188 3300005366 Unclassified 1811
24 Ga0070659_100594966 3300005366 Unclassified 950
25 Ga0070709_10011853 3300005434 Bacteria 4868
26 Ga0070709_11176936 3300005434 Unclassified 615
27 Ga0070714_100045826 3300005435 Bacteria 3708
28 Ga0070714_100150441 3300005435 Bacteria 2097
29 Ga0070714_100531934 3300005435 Bacteria 1124
30 Ga0070714_100861013 3300005435 Bacteria 879
31 Ga0070713_100175164 3300005436 Bacteria 1924
32 Ga0070713_100289559 3300005436 Bacteria 1505
33 Ga0070710_10029854 3300005437 Bacteria 2928
34 Ga0070694_100218613 3300005444 Bacteria 1428
35 Ga0070663_100486075 3300005455 Bacteria 1023
36 Ga0070678_101036864 3300005456 Bacteria 755
37 Ga0070681_10048445 3300005458 Bacteria 4246
38 Ga0070681_10069520 3300005458 Bacteria 3487
39 Ga0070681_10078222 3300005458 Bacteria 3265
40 Ga0070681_10130801 3300005458 Bacteria 2442
41 Ga0070681_10539478 3300005458 Bacteria 1080
42 Ga0070679_100041019 3300005530 Bacteria 4607
43 Ga0070679_100081140 3300005530 Bacteria 3233
44 Ga0070679_100129449 3300005530 Bacteria 2506
45 Ga0070679_100188597 3300005530 Unclassified 2031
46 Ga0070679_100244669 3300005530 Bacteria 1750
47 Ga0070679_100267342 3300005530 Bacteria 1665
48 Ga0070679_100320850 3300005530 Bacteria 1498
49 Ga0070679_100895227 3300005530 Unclassified 831
50 Ga0070684_100004951 3300005535 Bacteria 10166
51 Ga0070684_100212150 3300005535 Unclassified 1765
52 Ga0070684_100839717 3300005535 Bacteria 859
53 Ga0068853_100164767 3300005539 Unclassified 2002
54 Ga0070665_100366043 3300005548 Bacteria 1448
55 Ga0070704_100173402 3300005549 Bacteria 1718
56 Ga0068855_100076048 3300005563 Bacteria 3897
57 Ga0068855_100178421 3300005563 Bacteria 2402
58 Ga0068855_100216744 3300005563 Unclassified 2148
59 Ga0068855_100520222 3300005563 Unclassified 1291
60 Ga0068855_101616575 3300005563 Bacteria 663
61 Ga0070664_101119208 3300005564 Bacteria 742
62 Ga0068857_100014413 3300005577 Bacteria 6894
63 Ga0068857_100097613 3300005577 Bacteria 2634
64 Ga0068857_100559532 3300005577 Unclassified 1078
65 Ga0068854_100468390 3300005578 Bacteria 1056
66 Ga0068856_100377334 3300005614 Bacteria 1437
67 Ga0068852_100026479 3300005616 Bacteria 4714
68 Ga0068852_100758372 3300005616 Unclassified 983
69 Ga0068863_100945602 3300005841 Unclassified 863
70 Ga0081538_10000492 3300005981 Bacteria 44066
71 Ga0081538_10000613 3300005981 Bacteria 39554
72 Ga0070717_10020944 3300006028 Bacteria 5148
73 Ga0070717_10054961 3300006028 Bacteria 3284
74 Ga0070717_10516731 3300006028 Bacteria 1080
75 Ga0075432_10059507 3300006058 Unclassified 1358
76 Ga0070715_10000748 3300006163 Bacteria 8767
77 Ga0070716_100012124 3300006173 Bacteria 4360
78 Ga0070712_100151071 3300006175 Bacteria 1783
79 Ga0070712_100869499 3300006175 Unclassified 776
80 Ga0075428_100118691 3300006844 Bacteria 2880
81 Ga0075428_100505312 3300006844 Unclassified 1293
82 Ga0075428_100527418 3300006844 Unclassified 1263
83 Ga0075431_100239518 3300006847 Unclassified 1846
84 Ga0075431_100901866 3300006847 Bacteria 854
85 Ga0075433_10826447 3300006852 Bacteria 809
86 Ga0075434_100007870 3300006871 Bacteria 9873
87 Ga0075434_100300806 3300006871 Bacteria 1625
88 Ga0105251_10200301 3300009011 Unclassified 900
89 Ga0105240_10052404 3300009093 Bacteria 5131
90 Ga0105240_10073576 3300009093 Bacteria 4219
91 Ga0105240_10261432 3300009093 Bacteria 1996
92 Ga0105240_10341223 3300009093 Bacteria 1702
93 Ga0105240_11610455 3300009093 Unclassified 679
94 Ga0111539_10430466 3300009094 Bacteria 1536
95 Ga0111539_11160460 3300009094 Bacteria 897
96 Ga0114129_10167661 3300009147 Bacteria 2996
97 Ga0114129_10830878 3300009147 Unclassified 1176
98 Ga0105243_10987978 3300009148 Bacteria 843
99 Ga0105241_10093015 3300009174 Bacteria 2382
100 Ga0105242_10283693 3300009176 Bacteria 1505
101 Ga0105248_10437817 3300009177 Bacteria 1472
102 Ga0105237_10066073 3300009545 Bacteria 3612
103 Ga0105237_10543602 3300009545 Bacteria 1168
104 Ga0105237_10706402 3300009545 Bacteria 1015
105 Ga0105238_10100575 3300009551 Bacteria 2874
106 Ga0105238_10316415 3300009551 Unclassified 1546
107 Ga0105239_10064567 3300010375 Bacteria 4019
108 Ga0105239_10372767 3300010375 Bacteria 1613
109 Ga0105239_10489955 3300010375 Bacteria 1397
110 Ga0157373_10239549 3300013100 Unclassified 1282
111 Ga0157371_10269655 3300013102 Bacteria 1228
112 Ga0157370_10053446 3300013104 Bacteria 3851
113 Ga0157370_10057477 3300013104 Bacteria 3699
114 Ga0157370_10159771 3300013104 Bacteria 2097
115 Ga0157370_10194594 3300013104 Bacteria 1882
116 Ga0157370_10199255 3300013104 Unclassified 1857
117 Ga0157370_10722772 3300013104 Bacteria 908
118 Ga0157369_10029083 3300013105 Bacteria 6109
119 Ga0157369_10091319 3300013105 Bacteria 3251
120 Ga0157369_10125860 3300013105 Bacteria 2717
121 Ga0157369_10390268 3300013105 Bacteria 1444
122 Ga0157374_10371919 3300013296 Bacteria 1423
123 Ga0157374_11338907 3300013296 Unclassified 738
124 Ga0157372_10037160 3300013307 Bacteria 5369
125 Ga0157372_10045886 3300013307 Bacteria 4849
126 Ga0157372_10192089 3300013307 Bacteria 2365
127 Ga0157375_11400894 3300013308 Bacteria 823
128 Ga0163163_10838766 3300014325 Bacteria 983
129 Ga0163163_11175332 3300014325 Bacteria 830
130 Ga0182008_10277203 3300014497 Bacteria 872
131 Ga0157379_10683568 3300014968 Bacteria 962
132 Ga0157376_11579534 3300014969 Bacteria 690
133 Ga0197907_10101945 3300020069 Bacteria 2719
134 Ga0206356_10195176 3300020070 Bacteria 1417
135 Ga0206356_11148810 3300020070 Bacteria 776
136 Ga0206356_11712120 3300020070 Unclassified 671
137 Ga0206349_1085263 3300020075 Bacteria 853
138 Ga0206350_10676003 3300020080 Bacteria 599
139 Ga0206350_10808403 3300020080 Unclassified 732
140 Ga0206350_11186743 3300020080 Bacteria 719
141 Ga0206354_10270291 3300020081 Bacteria 844
142 Ga0206354_11513803 3300020081 Bacteria 1948
143 Ga0206353_10762471 3300020082 Unclassified 883
144 Ga0206353_10843204 3300020082 Bacteria 2623
145 Ga0206353_12033280 3300020082 Unclassified 1651
146 Ga0154015_1602728 3300020610 Bacteria 1152
147 Ga0213876_10061470 3300021384 Bacteria 1982
148 Ga0224712_10071822 3300022467 Bacteria 1407
149 Ga0207692_10167121 3300025898 Bacteria 1272
150 Ga0207685_10180791 3300025905 Bacteria 978
151 Ga0207699_10010727 3300025906 Bacteria 4608
152 Ga0207699_10392048 3300025906 Bacteria 987
153 Ga0207699_10764015 3300025906 Unclassified 709
154 Ga0207705_10037868 3300025909 Bacteria 3451
155 Ga0207705_10286194 3300025909 Unclassified 1262
156 Ga0207705_10470804 3300025909 Unclassified 975
157 Ga0207705_10903060 3300025909 Unclassified 684
158 Ga0207707_10117270 3300025912 Bacteria 2327
159 Ga0207707_10292854 3300025912 Bacteria 1408
160 Ga0207707_10452465 3300025912 Bacteria 1099
161 Ga0207695_10107717 3300025913 Bacteria 2772
162 Ga0207695_10324713 3300025913 Bacteria 1428
163 Ga0207695_10353330 3300025913 Unclassified 1357
164 Ga0207695_11098808 3300025913 Unclassified 675
165 Ga0207671_10156846 3300025914 Bacteria 1761
166 Ga0207671_10638839 3300025914 Unclassified 848
167 Ga0207671_10731104 3300025914 Bacteria 786
168 Ga0207693_10001669 3300025915 Bacteria 19567
169 Ga0207693_10001852 3300025915 Bacteria 18530
170 Ga0207693_10500938 3300025915 Bacteria 948
171 Ga0207663_10057743 3300025916 Bacteria 2446
172 Ga0207660_10009676 3300025917 Bacteria 6239
173 Ga0207660_10048883 3300025917 Bacteria 2995
174 Ga0207660_10604444 3300025917 Bacteria 893
175 Ga0207662_10528889 3300025918 Bacteria 815
176 Ga0207657_10000610 3300025919 Bacteria 37898
177 Ga0207657_10007328 3300025919 Bacteria 11317
178 Ga0207657_10074992 3300025919 Bacteria 2855
179 Ga0207657_10300970 3300025919 Bacteria 1270
180 Ga0207657_10396168 3300025919 Bacteria 1086
181 Ga0207649_10308825 3300025920 Bacteria 1158
182 Ga0207649_10648627 3300025920 Bacteria 815
183 Ga0207652_10043006 3300025921 Bacteria 3846
184 Ga0207652_10134820 3300025921 Bacteria 2204
185 Ga0207652_10660670 3300025921 Bacteria 934
186 Ga0207694_10827951 3300025924 Unclassified 782
187 Ga0207694_11022804 3300025924 Unclassified 699
188 Ga0207700_10226887 3300025928 Unclassified 1586
189 Ga0207700_10941560 3300025928 Bacteria 773
190 Ga0207664_10050621 3300025929 Bacteria 3276
191 Ga0207664_10070626 3300025929 Bacteria 2811
192 Ga0207664_10316589 3300025929 Bacteria 1376
193 Ga0207664_10431942 3300025929 Unclassified 1174
194 Ga0207686_10375681 3300025934 Bacteria 1076
195 Ga0207704_10723775 3300025938 Bacteria 826
196 Ga0207665_10000697 3300025939 Bacteria 22783
197 Ga0207711_10800737 3300025941 Bacteria 878
198 Ga0207661_10004885 3300025944 Bacteria 9396
199 Ga0207661_10265081 3300025944 Unclassified 1531
200 Ga0207661_10464809 3300025944 Bacteria 1154
201 Ga0207661_10844419 3300025944 Unclassified 843
202 Ga0207667_10130043 3300025949 Unclassified 2593
203 Ga0207667_10920692 3300025949 Bacteria 865
204 Ga0207639_10327696 3300026041 Unclassified 1361
205 Ga0207678_10061643 3300026067 Bacteria 3226
206 Ga0207702_10249755 3300026078 Unclassified 1665
207 Ga0207641_10448400 3300026088 Bacteria 1247
208 Ga0207674_10020357 3300026116 Bacteria 7168
209 Ga0207674_10235284 3300026116 Bacteria 1779
210 Ga0207674_10588367 3300026116 Unclassified 1075
211 Ga0207674_10939681 3300026116 Unclassified 833
212 Ga0207683_10869414 3300026121 Bacteria 837
213 Ga0207698_10014358 3300026142 Bacteria 5262
214 Ga0207698_10264534 3300026142 Bacteria 1582
215 Ga0207428_10119811 3300027907 Bacteria 2019
216 Ga0268266_10150474 3300028379 Bacteria 2097
217 Ga0268266_10475789 3300028379 Bacteria 1190
218 Ga0307406_10783631 3300031901 Bacteria 803
219 Ga0307416_100940563 3300032002 Bacteria 966
220 Ga0373959_0034134 3300034820 Bacteria 1041
221 Ga0373949_0072653 3300035090 Bacteria 904
222 Ga0373943_0023084 3300035170 Bacteria 2890
223 Ga0373931_0129252 3300035691 Bacteria 1452
224 Ga0373927_0030667 3300035695 Bacteria 3508
225 Ga0373947_0024837 3300035725 Bacteria 3494
226 Ga0395899_0002026 3300037312 Bacteria 16691
227 Ga0395899_0057843 3300037312 Bacteria 2861
228 Ga0395899_0112588 3300037312 Bacteria 1955
229 Ga0395899_0208231 3300037312 Unclassified 1360
230 Ga0395899_0564754 3300037312 Bacteria 729
231 Ga0395900_0003510 3300037418 Bacteria 16928
232 Ga0395900_0006366 3300037418 Bacteria 12310
233 Ga0395900_0046441 3300037418 Bacteria 4472
234 Ga0395900_0050026 3300037418 Bacteria 4305
235 Ga0395900_0076827 3300037418 Bacteria 3432
236 Ga0395900_0181944 3300037418 Bacteria 2135
237 Ga0395900_0231396 3300037418 Bacteria 1858
238 Ga0395900_0257765 3300037418 Bacteria 1743
239 Ga0395900_0358808 3300037418 Unclassified 1429
240 Ga0395900_1251857 3300037418 Bacteria 657
241 Ga0395898_0003052 3300037466 Bacteria 18969
242 Ga0395898_0004640 3300037466 Bacteria 14979
243 Ga0395898_0015914 3300037466 Bacteria 7707
244 Ga0395898_0044686 3300037466 Bacteria 4358
245 Ga0395898_0046985 3300037466 Bacteria 4238
246 Ga0395898_0055526 3300037466 Bacteria 3863
247 Ga0395898_0310601 3300037466 Bacteria 1504
248 Ga0395898_1606505 3300037466 Bacteria 574
249 Ga0395905_0003866 3300037471 Bacteria 15797
250 Ga0395905_0035129 3300037471 Bacteria 4706
251 Ga0395905_0064420 3300037471 Bacteria 3430
252 Ga0395905_0160634 3300037471 Bacteria 2112
253 Ga0395905_0246165 3300037471 Bacteria 1670
254 Ga0395905_0713966 3300037471 Bacteria 905
255 Ga0395905_0735494 3300037471 Bacteria 889
256 Ga0395901_0002248 3300038443 Bacteria 19701
257 Ga0395901_0003172 3300038443 Bacteria 16539
258 Ga0395901_0019186 3300038443 Bacteria 6991
259 Ga0395901_0037264 3300038443 Bacteria 5030
260 Ga0395901_0062153 3300038443 Bacteria 3886
261 Ga0395901_0066127 3300038443 Bacteria 3766
262 Ga0395901_0167623 3300038443 Bacteria 2305
263 Ga0395901_0196113 3300038443 Unclassified 2117
264 Ga0395901_0269243 3300038443 Bacteria 1772
265 Ga0395901_0439219 3300038443 Bacteria 1336
266 Ga0395901_0791379 3300038443 Bacteria 938
267 Ga0436365_0383669 3300039437 Bacteria 985
268 Ga0436365_1501848 3300039437 Bacteria 1363
269 Ga0436363_1597774 3300039450 Unclassified 2596
270 Ga0451804_0680202 3300041463 Bacteria 955
271 Ga0466963_0003084 3300044694 Bacteria 9444
272 Ga0466963_0007320 3300044694 Bacteria 6579
273 Ga0466963_0015593 3300044694 Bacteria 4710
274 Ga0466963_0037124 3300044694 Bacteria 3180
275 Ga0466963_0041137 3300044694 Bacteria 3030
276 Ga0466963_0210948 3300044694 Bacteria 1359
277 Ga0466963_0440936 3300044694 Bacteria 919
278 Ga0466964_0006768 3300044706 Bacteria 4273
279 Ga0466964_0301063 3300044706 Bacteria 808
280 Ga0466968_0107407 3300044735 Unclassified 1252
281 Ga0466957_0035751 3300044842 Bacteria 2982
282 Ga0466957_0435271 3300044842 Bacteria 902
283 Ga0466957_0813301 3300044842 Bacteria 664
284 Ga0466960_0207481 3300044901 Unclassified 1073
285 Ga0466959_0069429 3300045049 Bacteria 2553
286 Ga0466958_0053955 3300045836 Bacteria 2437
287 Ga0466958_0576833 3300045836 Bacteria 731
288 Ga0466967_0024940 3300045976 Bacteria 4923
289 Ga0466967_0032789 3300045976 Bacteria 4390
290 Ga0466967_0049995 3300045976 Bacteria 3659
291 Ga0466967_0056701 3300045976 Bacteria 3456
292 Ga0466967_0090999 3300045976 Bacteria 2772
293 Ga0466967_0126841 3300045976 Unclassified 2365
294 Ga0466967_0173635 3300045976 Bacteria 2029
295 Ga0466967_0311700 3300045976 Bacteria 1516
296 Ga0466967_0542564 3300045976 Bacteria 1144
297 Ga0466967_0560075 3300045976 Bacteria 1125
298 Ga0466967_0746881 3300045976 Bacteria 970
299 Ga0466967_1042604 3300045976 Bacteria 814
300 Ga0495641_0045277 3300046461 Bacteria 2026
301 Ga0495641_0107951 3300046461 Bacteria 1242
302 Ga0495653_0099454 3300046463 Bacteria 2111
303 Ga0495582_0056986 3300046473 Bacteria 2154
304 Ga0495582_0111135 3300046473 Bacteria 1539
305 Ga0495630_0014795 3300046517 Bacteria 5690
306 Ga0495630_0131045 3300046517 Bacteria 1904
307 Ga0495630_0346885 3300046517 Unclassified 1136
308 Ga0495630_0478552 3300046517 Bacteria 955
309 Ga0495630_0618702 3300046517 Unclassified 830
310 Ga0495663_0113301 3300046525 Bacteria 903
311 Ga0495640_0009659 3300046533 Bacteria 7501
312 Ga0495586_0032820 3300046535 Bacteria 2784
313 Ga0495587_0169678 3300046536 Unclassified 1240
314 Ga0495645_0094689 3300046543 Bacteria 2130
315 Ga0495634_0048060 3300046642 Bacteria 2874
316 Ga0495634_0075951 3300046642 Bacteria 2206
317 Ga0495634_0237288 3300046642 Unclassified 1120
318 Ga0495635_0084563 3300046663 Bacteria 2171
319 Ga0495659_0081345 3300046664 Bacteria 1230
320 Ga0495588_0335381 3300046674 Unclassified 795
321 Ga0495599_0067707 3300046678 Bacteria 2230
322 Ga0495658_0146524 3300046683 Bacteria 1447
323 Ga0495658_0478294 3300046683 Bacteria 796
324 Ga0495613_0074604 3300046689 Bacteria 2470
325 Ga0495613_0096784 3300046689 Bacteria 2134
326 Ga0495624_0057132 3300046690 Unclassified 2454
327 Ga0495670_0218008 3300046691 Bacteria 1013
328 Ga0495600_0172753 3300046809 Bacteria 1395
329 Ga0495581_0309312 3300047315 Bacteria 923
330 Ga0495674_0073371 3300047319 Bacteria 2950
331 Ga0495674_0166534 3300047319 Bacteria 1841
332 Ga0495680_0213741 3300047322 Bacteria 1379
333 Ga0495680_0425989 3300047322 Bacteria 912
334 Ga0496100_0028330 3300048903 Bacteria 3454
335 Ga0496100_0066666 3300048903 Bacteria 2388
336 Ga0496101_0153847 3300048904 Bacteria 1760
337 Ga0496101_0416670 3300048904 Bacteria 1058
338 Ga0496102_0083397 3300048905 Bacteria 2949
339 Ga0496102_0405808 3300048905 Bacteria 1281
340 Ga0496104_0003290 3300048907 Bacteria 13945
341 Ga0496104_0003782 3300048907 Bacteria 13095
342 Ga0496104_0069655 3300048907 Bacteria 3343
343 Ga0496104_0109906 3300048907 Bacteria 2642
344 Ga0496104_0757469 3300048907 Bacteria 878
345 Ga0496105_0000305 3300048908 Bacteria 32361
346 Ga0496105_0053883 3300048908 Bacteria 3322
347 Ga0496105_0095504 3300048908 Bacteria 2455
348 Ga0496105_0165468 3300048908 Bacteria 1814
349 Ga0496105_0170292 3300048908 Bacteria 1785
350 Ga0496106_0047021 3300048909 Bacteria 3245
351 Ga0496106_0060710 3300048909 Bacteria 2866
352 Ga0496107_0026465 3300048910 Bacteria 4112
353 Ga0496107_0117846 3300048910 Bacteria 1955
354 Ga0496108_0004984 3300048911 Bacteria 10732
355 Ga0496108_0030948 3300048911 Bacteria 4436
356 Ga0496108_0481345 3300048911 Bacteria 1084
357 Ga0496109_0002785 3300048912 Bacteria 14649
358 Ga0496109_0014986 3300048912 Bacteria 6747
359 Ga0496109_0230170 3300048912 Unclassified 1744
360 Ga0496110_0000905 3300048913 Bacteria 20843
361 Ga0496110_0126637 3300048913 Unclassified 2305
362 Ga0496110_0187473 3300048913 Bacteria 1878
363 Ga0496110_0893673 3300048913 Bacteria 794
364 Ga0496111_0022652 3300048914 Bacteria 4400
365 Ga0496111_0957727 3300048914 Bacteria 615
366 Ga0496112_0064103 3300048915 Bacteria 3625
367 Ga0496112_0219121 3300048915 Bacteria 1859
368 Ga0496112_0282863 3300048915 Bacteria 1605
369 Ga0496112_0298426 3300048915 Bacteria 1557
370 Ga0496112_0309702 3300048915 Unclassified 1524
371 Ga0496112_1277112 3300048915 Unclassified 650
372 Ga0496113_0015437 3300048916 Bacteria 5248
373 Ga0496113_0071154 3300048916 Bacteria 2646
374 Ga0496113_0124768 3300048916 Bacteria 2016
375 Ga0496114_0006590 3300048917 Bacteria 9154
376 Ga0496114_0018256 3300048917 Bacteria 5669
377 Ga0501047_0080230 3300049581 Bacteria 3137
378 Ga0501067_0000154 3300049583 Bacteria 38151
379 Ga0501067_0167920 3300049583 Unclassified 1222
380 Ga0501067_0200969 3300049583 Bacteria 1110
381 Ga0501069_0001465 3300049585 Bacteria 11614
382 Ga0501069_0053574 3300049585 Bacteria 2247
383 Ga0501070_0000243 3300049586 Bacteria 51201
384 Ga0501070_0380559 3300049586 Unclassified 1143
385 Ga0501070_0524843 3300049586 Bacteria 950
386 Ga0501080_0176152 3300049742 Bacteria 1970
387 Ga0501044_1079390 3300049823 Bacteria 673
388 nmdc:mga05p37_186151_c1 3300050507 Bacteria 2524
389 nmdc:mga09592_209112_c1 3300050508 Unclassified 1690
390 nmdc:mga0qj67_143907_c1 3300050509 Bacteria 1933
391 nmdc:mga06r32_1223425_c1 3300050510 Bacteria 697
392 nmdc:mga06r32_536931_c1 3300050510 Unclassified 1144
393 nmdc:mga08y16_826980_c1 3300050511 Bacteria 917
394 nmdc:mga0n895_66084_c1 3300050512 Bacteria 3581
395 nmdc:mga0rr50_832982_c1 3300050513 Unclassified 787
396 nmdc:mga08x19_262463_c1 3300050514 Bacteria 1194
397 Ga0495601_0020391 3300053077 Bacteria 4049
398 Ga0495601_0040538 3300053077 Bacteria 2916
399 Ga0495619_0022572 3300053085 Bacteria 4029
400 Ga0495619_0145715 3300053085 Bacteria 1632
401 Ga0590077_006680 3300059426 Bacteria 2362
402 Ga0466962_0024612 3300061719 Bacteria 2891
403 Ga0070696_100184129
404 JGI25407J50210_10007154
405 Ga0070658_10022886
406 Ga0070658_10855552
407 Ga0070683_100267943
408 Ga0070683_100279974
409 Ga0070683_100398455
410 Ga0070683_100870267
411 Ga0070680_100020648
412 Ga0070680_100036319
413 Ga0070680_100380574
414 Ga0070680_100607753
415 Ga0070682_100124291
416 Ga0070660_100045995
417 Ga0070660_100059769
418 Ga0070660_100480257
419 Ga0070661_100021648
420 Ga0070661_100135069
421 Ga0070661_100436069
422 Ga0070661_100501208
423 Ga0070671_100391704
424 Ga0070659_100098463
425 Ga0070659_100165188
426 Ga0070659_100594966
427 Ga0070709_10011853
428 Ga0070709_11176936
429 Ga0070714_100045826
430 Ga0070714_100150441
431 Ga0070714_100531934
432 Ga0070714_100861013
433 Ga0070713_100175164
434 Ga0070713_100289559
435 Ga0070710_10029854
436 Ga0070694_100218613
437 Ga0070663_100486075
438 Ga0070678_101036864
439 Ga0070681_10048445
440 Ga0070681_10069520
441 Ga0070681_10078222
442 Ga0070681_10130801
443 Ga0070681_10539478
444 Ga0070679_100041019
445 Ga0070679_100081140
446 Ga0070679_100129449
447 Ga0070679_100188597
448 Ga0070679_100244669
449 Ga0070679_100267342
450 Ga0070679_100320850
451 Ga0070679_100895227
452 Ga0070684_100004951
453 Ga0070684_100212150
454 Ga0070684_100839717
455 Ga0068853_100164767
456 Ga0070665_100366043
457 Ga0070704_100173402
458 Ga0068855_100076048
459 Ga0068855_100178421
460 Ga0068855_100216744
461 Ga0068855_100520222
462 Ga0068855_101616575
463 Ga0070664_101119208
464 Ga0068857_100014413
465 Ga0068857_100097613
466 Ga0068857_100559532
467 Ga0068854_100468390
468 Ga0068856_100377334
469 Ga0068852_100026479
470 Ga0068852_100758372
471 Ga0068863_100945602
472 Ga0081538_10000492
473 Ga0081538_10000613
474 Ga0070717_10020944
475 Ga0070717_10054961
476 Ga0070717_10516731
477 Ga0075432_10059507
478 Ga0070715_10000748
479 Ga0070716_100012124
480 Ga0070712_100151071
481 Ga0070712_100869499
482 Ga0075428_100118691
483 Ga0075428_100505312
484 Ga0075428_100527418
485 Ga0075431_100239518
486 Ga0075431_100901866
487 Ga0075433_10826447
488 Ga0075434_100007870
489 Ga0075434_100300806
490 Ga0105251_10200301
491 Ga0105240_10052404
492 Ga0105240_10073576
493 Ga0105240_10261432
494 Ga0105240_10341223
495 Ga0105240_11610455
496 Ga0111539_10430466
497 Ga0111539_11160460
498 Ga0114129_10167661
499 Ga0114129_10830878
500 Ga0105243_10987978
501 Ga0105241_10093015
502 Ga0105242_10283693
503 Ga0105248_10437817
504 Ga0105237_10066073
505 Ga0105237_10543602
506 Ga0105237_10706402
507 Ga0105238_10100575
508 Ga0105238_10316415
509 Ga0105239_10064567
510 Ga0105239_10372767
511 Ga0105239_10489955
512 Ga0157373_10239549
513 Ga0157371_10269655
514 Ga0157370_10053446
515 Ga0157370_10057477
516 Ga0157370_10159771
517 Ga0157370_10194594
518 Ga0157370_10199255
519 Ga0157370_10722772
520 Ga0157369_10029083
521 Ga0157369_10091319
522 Ga0157369_10125860
523 Ga0157369_10390268
524 Ga0157374_10371919
525 Ga0157374_11338907
526 Ga0157372_10037160
527 Ga0157372_10045886
528 Ga0157372_10192089
529 Ga0157375_11400894
530 Ga0163163_10838766
531 Ga0163163_11175332
532 Ga0182008_10277203
533 Ga0157379_10683568
534 Ga0157376_11579534
535 Ga0197907_10101945
536 Ga0206356_10195176
537 Ga0206356_11148810
538 Ga0206356_11712120
539 Ga0206349_1085263
540 Ga0206350_10676003
541 Ga0206350_10808403
542 Ga0206350_11186743
543 Ga0206354_10270291
544 Ga0206354_11513803
545 Ga0206353_10762471
546 Ga0206353_10843204
547 Ga0206353_12033280
548 Ga0154015_1602728
549 Ga0213876_10061470
550 Ga0224712_10071822
551 Ga0207692_10167121
552 Ga0207685_10180791
553 Ga0207699_10010727
554 Ga0207699_10392048
555 Ga0207699_10764015
556 Ga0207705_10037868
557 Ga0207705_10286194
558 Ga0207705_10470804
559 Ga0207705_10903060
560 Ga0207707_10117270
561 Ga0207707_10292854
562 Ga0207707_10452465
563 Ga0207695_10107717
564 Ga0207695_10324713
565 Ga0207695_10353330
566 Ga0207695_11098808
567 Ga0207671_10156846
568 Ga0207671_10638839
569 Ga0207671_10731104
570 Ga0207693_10001669
571 Ga0207693_10001852
572 Ga0207693_10500938
573 Ga0207663_10057743
574 Ga0207660_10009676
575 Ga0207660_10048883
576 Ga0207660_10604444
577 Ga0207662_10528889
578 Ga0207657_10000610
579 Ga0207657_10007328
580 Ga0207657_10074992
581 Ga0207657_10300970
582 Ga0207657_10396168
583 Ga0207649_10308825
584 Ga0207649_10648627
585 Ga0207652_10043006
586 Ga0207652_10134820
587 Ga0207652_10660670
588 Ga0207694_10827951
589 Ga0207694_11022804
590 Ga0207700_10226887
591 Ga0207700_10941560
592 Ga0207664_10050621
593 Ga0207664_10070626
594 Ga0207664_10316589
595 Ga0207664_10431942
596 Ga0207686_10375681
597 Ga0207704_10723775
598 Ga0207665_10000697
599 Ga0207711_10800737
600 Ga0207661_10004885
601 Ga0207661_10265081
602 Ga0207661_10464809
603 Ga0207661_10844419
604 Ga0207667_10130043
605 Ga0207667_10920692
606 Ga0207639_10327696
607 Ga0207678_10061643
608 Ga0207702_10249755
609 Ga0207641_10448400
610 Ga0207674_10020357
611 Ga0207674_10235284
612 Ga0207674_10588367
613 Ga0207674_10939681
614 Ga0207683_10869414
615 Ga0207698_10014358
616 Ga0207698_10264534
617 Ga0207428_10119811
618 Ga0268266_10150474
619 Ga0268266_10475789
620 Ga0307406_10783631
621 Ga0307416_100940563
622 Ga0373959_0034134
623 Ga0373949_0072653
624 Ga0373943_0023084
625 Ga0373931_0129252
626 Ga0373927_0030667
627 Ga0373947_0024837
628 Ga0395899_0002026
629 Ga0395899_0057843
630 Ga0395899_0112588
631 Ga0395899_0208231
632 Ga0395899_0564754
633 Ga0395900_0003510
634 Ga0395900_0006366
635 Ga0395900_0046441
636 Ga0395900_0050026
637 Ga0395900_0076827
638 Ga0395900_0181944
639 Ga0395900_0231396
640 Ga0395900_0257765
641 Ga0395900_0358808
642 Ga0395900_1251857
643 Ga0395898_0003052
644 Ga0395898_0004640
645 Ga0395898_0015914
646 Ga0395898_0044686
647 Ga0395898_0046985
648 Ga0395898_0055526
649 Ga0395898_0310601
650 Ga0395898_1606505
651 Ga0395905_0003866
652 Ga0395905_0035129
653 Ga0395905_0064420
654 Ga0395905_0160634
655 Ga0395905_0246165
656 Ga0395905_0713966
657 Ga0395905_0735494
658 Ga0395901_0002248
659 Ga0395901_0003172
660 Ga0395901_0019186
661 Ga0395901_0037264
662 Ga0395901_0062153
663 Ga0395901_0066127
664 Ga0395901_0167623
665 Ga0395901_0196113
666 Ga0395901_0269243
667 Ga0395901_0439219
668 Ga0395901_0791379
669 Ga0436365_0383669
670 Ga0436365_1501848
671 Ga0436363_1597774
672 Ga0451804_0680202
673 Ga0466963_0003084
674 Ga0466963_0007320
675 Ga0466963_0015593
676 Ga0466963_0037124
677 Ga0466963_0041137
678 Ga0466963_0210948
679 Ga0466963_0440936
680 Ga0466964_0006768
681 Ga0466964_0301063
682 Ga0466968_0107407
683 Ga0466957_0035751
684 Ga0466957_0435271
685 Ga0466957_0813301
686 Ga0466960_0207481
687 Ga0466959_0069429
688 Ga0466958_0053955
689 Ga0466958_0576833
690 Ga0466967_0024940
691 Ga0466967_0032789
692 Ga0466967_0049995
693 Ga0466967_0056701
694 Ga0466967_0090999
695 Ga0466967_0126841
696 Ga0466967_0173635
697 Ga0466967_0311700
698 Ga0466967_0542564
699 Ga0466967_0560075
700 Ga0466967_0746881
701 Ga0466967_1042604
702 Ga0495641_0045277
703 Ga0495641_0107951
704 Ga0495653_0099454
705 Ga0495582_0056986
706 Ga0495582_0111135
707 Ga0495630_0014795
708 Ga0495630_0131045
709 Ga0495630_0346885
710 Ga0495630_0478552
711 Ga0495630_0618702
712 Ga0495663_0113301
713 Ga0495640_0009659
714 Ga0495586_0032820
715 Ga0495587_0169678
716 Ga0495645_0094689
717 Ga0495634_0048060
718 Ga0495634_0075951
719 Ga0495634_0237288
720 Ga0495635_0084563
721 Ga0495659_0081345
722 Ga0495588_0335381
723 Ga0495599_0067707
724 Ga0495658_0146524
725 Ga0495658_0478294
726 Ga0495613_0074604
727 Ga0495613_0096784
728 Ga0495624_0057132
729 Ga0495670_0218008
730 Ga0495600_0172753
731 Ga0495581_0309312
732 Ga0495674_0073371
733 Ga0495674_0166534
734 Ga0495680_0213741
735 Ga0495680_0425989
736 Ga0496100_0028330
737 Ga0496100_0066666
738 Ga0496101_0153847
739 Ga0496101_0416670
740 Ga0496102_0083397
741 Ga0496102_0405808
742 Ga0496104_0003290
743 Ga0496104_0003782
744 Ga0496104_0069655
745 Ga0496104_0109906
746 Ga0496104_0757469
747 Ga0496105_0000305
748 Ga0496105_0053883
749 Ga0496105_0095504
750 Ga0496105_0165468
751 Ga0496105_0170292
752 Ga0496106_0047021
753 Ga0496106_0060710
754 Ga0496107_0026465
755 Ga0496107_0117846
756 Ga0496108_0004984
757 Ga0496108_0030948
758 Ga0496108_0481345
759 Ga0496109_0002785
760 Ga0496109_0014986
761 Ga0496109_0230170
762 Ga0496110_0000905
763 Ga0496110_0126637
764 Ga0496110_0187473
765 Ga0496110_0893673
766 Ga0496111_0022652
767 Ga0496111_0957727
768 Ga0496112_0064103
769 Ga0496112_0219121
770 Ga0496112_0282863
771 Ga0496112_0298426
772 Ga0496112_0309702
773 Ga0496112_1277112
774 Ga0496113_0015437
775 Ga0496113_0071154
776 Ga0496113_0124768
777 Ga0496114_0006590
778 Ga0496114_0018256
779 Ga0501047_0080230
780 Ga0501067_0000154
781 Ga0501067_0167920
782 Ga0501067_0200969
783 Ga0501069_0001465
784 Ga0501069_0053574
785 Ga0501070_0000243
786 Ga0501070_0380559
787 Ga0501070_0524843
788 Ga0501080_0176152
789 Ga0501044_1079390
790 nmdc:mga05p37_186151_c1
791 nmdc:mga09592_209112_c1
792 nmdc:mga0qj67_143907_c1
793 nmdc:mga06r32_1223425_c1
794 nmdc:mga06r32_536931_c1
795 nmdc:mga08y16_826980_c1
796 nmdc:mga0n895_66084_c1
797 nmdc:mga0rr50_832982_c1
798 nmdc:mga08x19_262463_c1
799 Ga0495601_0020391
800 Ga0495601_0040538
801 Ga0495619_0022572
802 Ga0495619_0145715
803 Ga0590077_006680
804 Ga0466962_0024612

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ayo-assembly1.cif.gz_B receptor binding domain of bovine alpha-2-macroglobulin 0.7172 73 168
7nyd-assembly1.cif.gz_A cryoem structure of 2c9-smac 0.7129 56 173
2jhz-assembly2.cif.gz_B crystal structure of rhogdi e155s, e157s mutant 0.7014 67 172
1ft3-assembly2.cif.gz_B crystal structure of truncated rhogdi k141a mutant 0.6968 67 172
2jhw-assembly2.cif.gz_B crystal structure of rhogdi e155a, e157a mutant 0.6911 67 172
ID Description Score Start End Superfamily
af_P49222_590_685_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7341 62 172 2.60.40.10
af_F1R1R7_646_742_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7174 60 173 2.60.40.10
1ayoB00 Mainly Beta;Sandwich;Immunoglobulin-like;Alpha-macroglobulin, receptor-binding domain 0.7172 73 168 2.60.40.690
af_P49222_590_685_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7143 62 172 2.60.40.10
af_F1QC84_628_725_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.713 47 172 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A7W0N6L0-F1-model_v4 Uncharacterized protein 0.9744 81 173
AF-A0A1M3BM45-F1-model_v4 Cohesin domain-containing protein 0.9546 20 173
AF-A0A7W0N6L0-F1-model_v4 Uncharacterized protein 0.9543 81 173
AF-A0A3D3YXE0-F1-model_v4 Uncharacterized protein 0.9501 75 173
AF-A0A2W6SU32-F1-model_v4 Uncharacterized protein 0.9474 45 173

Map