F434738

General Info

Members Datasets Scaffolds Average Seq Length
401 272 315 249

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10074345|Ga0065704_100743457
Length 250
Sequence MKTVMITGCSSGFGLATARYFLEQGWKVIATMRTPQEGLLPQSERLRLLALDVTSQQSIERAVADADAGDIDVLVNNAGVGMLNALEGVSPEAVREVFETNTLGTLAMTRAVIPQFRQRRSGTIVNVTSAVTLQPLPLLAVYSASKVAVNAFTESLALELAPFNIRVGLVLPGRSPATRFGENAQRIMGEIPEAYAAFSQQILHGMQDAHAKVTRPEEVAHAVWQMATDPDTPIRLPAGEDAWEMAGQRR

Samples

Sample ID Description Type Environment
1 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
2 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
5 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
6 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
7 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
8 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
9 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
10 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
11 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
12 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
13 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
14 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
15 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
16 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
17 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
18 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
19 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
20 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
21 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
22 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
23 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
24 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
25 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
26 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
27 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
28 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
29 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
30 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
31 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
32 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
33 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
34 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
35 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
36 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
37 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
38 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
39 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
40 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
41 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
42 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
43 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
44 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
45 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
46 2636415599 Klebsiella variicola DX120E Isolate Unclassified
47 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
48 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
49 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
50 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
51 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
52 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
53 2738541297 Duganella sp. GV083 Isolate Unclassified
54 2738541307 Variovorax sp. GV008 Isolate Unclassified
55 2738541357 Duganella sp. GV053 Isolate Unclassified
56 2738543003 Duganella sp. GV066 Isolate Unclassified
57 2738543026 Duganella sp. GV089 Isolate Unclassified
58 2738543029 Duganella sp. GV039 Isolate Unclassified
59 2775507074 Klebsiella sp. D5A Isolate Unclassified
60 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
61 2831864461 Roseateles noduli HZ7 Isolate Nodule
62 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
63 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
64 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
65 2857558681 Duganella sp. R-74565 Isolate Unclassified
66 2857564685 Duganella sp. R-74599 Isolate Unclassified
67 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
68 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
69 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
70 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
71 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
72 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
73 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
74 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
75 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
76 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
77 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
78 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
79 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
80 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
81 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
82 2941471342 Luteibacter sp. 621 Isolate Unclassified
83 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
84 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
85 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
86 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
87 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
88 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
89 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
90 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
91 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
92 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
93 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
94 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
95 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
96 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
97 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
98 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
99 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
100 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
101 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
102 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
103 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
104 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
105 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
106 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
107 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
108 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
109 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
110 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
111 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
112 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
113 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
114 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
115 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
116 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
117 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
127 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
128 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
131 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
138 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
139 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
142 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
143 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
167 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
168 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
169 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
196 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
197 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
198 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
199 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
202 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
203 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
206 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
209 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
212 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
213 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
214 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
215 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
216 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
217 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
218 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
219 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
220 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
221 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
222 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
223 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
230 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
231 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
232 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
236 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
237 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
238 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
239 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
240 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
241 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
251 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
252 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
255 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
260 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
261 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
262 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
263 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
264 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
265 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
266 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
267 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
268 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
269 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
270 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
271 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
272 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.55
Metatranscriptomes 0
Isolates 21.45

Biome Distribution

Category Percentage (%)
Aerial Root 0.75
Bulb 0
Endosphere 16.21
Nodule 0.25
Rhizoplane 9.98
Rhizosphere 54.11
Stem 0
Stem Tuber 0
Unclassified 18.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001580 3300001904 Bacteria 4151
2 JGI25152J39213_1002275 3300002773 Bacteria 7410
3 JGI25153J46596_10000393 3300003215 Bacteria 29527
4 JGI25153J46596_10013610 3300003215 Bacteria 3428
5 rootH1_10043751 3300003316 Bacteria 5853
6 rootH2_10048846 3300003320 Bacteria 1733
7 rootL2_10170830 3300003322 Bacteria 1914
8 rootL2_10318290 3300003322 Bacteria 1839
9 rootH1_10045939 3300003323 Bacteria 5445
10 rootH1_10255600 3300003323 Bacteria 1849
11 Ga0055539_1000002 3300003752 Bacteria 999437
12 Ga0055533_1000004 3300003756 Bacteria 999437
13 Ga0055525_1000002 3300003759 Bacteria 999437
14 Ga0055535_1000102 3300003761 Bacteria 92203
15 Ga0055542_1000147 3300003762 Bacteria 88503
16 Ga0055526_1000573 3300003771 Bacteria 29024
17 Ga0055526_1000884 3300003771 Bacteria 22289
18 Ga0055526_1003157 3300003771 Bacteria 10676
19 Ga0055536_1022804 3300003781 Bacteria 1856
20 Ga0055534_1020412 3300003784 Bacteria 1120
21 Ga0055530_10050293 3300003791 Bacteria 972
22 Ga0055531_10002539 3300003794 Bacteria 12140
23 Ga0055541_1000002 3300003841 Bacteria 896405
24 Ga0058692_1000208 3300003856 Bacteria 35014
25 Ga0058692_1000255 3300003856 Bacteria 29148
26 Ga0058692_1001754 3300003856 Bacteria 7705
27 Ga0058692_1001812 3300003856 Bacteria 7538
28 Ga0055543_1008160 3300004625 Bacteria 2343
29 Ga0065165_1000562 3300005262 Bacteria 55318
30 Ga0065165_1000647 3300005262 Bacteria 50322
31 Ga0065704_10074345 3300005289 Bacteria 6333
32 Ga0070660_100007498 3300005339 Bacteria 7605
33 Ga0070665_100006317 3300005548 Bacteria 12093
34 Ga0070665_100343219 3300005548 Bacteria 1498
35 Ga0068855_100001647 3300005563 Bacteria 27987
36 Ga0068855_100005393 3300005563 Bacteria 15602
37 Ga0068855_100051533 3300005563 Bacteria 4848
38 Ga0068855_100085349 3300005563 Bacteria 3653
39 Ga0068857_100293957 3300005577 Bacteria 1496
40 Ga0068854_100363580 3300005578 Bacteria 1188
41 Ga0068856_100125652 3300005614 Bacteria 2568
42 Ga0068856_100145228 3300005614 Bacteria 2380
43 Ga0070717_10071467 3300006028 Bacteria 2895
44 Ga0105251_10031058 3300009011 Bacteria 2676
45 Ga0105251_10077644 3300009011 Bacteria 1539
46 Ga0105244_10002612 3300009036 Bacteria 13497
47 Ga0105244_10039486 3300009036 Bacteria 2456
48 Ga0105237_10022139 3300009545 Bacteria 6521
49 Ga0105238_10020754 3300009551 Bacteria 6689
50 Ga0105239_10054086 3300010375 Bacteria 4403
51 Ga0105239_10537699 3300010375 Bacteria 1330
52 Ga0105246_10354926 3300011119 Bacteria 1203
53 Ga0157373_10028776 3300013100 Bacteria 4007
54 Ga0157370_10009472 3300013104 Bacteria 10398
55 Ga0157369_10016891 3300013105 Bacteria 8201
56 Ga0157369_10203884 3300013105 Bacteria 2075
57 Ga0157372_10482333 3300013307 Bacteria 1445
58 Ga0182006_1005409 3300015261 Bacteria 6098
59 Ga0182005_1007823 3300015265 Bacteria 3182
60 Ga0183361_10019 3300016635 Bacteria 129849
61 Ga0163161_10005918 3300017792 Bacteria 8479
62 Ga0213872_10000282 3300021361 Bacteria 43374
63 Ga0213872_10001060 3300021361 Bacteria 19085
64 Ga0213872_10201081 3300021361 Bacteria 854
65 Ga0209784_100002 3300025224 Bacteria 1753105
66 Ga0209566_100003 3300025225 Bacteria 1753105
67 Ga0209566_101685 3300025225 Bacteria 5506
68 Ga0209674_100004 3300025226 Bacteria 1753105
69 Ga0209672_100207 3300025228 Bacteria 46534
70 Ga0209563_100006 3300025230 Bacteria 1753105
71 Ga0209258_100111 3300025242 Bacteria 197019
72 Ga0209258_101053 3300025242 Bacteria 12128
73 Ga0207425_1000203 3300025245 Bacteria 47325
74 Ga0209646_1006409 3300025246 Bacteria 1980
75 Ga0209677_100003 3300025253 Bacteria 1753105
76 Ga0209148_1000099 3300025254 Bacteria 227713
77 Ga0209759_1002827 3300025256 Bacteria 7323
78 Ga0209129_1000012 3300025258 Bacteria 541516
79 Ga0209129_1000431 3300025258 Bacteria 31539
80 Ga0209455_1003866 3300025272 Bacteria 5112
81 Ga0209673_1005775 3300025273 Bacteria 6155
82 Ga0209673_1014662 3300025273 Bacteria 3023
83 Ga0209675_1001568 3300025291 Bacteria 12968
84 Ga0209676_1010692 3300025292 Bacteria 3784
85 Ga0209676_1030476 3300025292 Bacteria 1649
86 Ga0209025_1037763 3300025294 Bacteria 2136
87 Ga0209564_1000021 3300025295 Bacteria 571316
88 Ga0209564_1000022 3300025295 Bacteria 555109
89 Ga0209564_1000028 3300025295 Bacteria 510986
90 Ga0209758_1000233 3300025297 Bacteria 116640
91 Ga0209758_1006383 3300025297 Bacteria 8513
92 Ga0209050_1010708 3300025298 Bacteria 4474
93 Ga0209256_1010215 3300025299 Bacteria 3966
94 Ga0209256_1012519 3300025299 Bacteria 3232
95 Ga0209051_1001051 3300025303 Bacteria 25929
96 Ga0209257_1047966 3300025304 Bacteria 1225
97 Ga0207655_1016353 3300025728 Bacteria 4063
98 Ga0207655_1024023 3300025728 Bacteria 3000
99 Ga0207647_10000002 3300025904 Bacteria 400771
100 Ga0207695_10668850 3300025913 Bacteria 919
101 Ga0207671_10010798 3300025914 Bacteria 7493
102 Ga0207657_10004105 3300025919 Bacteria 15466
103 Ga0207694_10011441 3300025924 Bacteria 6696
104 Ga0207667_10000032 3300025949 Bacteria 322253
105 Ga0207667_10005459 3300025949 Bacteria 15496
106 Ga0207667_10069027 3300025949 Bacteria 3679
107 Ga0207667_10076980 3300025949 Bacteria 3461
108 Ga0207702_10243254 3300026078 Bacteria 1687
109 Ga0209371_1000017 3300027312 Bacteria 625776
110 Ga0209371_1000134 3300027312 Bacteria 121747
111 Ga0209371_1002830 3300027312 Bacteria 9219
112 Ga0209371_1007453 3300027312 Bacteria 3808
113 Ga0209371_1010697 3300027312 Bacteria 2793
114 Ga0209371_1016623 3300027312 Bacteria 1933
115 Ga0268266_10000043 3300028379 Bacteria 316604
116 Ga0307515_10097652 3300028794 Bacteria 3587
117 Ga0307515_10144424 3300028794 Bacteria 2530
118 Ga0265338_10000120 3300028800 Bacteria 145451
119 Ga0268256_1000208 3300030500 Bacteria 66543
120 Ga0268256_1000643 3300030500 Bacteria 26645
121 Ga0268256_1001351 3300030500 Bacteria 14995
122 Ga0268256_1006979 3300030500 Bacteria 4115
123 Ga0268256_1007670 3300030500 Bacteria 3808
124 Ga0268256_1018922 3300030500 Bacteria 1898
125 Ga0307511_10109914 3300030521 Bacteria 1760
126 Ga0307509_10005684 3300031507 Bacteria 17204
127 Ga0307508_10013746 3300031616 Bacteria 7391
128 Ga0307405_10001325 3300031731 Bacteria 10374
129 Ga0307409_100326752 3300031995 Bacteria 1438
130 Ga0307414_10188477 3300032004 Bacteria 1666
131 Ga0307414_10588116 3300032004 Bacteria 997
132 Ga0307411_10443652 3300032005 Bacteria 1084
133 Ga0373939_0008607 3300035114 Bacteria 2505
134 Ga0395899_0003963 3300037312 Bacteria 11664
135 Ga0395900_0559641 3300037418 Bacteria 1087
136 Ga0395898_0001228 3300037466 Bacteria 38500
137 Ga0436364_1192512 3300037853 Bacteria 2277
138 Ga0436361_0743645 3300039447 Bacteria 72606
139 Ga0436361_1194971 3300039447 Bacteria 6643
140 Ga0466982_0000008 3300044672 Bacteria 240089
141 Ga0466965_0018734 3300044683 Bacteria 3321
142 Ga0466965_0135415 3300044683 Bacteria 1279
143 Ga0466966_0019664 3300044684 Bacteria 4442
144 Ga0466966_0127813 3300044684 Bacteria 1557
145 Ga0466961_0179684 3300044693 Bacteria 1314
146 Ga0466963_0054830 3300044694 Bacteria 2651
147 Ga0466964_0011677 3300044706 Bacteria 3321
148 Ga0466964_0034399 3300044706 Bacteria 2022
149 Ga0453684_0078912 3300044712 Bacteria 4117
150 Ga0466971_0021032 3300044719 Bacteria 2901
151 Ga0466968_0011505 3300044735 Bacteria 3448
152 Ga0466970_0104454 3300044765 Bacteria 1544
153 Ga0466957_0004850 3300044842 Bacteria 7526
154 Ga0466957_0056128 3300044842 Bacteria 2408
155 Ga0466960_0014238 3300044901 Bacteria 3399
156 Ga0466959_0217988 3300045049 Bacteria 1324
157 Ga0466958_0193863 3300045836 Bacteria 1292
158 Ga0466967_0038044 3300045976 Bacteria 4123
159 Ga0466967_0202264 3300045976 Bacteria 1882
160 Ga0466967_0417822 3300045976 Bacteria 1307
161 Ga0495617_000507 3300046452 Bacteria 20393
162 Ga0495627_011069 3300046453 Bacteria 3250
163 Ga0495591_000006 3300046458 Bacteria 390570
164 Ga0495591_008937 3300046458 Bacteria 4039
165 Ga0495638_0004985 3300046460 Bacteria 9959
166 Ga0495650_0000621 3300046471 Bacteria 47774
167 Ga0495650_0002603 3300046471 Bacteria 14165
168 Ga0495650_0009218 3300046471 Bacteria 5644
169 Ga0495580_0013007 3300046472 Bacteria 6372
170 Ga0495605_0000002 3300046474 Bacteria 522417
171 Ga0495605_0002910 3300046474 Bacteria 10387
172 Ga0495639_0021512 3300046475 Bacteria 2824
173 Ga0495585_0003300 3300046492 Bacteria 10957
174 Ga0495585_0086869 3300046492 Bacteria 1689
175 Ga0495594_0002064 3300046499 Bacteria 10462
176 Ga0495607_0000003 3300046501 Bacteria 366900
177 Ga0495607_0007816 3300046501 Bacteria 7360
178 Ga0495583_0000012 3300046506 Bacteria 324839
179 Ga0495583_0000384 3300046506 Bacteria 68323
180 Ga0495583_0004906 3300046506 Bacteria 9307
181 Ga0495606_0000004 3300046507 Bacteria 406209
182 Ga0495606_0000492 3300046507 Bacteria 64591
183 Ga0495606_0000699 3300046507 Bacteria 52011
184 Ga0495606_0012781 3300046507 Bacteria 6689
185 Ga0495610_0000007 3300046512 Bacteria 820919
186 Ga0495610_0000686 3300046512 Bacteria 32653
187 Ga0495610_0002791 3300046512 Bacteria 14302
188 Ga0495610_0006247 3300046512 Bacteria 8260
189 Ga0495610_0009777 3300046512 Bacteria 6026
190 Ga0495610_0020524 3300046512 Bacteria 3666
191 Ga0495620_0000010 3300046515 Bacteria 173604
192 Ga0495620_0075156 3300046515 Bacteria 1375
193 Ga0495620_0101128 3300046515 Bacteria 1149
194 Ga0495630_0000767 3300046517 Bacteria 22529
195 Ga0495631_0000021 3300046518 Bacteria 92765
196 Ga0495631_0003114 3300046518 Bacteria 9141
197 Ga0495632_0000077 3300046519 Bacteria 100834
198 Ga0495632_0000337 3300046519 Bacteria 44677
199 Ga0495632_0006738 3300046519 Bacteria 7345
200 Ga0495637_0005077 3300046520 Bacteria 6753
201 Ga0495637_0020821 3300046520 Bacteria 3011
202 Ga0495643_0000234 3300046522 Bacteria 84022
203 Ga0495648_0000489 3300046524 Bacteria 42541
204 Ga0495648_0021321 3300046524 Bacteria 4490
205 Ga0495648_0039678 3300046524 Bacteria 2993
206 Ga0495663_0094839 3300046525 Bacteria 976
207 Ga0495666_0031142 3300046526 Bacteria 2615
208 Ga0495654_0000094 3300046530 Bacteria 100820
209 Ga0495654_0000362 3300046530 Bacteria 39403
210 Ga0495654_0003590 3300046530 Bacteria 9445
211 Ga0495654_0005583 3300046530 Bacteria 7279
212 Ga0495654_0045375 3300046530 Bacteria 2169
213 Ga0495654_0096910 3300046530 Bacteria 1362
214 Ga0495665_0132169 3300046531 Bacteria 1306
215 Ga0495609_0000008 3300046538 Bacteria 383025
216 Ga0495609_0007254 3300046538 Bacteria 5556
217 Ga0495621_0002561 3300046539 Bacteria 4904
218 Ga0495597_0000366 3300046542 Bacteria 39958
219 Ga0495633_0000009 3300046558 Bacteria 293183
220 Ga0495633_0002307 3300046558 Bacteria 13601
221 Ga0495633_0010481 3300046558 Bacteria 5054
222 Ga0495633_0019405 3300046558 Bacteria 3439
223 Ga0495633_0035829 3300046558 Bacteria 2381
224 Ga0495668_0000156 3300046616 Bacteria 103647
225 Ga0495668_0001769 3300046616 Bacteria 19741
226 Ga0495668_0045273 3300046616 Bacteria 2446
227 Ga0495668_0110254 3300046616 Bacteria 1505
228 Ga0495611_0002848 3300046648 Bacteria 7730
229 Ga0495625_0030062 3300046660 Bacteria 4056
230 Ga0495625_0193847 3300046660 Bacteria 1344
231 Ga0495625_0413786 3300046660 Bacteria 840
232 Ga0495661_0000029 3300046665 Bacteria 173899
233 Ga0495661_0000683 3300046665 Bacteria 33827
234 Ga0495661_0021283 3300046665 Bacteria 4230
235 Ga0495670_0009620 3300046691 Bacteria 4747
236 Ga0495670_0017834 3300046691 Bacteria 3496
237 Ga0495671_0050775 3300046692 Bacteria 2064
238 Ga0495671_0059935 3300046692 Bacteria 1879
239 Ga0495649_0000162 3300046694 Bacteria 58169
240 Ga0495649_0001478 3300046694 Bacteria 17648
241 Ga0495589_0048462 3300046794 Bacteria 2103
242 Ga0495660_0002624 3300046810 Bacteria 11418
243 Ga0495674_0023642 3300047319 Bacteria 5659
244 Ga0495672_0000226 3300047320 Bacteria 80307
245 Ga0495683_0000039 3300047323 Bacteria 137702
246 Ga0495683_0008384 3300047323 Bacteria 5537
247 Ga0495677_0014895 3300047445 Bacteria 2828
248 Ga0495679_000409 3300047446 Bacteria 32107
249 Ga0495679_003032 3300047446 Bacteria 8252
250 Ga0495679_013034 3300047446 Bacteria 3137
251 Ga0495679_016690 3300047446 Bacteria 2650
252 Ga0495673_0000008 3300047469 Bacteria 752462
253 Ga0495673_0000031 3300047469 Bacteria 447868
254 Ga0495673_0000032 3300047469 Bacteria 375856
255 Ga0495673_0004920 3300047469 Bacteria 8224
256 Ga0495681_0006910 3300047470 Bacteria 7362
257 Ga0495686_0000257 3300047472 Bacteria 95410
258 Ga0495686_0012000 3300047472 Bacteria 6088
259 Ga0495593_0079085 3300047673 Bacteria 1702
260 Ga0495602_0094664 3300048088 Bacteria 2468
261 Ga0495626_0000003 3300048091 Bacteria 427774
262 Ga0496104_0082949 3300048907 Bacteria 3057
263 Ga0496105_0071138 3300048908 Bacteria 2875
264 Ga0496108_0764102 3300048911 Bacteria 835
265 Ga0496110_0320413 3300048913 Unclassified 1412
266 Ga0496116_0068754 3300048919 Bacteria 2255
267 Ga0496117_0051636 3300048920 Bacteria 2904
268 Ga0496117_0056913 3300048920 Bacteria 2719
269 Ga0496118_0005013 3300048921 Bacteria 15296
270 Ga0496119_0000030 3300048922 Bacteria 240167
271 Ga0496120_0000033 3300048923 Bacteria 218355
272 Ga0496121_0141702 3300048924 Unclassified 1782
273 Ga0496121_0177914 3300048924 Bacteria 1538
274 Ga0496122_0026777 3300048925 Bacteria 4956
275 Ga0496122_0038657 3300048925 Bacteria 3817
276 Ga0496123_0002591 3300048926 Bacteria 21992
277 Ga0496123_0019176 3300048926 Bacteria 5398
278 Ga0496123_0031463 3300048926 Bacteria 3859
279 Ga0496123_0033455 3300048926 Bacteria 3699
280 Ga0496123_0042628 3300048926 Bacteria 3129
281 Ga0496124_0000006 3300048927 Bacteria 904259
282 Ga0496124_0000840 3300048927 Bacteria 50101
283 Ga0496124_0000893 3300048927 Bacteria 48172
284 Ga0496124_0006231 3300048927 Bacteria 13068
285 Ga0496124_0010122 3300048927 Bacteria 9602
286 Ga0496124_0047576 3300048927 Bacteria 3669
287 Ga0496124_0144149 3300048927 Bacteria 1876
288 Ga0496125_0012035 3300048928 Bacteria 8612
289 Ga0496125_0071653 3300048928 Bacteria 2706
290 Ga0496125_0111492 3300048928 Bacteria 1979
291 Ga0496125_0132240 3300048928 Bacteria 1754
292 Ga0496125_0262011 3300048928 Bacteria 1083
293 Ga0496126_0041659 3300048929 Bacteria 4248
294 Ga0496126_0095844 3300048929 Bacteria 2602
295 Ga0495678_000011 3300049459 Bacteria 335512
296 Ga0495678_000130 3300049459 Bacteria 88909
297 Ga0495682_0005089 3300049460 Bacteria 5513
298 Ga0500562_025824 3300053108 Bacteria 1538
299 Ga0500592_009605 3300053116 Bacteria 1539
300 Ga0500594_0000966 3300053118 Bacteria 6178
301 Ga0500618_000299 3300053125 Bacteria 37630
302 Ga0500618_004657 3300053125 Bacteria 4321
303 Ga0500626_021764 3300053128 Bacteria 2862
304 Ga0500658_0000293 3300053134 Bacteria 22584
305 Ga0500559_0001898 3300053136 Bacteria 11325
306 Ga0500559_0006334 3300053136 Bacteria 5344
307 Ga0500559_0019146 3300053136 Bacteria 2893
308 Ga0500573_0007147 3300053140 Bacteria 6075
309 Ga0500586_002338 3300053145 Bacteria 4250
310 Ga0500586_002756 3300053145 Bacteria 4035
311 Ga0500616_0229029 3300053153 Bacteria 805
312 Ga0500622_0004400 3300053156 Bacteria 8871
313 Ga0500622_0050297 3300053156 Bacteria 2147
314 Ga0466962_0002157 3300061719 Bacteria 9297
315 Ga0466962_0010947 3300061719 Bacteria 4363

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100343219 Ga0070665_1003432191 214
2 3300046452 Ga0495617_000507 Ga0495617_000507_15692_16429 225
3 3300046524 Ga0495648_0039678 Ga0495648_0039678_1442_2179 225
4 3300046530 Ga0495654_0003590 Ga0495654_0003590_7612_8349 225
5 3300047469 Ga0495673_0000032 Ga0495673_0000032_85584_86321 225
6 3300053145 Ga0500586_002338 Ga0500586_002338_629_1366 225
7 3300003784 Ga0055534_1020412 Ga0055534_10204122 228
8 3300025291 Ga0209675_1001568 Ga0209675_100156817 228
9 3300025294 Ga0209025_1037763 Ga0209025_10377632 228
10 3300025292 Ga0209676_1010692 Ga0209676_10106924 229
11 3300048920 Ga0496117_0056913 Ga0496117_0056913_1720_2490 229
12 3300048928 Ga0496125_0071653 Ga0496125_0071653_578_1348 229
13 3300003316 rootH1_10043751 rootH1_100437516 231
14 3300005262 Ga0065165_1000562 Ga0065165_100056232 231
15 3300003322 rootL2_10170830 rootL2_101708302 233
16 iso_pu_bacteria 2738541297 2738827476 239
17 iso_pu_bacteria 2738541357 2739151272 239
18 iso_pu_bacteria 2738543003 2739193192 239
19 iso_pu_bacteria 2738543026 2739319668 239
20 iso_pu_bacteria 2738543029 2739337909 239
21 3300028800 Ga0265338_10000120 Ga0265338_1000012098 240
22 iso_pu_bacteria 2511231025 2511381949 240
23 iso_pu_bacteria 2511231035 2511437775 240
24 iso_pu_bacteria 2521172590 2521558406 240
25 iso_pu_bacteria 2593339239 2595451100 240
26 iso_pu_bacteria 2599185236 2599719543 240
27 iso_pu_bacteria 2643221577 2643894130 240
28 iso_pu_bacteria 2643221639 2644218178 240
29 iso_pu_bacteria 2643221646 2644256967 240
30 iso_pu_bacteria 2643221685 2644476333 240
31 iso_pu_bacteria 2818991449 2819614362 240
32 iso_pu_bacteria 2842914999 2842916632 240
33 iso_pu_bacteria 2857558681 2857560768 240
34 iso_pu_bacteria 2904439833 2904445058 240
35 iso_pu_bacteria 2904530477 2904534113 240
36 iso_pu_bacteria 2904584206 2904589045 240
37 iso_pu_bacteria 2904589729 2904590474 240
38 iso_pu_bacteria 2904601388 2904603652 240
39 iso_pu_bacteria 2919046199 2919046840 240
40 iso_pu_bacteria 2919079590 2919080335 240
41 iso_pu_bacteria 2928130867 2928131621 240
42 iso_pu_bacteria 2939602548 2939605375 240
43 3300005563 Ga0068855_100005393 Ga0068855_1000053938 241
44 3300009011 Ga0105251_10077644 Ga0105251_100776442 241
45 3300025949 Ga0207667_10005459 Ga0207667_100054596 241
46 iso_pu_bacteria 2595698237 2596375976 241
47 iso_pu_bacteria 2636415599 2637224956 241
48 iso_pu_bacteria 2775507074 2777022010 241
49 iso_pu_bacteria 2856287931 2856292965 241
50 iso_pu_bacteria 2857357740 2857362134 241
51 iso_pu_bacteria 2857564685 2857569123 241
52 iso_pu_bacteria 2889306138 2889309636 241
53 iso_pu_bacteria 2904513164 2904514163 241
54 iso_pu_bacteria 2919171160 2919174977 241
55 iso_pu_bacteria 2928084124 2928089101 241
56 iso_pu_bacteria 2928125067 2928130396 241
57 iso_pu_bacteria 2969079654 2969081943 241
58 iso_pu_bacteria 2984499530 2984503153 241
59 iso_pu_bacteria 2984559226 2984564377 241
60 iso_pu_bacteria 2984595703 2984597110 241
61 3300003771 Ga0055526_1000884 Ga0055526_10008843 242
62 3300005548 Ga0070665_100006317 Ga0070665_10000631710 242
63 3300009011 Ga0105251_10031058 Ga0105251_100310583 242
64 3300009036 Ga0105244_10002612 Ga0105244_100026128 242
65 3300025295 Ga0209564_1000028 Ga0209564_100002833 242
66 3300025728 Ga0207655_1024023 Ga0207655_10240232 242
67 3300028379 Ga0268266_10000043 Ga0268266_10000043264 242
68 3300035114 Ga0373939_0008607 Ga0373939_0008607_779_1510 242
69 3300046453 Ga0495627_011069 Ga0495627_011069_1337_2098 242
70 3300046458 Ga0495591_008937 Ga0495591_008937_948_1709 242
71 3300046471 Ga0495650_0002603 Ga0495650_0002603_9461_10192 242
72 3300046471 Ga0495650_0009218 Ga0495650_0009218_3763_4524 242
73 3300046474 Ga0495605_0000002 Ga0495605_0000002_257186_257947 242
74 3300046499 Ga0495594_0002064 Ga0495594_0002064_4343_5104 242
75 3300046506 Ga0495583_0000012 Ga0495583_0000012_163626_164387 242
76 3300046507 Ga0495606_0000004 Ga0495606_0000004_342435_343166 242
77 3300046512 Ga0495610_0002791 Ga0495610_0002791_1579_2310 242
78 3300046515 Ga0495620_0000010 Ga0495620_0000010_172646_173407 242
79 3300046518 Ga0495631_0003114 Ga0495631_0003114_1304_2065 242
80 3300046524 Ga0495648_0000489 Ga0495648_0000489_21039_21800 242
81 3300046530 Ga0495654_0000362 Ga0495654_0000362_30368_31129 242
82 3300046538 Ga0495609_0000008 Ga0495609_0000008_218577_219338 242
83 3300046542 Ga0495597_0000366 Ga0495597_0000366_30568_31329 242
84 3300046558 Ga0495633_0000009 Ga0495633_0000009_239373_240134 242
85 3300046558 Ga0495633_0010481 Ga0495633_0010481_2112_2843 242
86 3300046616 Ga0495668_0000156 Ga0495668_0000156_62199_62930 242
87 3300046648 Ga0495611_0002848 Ga0495611_0002848_6378_7121 242
88 3300046665 Ga0495661_0000029 Ga0495661_0000029_40761_41522 242
89 3300046691 Ga0495670_0009620 Ga0495670_0009620_3039_3800 242
90 3300046694 Ga0495649_0000162 Ga0495649_0000162_17975_18709 242
91 3300046794 Ga0495589_0048462 Ga0495589_0048462_339_1100 242
92 3300046810 Ga0495660_0002624 Ga0495660_0002624_10633_11394 242
93 3300047323 Ga0495683_0000039 Ga0495683_0000039_100988_101749 242
94 3300047446 Ga0495679_000409 Ga0495679_000409_16978_17721 242
95 3300047469 Ga0495673_0000008 Ga0495673_0000008_447128_447856 242
96 3300047469 Ga0495673_0004920 Ga0495673_0004920_357_1118 242
97 3300047470 Ga0495681_0006910 Ga0495681_0006910_5262_6023 242
98 3300047472 Ga0495686_0012000 Ga0495686_0012000_640_1371 242
99 3300048926 Ga0496123_0031463 Ga0496123_0031463_2898_3659 242
100 3300048927 Ga0496124_0006231 Ga0496124_0006231_11014_11748 242
101 3300048927 Ga0496124_0047576 Ga0496124_0047576_2893_3624 242
102 3300048927 Ga0496124_0144149 Ga0496124_0144149_607_1338 242
103 3300048928 Ga0496125_0111492 Ga0496125_0111492_522_1253 242
104 3300049459 Ga0495678_000011 Ga0495678_000011_232423_233184 242
105 iso_pu_bacteria 2585427591 2585827244 242
106 iso_pu_bacteria 2585427592 2585833446 242
107 iso_pu_bacteria 2941471342 2941475252 242
108 3300003323 rootH1_10045939 rootH1_100459394 243
109 3300028794 Ga0307515_10144424 Ga0307515_101444242 243
110 3300037312 Ga0395899_0003963 Ga0395899_0003963_5998_6735 243
111 3300037418 Ga0395900_0559641 Ga0395900_0559641_189_926 243
112 3300044693 Ga0466961_0179684 Ga0466961_0179684_496_1233 243
113 3300046492 Ga0495585_0003300 Ga0495585_0003300_1513_2250 243
114 3300046507 Ga0495606_0000492 Ga0495606_0000492_3635_4372 243
115 3300046512 Ga0495610_0000007 Ga0495610_0000007_290815_291552 243
116 3300046512 Ga0495610_0000686 Ga0495610_0000686_22672_23403 243
117 3300046512 Ga0495610_0006247 Ga0495610_0006247_5110_5847 243
118 3300046522 Ga0495643_0000234 Ga0495643_0000234_48448_49179 243
119 3300046538 Ga0495609_0007254 Ga0495609_0007254_1044_1775 243
120 3300046558 Ga0495633_0002307 Ga0495633_0002307_7278_8015 243
121 3300046558 Ga0495633_0035829 Ga0495633_0035829_557_1294 243
122 3300046616 Ga0495668_0001769 Ga0495668_0001769_15131_15868 243
123 3300046660 Ga0495625_0030062 Ga0495625_0030062_1138_1869 243
124 3300046692 Ga0495671_0050775 Ga0495671_0050775_1060_1791 243
125 3300046692 Ga0495671_0059935 Ga0495671_0059935_838_1575 243
126 3300046694 Ga0495649_0001478 Ga0495649_0001478_14079_14810 243
127 3300047320 Ga0495672_0000226 Ga0495672_0000226_11036_11767 243
128 3300047323 Ga0495683_0008384 Ga0495683_0008384_3762_4499 243
129 3300047445 Ga0495677_0014895 Ga0495677_0014895_1347_2078 243
130 3300047446 Ga0495679_013034 Ga0495679_013034_174_911 243
131 3300047446 Ga0495679_016690 Ga0495679_016690_1879_2616 243
132 3300047469 Ga0495673_0000031 Ga0495673_0000031_393900_394637 243
133 3300048926 Ga0496123_0002591 Ga0496123_0002591_20004_20741 243
134 3300049459 Ga0495678_000130 Ga0495678_000130_15412_16143 243
135 3300053145 Ga0500586_002756 Ga0500586_002756_1572_2309 243
136 3300003322 rootL2_10318290 rootL2_103182901 244
137 3300003323 rootH1_10255600 rootH1_102556002 244
138 3300003752 Ga0055539_1000002 Ga0055539_1000002154 244
139 3300003756 Ga0055533_1000004 Ga0055533_1000004154 244
140 3300003759 Ga0055525_1000002 Ga0055525_1000002154 244
141 3300003761 Ga0055535_1000102 Ga0055535_100010287 244
142 3300003762 Ga0055542_1000147 Ga0055542_100014731 244
143 3300003841 Ga0055541_1000002 Ga0055541_1000002688 244
144 3300003856 Ga0058692_1000208 Ga0058692_10002086 244
145 3300003856 Ga0058692_1000255 Ga0058692_100025525 244
146 3300003856 Ga0058692_1001754 Ga0058692_10017542 244
147 3300003856 Ga0058692_1001812 Ga0058692_10018127 244
148 3300005563 Ga0068855_100001647 Ga0068855_10000164725 244
149 3300005563 Ga0068855_100051533 Ga0068855_1000515332 244
150 3300005577 Ga0068857_100293957 Ga0068857_1002939572 244
151 3300005578 Ga0068854_100363580 Ga0068854_1003635802 244
152 3300005614 Ga0068856_100145228 Ga0068856_1001452282 244
153 3300009036 Ga0105244_10039486 Ga0105244_100394863 244
154 3300009545 Ga0105237_10022139 Ga0105237_100221394 244
155 3300009551 Ga0105238_10020754 Ga0105238_100207544 244
156 3300010375 Ga0105239_10054086 Ga0105239_100540865 244
157 3300010375 Ga0105239_10537699 Ga0105239_105376992 244
158 3300011119 Ga0105246_10354926 Ga0105246_103549261 244
159 3300015261 Ga0182006_1005409 Ga0182006_10054094 244
160 3300015265 Ga0182005_1007823 Ga0182005_10078233 244
161 3300021361 Ga0213872_10000282 Ga0213872_1000028229 244
162 3300021361 Ga0213872_10001060 Ga0213872_100010603 244
163 3300025224 Ga0209784_100002 Ga0209784_100002388 244
164 3300025225 Ga0209566_100003 Ga0209566_100003388 244
165 3300025226 Ga0209674_100004 Ga0209674_100004388 244
166 3300025228 Ga0209672_100207 Ga0209672_10020740 244
167 3300025230 Ga0209563_100006 Ga0209563_100006388 244
168 3300025242 Ga0209258_100111 Ga0209258_10011130 244
169 3300025253 Ga0209677_100003 Ga0209677_100003388 244
170 3300025254 Ga0209148_1000099 Ga0209148_1000099183 244
171 3300025258 Ga0209129_1000431 Ga0209129_100043120 244
172 3300025272 Ga0209455_1003866 Ga0209455_10038662 244
173 3300025299 Ga0209256_1012519 Ga0209256_10125192 244
174 3300025728 Ga0207655_1016353 Ga0207655_10163533 244
175 3300025914 Ga0207671_10010798 Ga0207671_100107983 244
176 3300025924 Ga0207694_10011441 Ga0207694_100114414 244
177 3300025949 Ga0207667_10000032 Ga0207667_10000032196 244
178 3300025949 Ga0207667_10076980 Ga0207667_100769802 244
179 3300027312 Ga0209371_1000017 Ga0209371_1000017325 244
180 3300027312 Ga0209371_1000134 Ga0209371_1000134125 244
181 3300027312 Ga0209371_1007453 Ga0209371_10074535 244
182 3300027312 Ga0209371_1010697 Ga0209371_10106974 244
183 3300028794 Ga0307515_10097652 Ga0307515_100976521 244
184 3300030500 Ga0268256_1000208 Ga0268256_100020815 244
185 3300030500 Ga0268256_1001351 Ga0268256_10013514 244
186 3300030500 Ga0268256_1006979 Ga0268256_10069794 244
187 3300030500 Ga0268256_1007670 Ga0268256_10076702 244
188 3300037466 Ga0395898_0001228 Ga0395898_0001228_23194_23934 244
189 3300037853 Ga0436364_1192512 Ga0436364_1192512_855_1598 244
190 3300039447 Ga0436361_0743645 Ga0436361_0743645_1222_1962 244
191 3300044672 Ga0466982_0000008 Ga0466982_0000008_133528_134283 244
192 3300044683 Ga0466965_0135415 Ga0466965_0135415_306_1061 244
193 3300044684 Ga0466966_0127813 Ga0466966_0127813_533_1288 244
194 3300044706 Ga0466964_0011677 Ga0466964_0011677_2420_3175 244
195 3300044712 Ga0453684_0078912 Ga0453684_0078912_355_1107 244
196 3300044735 Ga0466968_0011505 Ga0466968_0011505_2615_3370 244
197 3300044901 Ga0466960_0014238 Ga0466960_0014238_1799_2554 244
198 3300045049 Ga0466959_0217988 Ga0466959_0217988_496_1251 244
199 3300045836 Ga0466958_0193863 Ga0466958_0193863_20_775 244
200 3300045976 Ga0466967_0417822 Ga0466967_0417822_355_1095 244
201 3300046458 Ga0495591_000006 Ga0495591_000006_290793_291539 244
202 3300046460 Ga0495638_0004985 Ga0495638_0004985_5006_5749 244
203 3300046472 Ga0495580_0013007 Ga0495580_0013007_3594_4337 244
204 3300046506 Ga0495583_0004906 Ga0495583_0004906_248_991 244
205 3300046517 Ga0495630_0000767 Ga0495630_0000767_16655_17398 244
206 3300046524 Ga0495648_0021321 Ga0495648_0021321_3130_3873 244
207 3300046526 Ga0495666_0031142 Ga0495666_0031142_1548_2291 244
208 3300046530 Ga0495654_0000094 Ga0495654_0000094_1534_2280 244
209 3300046530 Ga0495654_0005583 Ga0495654_0005583_4608_5366 244
210 3300046530 Ga0495654_0096910 Ga0495654_0096910_91_843 244
211 3300046531 Ga0495665_0132169 Ga0495665_0132169_140_883 244
212 3300046558 Ga0495633_0019405 Ga0495633_0019405_945_1688 244
213 3300046616 Ga0495668_0045273 Ga0495668_0045273_503_1249 244
214 3300046660 Ga0495625_0413786 Ga0495625_0413786_26_766 244
215 3300047319 Ga0495674_0023642 Ga0495674_0023642_1053_1796 244
216 3300047673 Ga0495593_0079085 Ga0495593_0079085_652_1395 244
217 3300048088 Ga0495602_0094664 Ga0495602_0094664_1433_2176 244
218 3300048907 Ga0496104_0082949 Ga0496104_0082949_1841_2584 244
219 3300048908 Ga0496105_0071138 Ga0496105_0071138_1614_2357 244
220 3300048920 Ga0496117_0051636 Ga0496117_0051636_576_1319 244
221 3300048921 Ga0496118_0005013 Ga0496118_0005013_3509_4252 244
222 3300048922 Ga0496119_0000030 Ga0496119_0000030_112715_113458 244
223 3300048923 Ga0496120_0000033 Ga0496120_0000033_126718_127461 244
224 3300048924 Ga0496121_0141702 Ga0496121_0141702_763_1506 244
225 3300048927 Ga0496124_0000840 Ga0496124_0000840_47367_48122 244
226 3300048927 Ga0496124_0000893 Ga0496124_0000893_47123_47878 244
227 3300048927 Ga0496124_0010122 Ga0496124_0010122_2765_3511 244
228 3300049460 Ga0495682_0005089 Ga0495682_0005089_3630_4382 244
229 3300053125 Ga0500618_004657 Ga0500618_004657_601_1344 244
230 3300053136 Ga0500559_0019146 Ga0500559_0019146_129_878 244
231 3300061719 Ga0466962_0002157 Ga0466962_0002157_3634_4389 244
232 iso_pu_bacteria 2562617112 2563055972 244
233 iso_pu_bacteria 2585428057 2587730336 244
234 iso_pu_bacteria 2600255067 2600812180 244
235 iso_pu_bacteria 2711768613 2713482452 244
236 iso_pu_bacteria 2831864461 2831868039 244
237 iso_pu_bacteria 2881412998 2881415206 244
238 3300002773 JGI25152J39213_1002275 JGI25152J39213_100227510 245
239 3300003215 JGI25153J46596_10000393 JGI25153J46596_1000039318 245
240 3300003215 JGI25153J46596_10013610 JGI25153J46596_100136105 245
241 3300003320 rootH2_10048846 rootH2_100488462 245
242 3300003771 Ga0055526_1000573 Ga0055526_100057311 245
243 3300003771 Ga0055526_1003157 Ga0055526_10031573 245
244 3300003781 Ga0055536_1022804 Ga0055536_10228042 245
245 3300003791 Ga0055530_10050293 Ga0055530_100502931 245
246 3300003794 Ga0055531_10002539 Ga0055531_100025395 245
247 3300004625 Ga0055543_1008160 Ga0055543_10081603 245
248 3300005262 Ga0065165_1000647 Ga0065165_100064711 245
249 3300005339 Ga0070660_100007498 Ga0070660_1000074983 245
250 3300005563 Ga0068855_100085349 Ga0068855_1000853492 245
251 3300005614 Ga0068856_100125652 Ga0068856_1001256522 245
252 3300006028 Ga0070717_10071467 Ga0070717_100714673 245
253 3300013100 Ga0157373_10028776 Ga0157373_100287762 245
254 3300013105 Ga0157369_10203884 Ga0157369_102038842 245
255 3300013307 Ga0157372_10482333 Ga0157372_104823332 245
256 3300016635 Ga0183361_10019 Ga0183361_1001947 245
257 3300017792 Ga0163161_10005918 Ga0163161_100059184 245
258 3300021361 Ga0213872_10201081 Ga0213872_102010811 245
259 3300025225 Ga0209566_101685 Ga0209566_1016852 245
260 3300025242 Ga0209258_101053 Ga0209258_1010536 245
261 3300025245 Ga0207425_1000203 Ga0207425_100020320 245
262 3300025246 Ga0209646_1006409 Ga0209646_10064092 245
263 3300025256 Ga0209759_1002827 Ga0209759_10028272 245
264 3300025258 Ga0209129_1000012 Ga0209129_1000012433 245
265 3300025273 Ga0209673_1005775 Ga0209673_10057752 245
266 3300025273 Ga0209673_1014662 Ga0209673_10146622 245
267 3300025292 Ga0209676_1030476 Ga0209676_10304762 245
268 3300025295 Ga0209564_1000021 Ga0209564_1000021383 245
269 3300025295 Ga0209564_1000022 Ga0209564_100002281 245
270 3300025297 Ga0209758_1000233 Ga0209758_100023380 245
271 3300025297 Ga0209758_1006383 Ga0209758_10063832 245
272 3300025298 Ga0209050_1010708 Ga0209050_10107086 245
273 3300025299 Ga0209256_1010215 Ga0209256_10102153 245
274 3300025303 Ga0209051_1001051 Ga0209051_100105112 245
275 3300025304 Ga0209257_1047966 Ga0209257_10479662 245
276 3300025913 Ga0207695_10668850 Ga0207695_106688501 245
277 3300025919 Ga0207657_10004105 Ga0207657_100041059 245
278 3300025949 Ga0207667_10069027 Ga0207667_100690272 245
279 3300026078 Ga0207702_10243254 Ga0207702_102432542 245
280 3300027312 Ga0209371_1002830 Ga0209371_100283010 245
281 3300027312 Ga0209371_1016623 Ga0209371_10166232 245
282 3300030500 Ga0268256_1000643 Ga0268256_10006438 245
283 3300030500 Ga0268256_1018922 Ga0268256_10189222 245
284 3300030521 Ga0307511_10109914 Ga0307511_101099142 245
285 3300031507 Ga0307509_10005684 Ga0307509_100056842 245
286 3300031616 Ga0307508_10013746 Ga0307508_100137465 245
287 3300031731 Ga0307405_10001325 Ga0307405_100013255 245
288 3300031995 Ga0307409_100326752 Ga0307409_1003267522 245
289 3300032004 Ga0307414_10188477 Ga0307414_101884772 245
290 3300039447 Ga0436361_1194971 Ga0436361_1194971_2093_2839 245
291 3300044683 Ga0466965_0018734 Ga0466965_0018734_1636_2385 245
292 3300044684 Ga0466966_0019664 Ga0466966_0019664_2657_3406 245
293 3300044694 Ga0466963_0054830 Ga0466963_0054830_1434_2183 245
294 3300044706 Ga0466964_0034399 Ga0466964_0034399_162_911 245
295 3300044719 Ga0466971_0021032 Ga0466971_0021032_541_1290 245
296 3300044765 Ga0466970_0104454 Ga0466970_0104454_774_1523 245
297 3300044842 Ga0466957_0004850 Ga0466957_0004850_6430_7188 245
298 3300044842 Ga0466957_0056128 Ga0466957_0056128_250_996 245
299 3300045976 Ga0466967_0038044 Ga0466967_0038044_2690_3484 245
300 3300045976 Ga0466967_0202264 Ga0466967_0202264_325_1071 245
301 3300046471 Ga0495650_0000621 Ga0495650_0000621_17323_18087 245
302 3300046474 Ga0495605_0002910 Ga0495605_0002910_6256_7020 245
303 3300046475 Ga0495639_0021512 Ga0495639_0021512_1608_2363 245
304 3300046492 Ga0495585_0086869 Ga0495585_0086869_41_805 245
305 3300046501 Ga0495607_0000003 Ga0495607_0000003_101859_102602 245
306 3300046501 Ga0495607_0007816 Ga0495607_0007816_3687_4451 245
307 3300046506 Ga0495583_0000384 Ga0495583_0000384_29979_30743 245
308 3300046507 Ga0495606_0000699 Ga0495606_0000699_49458_50210 245
309 3300046507 Ga0495606_0012781 Ga0495606_0012781_5363_6127 245
310 3300046512 Ga0495610_0009777 Ga0495610_0009777_890_1654 245
311 3300046512 Ga0495610_0020524 Ga0495610_0020524_2547_3308 245
312 3300046515 Ga0495620_0075156 Ga0495620_0075156_50_814 245
313 3300046515 Ga0495620_0101128 Ga0495620_0101128_94_855 245
314 3300046518 Ga0495631_0000021 Ga0495631_0000021_6563_7324 245
315 3300046519 Ga0495632_0000077 Ga0495632_0000077_27299_28045 245
316 3300046519 Ga0495632_0000337 Ga0495632_0000337_25803_26567 245
317 3300046519 Ga0495632_0006738 Ga0495632_0006738_2835_3608 245
318 3300046520 Ga0495637_0005077 Ga0495637_0005077_2439_3203 245
319 3300046520 Ga0495637_0020821 Ga0495637_0020821_187_948 245
320 3300046525 Ga0495663_0094839 Ga0495663_0094839_66_827 245
321 3300046530 Ga0495654_0045375 Ga0495654_0045375_992_1753 245
322 3300046539 Ga0495621_0002561 Ga0495621_0002561_853_1614 245
323 3300046616 Ga0495668_0110254 Ga0495668_0110254_664_1419 245
324 3300046660 Ga0495625_0193847 Ga0495625_0193847_377_1138 245
325 3300046665 Ga0495661_0000683 Ga0495661_0000683_510_1274 245
326 3300046665 Ga0495661_0021283 Ga0495661_0021283_1952_2698 245
327 3300046691 Ga0495670_0017834 Ga0495670_0017834_1354_2106 245
328 3300047446 Ga0495679_003032 Ga0495679_003032_7273_8019 245
329 3300047472 Ga0495686_0000257 Ga0495686_0000257_45998_46744 245
330 3300048091 Ga0495626_0000003 Ga0495626_0000003_119093_119839 245
331 3300048919 Ga0496116_0068754 Ga0496116_0068754_36_806 245
332 3300048924 Ga0496121_0177914 Ga0496121_0177914_81_851 245
333 3300048925 Ga0496122_0026777 Ga0496122_0026777_3150_3911 245
334 3300048926 Ga0496123_0019176 Ga0496123_0019176_4134_4904 245
335 3300048926 Ga0496123_0042628 Ga0496123_0042628_1718_2479 245
336 3300048927 Ga0496124_0000006 Ga0496124_0000006_421441_422196 245
337 3300048928 Ga0496125_0132240 Ga0496125_0132240_774_1535 245
338 3300048928 Ga0496125_0262011 Ga0496125_0262011_184_1017 245
339 3300048929 Ga0496126_0041659 Ga0496126_0041659_2247_3008 245
340 3300053108 Ga0500562_025824 Ga0500562_025824_60_821 245
341 3300053116 Ga0500592_009605 Ga0500592_009605_56_817 245
342 3300053118 Ga0500594_0000966 Ga0500594_0000966_4644_5405 245
343 3300053125 Ga0500618_000299 Ga0500618_000299_5910_6656 245
344 3300053128 Ga0500626_021764 Ga0500626_021764_1432_2187 245
345 3300053134 Ga0500658_0000293 Ga0500658_0000293_12524_13285 245
346 3300053136 Ga0500559_0001898 Ga0500559_0001898_6933_7688 245
347 3300053136 Ga0500559_0006334 Ga0500559_0006334_1398_2153 245
348 3300053140 Ga0500573_0007147 Ga0500573_0007147_151_897 245
349 3300053153 Ga0500616_0229029 Ga0500616_0229029_45_794 245
350 3300053156 Ga0500622_0004400 Ga0500622_0004400_5797_6549 245
351 3300053156 Ga0500622_0050297 Ga0500622_0050297_561_1313 245
352 3300061719 Ga0466962_0010947 Ga0466962_0010947_3088_3837 245
353 iso_pu_bacteria 2599185169 2599409057 245
354 iso_pu_bacteria 2600255254 2601522436 245
355 iso_pu_bacteria 2600255255 2601527463 245
356 iso_pu_bacteria 2600255280 2601614293 245
357 iso_pu_bacteria 2600255281 2601619014 245
358 iso_pu_bacteria 2600255287 2601642380 245
359 iso_pu_bacteria 2600255288 2601647228 245
360 iso_pu_bacteria 2600255289 2601652440 245
361 iso_pu_bacteria 2600255290 2601657767 245
362 iso_pu_bacteria 2600255291 2601662203 245
363 iso_pu_bacteria 2600255298 2601695161 245
364 iso_pu_bacteria 2600255299 2601699833 245
365 iso_pu_bacteria 2600255300 2601706286 245
366 iso_pu_bacteria 2600255301 2601710592 245
367 iso_pu_bacteria 2600255302 2601715606 245
368 iso_pu_bacteria 2600255303 2601720184 245
369 iso_pu_bacteria 2600255304 2601726011 245
370 iso_pu_bacteria 2600255305 2601730552 245
371 iso_pu_bacteria 2600255306 2601735569 245
372 iso_pu_bacteria 2600255307 2601740827 245
373 iso_pu_bacteria 2600255309 2601750757 245
374 iso_pu_bacteria 2600255392 2602018011 245
375 iso_pu_bacteria 2602042052 2603659568 245
376 iso_pu_bacteria 2602042053 2603664844 245
377 iso_pu_bacteria 2602042103 2603837943 245
378 iso_pu_bacteria 2602042104 2603843021 245
379 iso_pu_bacteria 2602042105 2603848094 245
380 iso_pu_bacteria 2602042106 2603853165 245
381 iso_pu_bacteria 2602042110 2603871220 245
382 iso_pu_bacteria 2602042111 2603876135 245
383 iso_pu_bacteria 2603880178 2606048413 245
384 iso_pu_bacteria 2603880184 2606069271 245
385 iso_pu_bacteria 2603880202 2606145080 245
386 iso_pu_bacteria 2603880211 2606175814 245
387 iso_pu_bacteria 2675903046 2676406197 245
388 iso_pu_bacteria 2738541307 2738881384 245
389 3300001904 JGI24736J21556_1001580 JGI24736J21556_10015805 246
390 3300005289 Ga0065704_10074345 Ga0065704_100743457 246
391 3300013104 Ga0157370_10009472 Ga0157370_100094727 246
392 3300013105 Ga0157369_10016891 Ga0157369_100168916 246
393 3300025904 Ga0207647_10000002 Ga0207647_10000002250 246
394 3300032004 Ga0307414_10588116 Ga0307414_105881161 246
395 3300032005 Ga0307411_10443652 Ga0307411_104436522 246
396 3300048911 Ga0496108_0764102 Ga0496108_0764102_29_769 246
397 3300048913 Ga0496110_0320413 Ga0496110_0320413_83_829 246
398 3300048925 Ga0496122_0038657 Ga0496122_0038657_1477_2217 246
399 3300048926 Ga0496123_0033455 Ga0496123_0033455_2857_3597 246
400 3300048928 Ga0496125_0012035 Ga0496125_0012035_510_1250 246
401 3300048929 Ga0496126_0095844 Ga0496126_0095844_1834_2574 246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

2

186

0.94

PF08659

KR

KR domain

2

170

0.88

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

4

233

0.83

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

8

234

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7do6-assembly2.cif.gz_G crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase(nadp bound-form) 0.9286 2 171
7e6o-assembly1.cif.gz_D crystal structure of polyol dehydrogenase from paracoccus denitrificans 0.9122 2 172
1gz6-assembly1.cif.gz_B (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 0.9054 2 170
1w8d-assembly1.cif.gz_B binary structure of human decr. 0.9029 2 175
2ehd-assembly1.cif.gz_A crystal structure analysis of oxidoreductase 0.8978 2 238
ID Description Score Start End Superfamily
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9307 78 175 3.40.50.720
af_Q0E0D3_22_224_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9239 1 171 3.40.50.720
af_Q0D3U8_30_207_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9216 2 154 3.40.50.720
af_B4FAP3_11_264_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9194 1 243 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9127 2 180 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A436QX60-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9961 1 166 GO:0000140
GO:0004806
GO:0005811
GO:0006654
GO:0019433
AF-A0A519EUK1-F1-model_v4 SDR family oxidoreductase 0.9944 1 203 GO:0016491
AF-A0A436QX60-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9901 1 166 GO:0000140
GO:0004806
GO:0005811
GO:0006654
GO:0019433
AF-A0A7X2HSB6-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.989 32 223 GO:0005829
GO:0016491
AF-F7SBZ5-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9881 49 245 GO:0016491

Feature Viewer

pLDDT pTM Quality
93.03 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map