F434731

General Info

Members Datasets Scaffolds Average Seq Length
401 220 390 290

Family's Representative Sequence

Representative Sequence 3300001904|JGI24736J21556_1000401|JGI24736J21556_10004015
Length 303
Sequence MTTSDHSPDTGRRAALGQLATAVAAFGAAPLLASAETLPGKAATGKVGPGRLKQSLSRWTSKAPLPELCKRLKTLGFVGVDLLYTDEWNTVIDSGLTVTMGYPAKRDNFIEFGFNDPANHAQLLKELEATIPLAKKAGVPNVITMFGNRKAGIDDRQALDNCIAGLSKIAPLAAENGITVCVELLNSKVDHHGYQGDSTKFGAEVMKGVGSPNVKLLYDIYHMQIMEGDVIRTIRDNIQWIGHFHTGGVPGRHEIDGTQELNYHAVAKAVADLNYQGYIAHEFMPARPDSFESFAEAFKICTV

Samples

Sample ID Description Type Environment
1 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
2 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
3 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
4 2738543009 Luteibacter sp. OK325 Isolate Unclassified
5 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
6 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
7 2884411467 Dyella sp. AD56 Isolate Rhizosphere
8 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
9 2919085039 Luteibacter sp. 1214 Isolate Unclassified
10 2928963466 Dyella japonica 1073 Isolate Unclassified
11 2941471342 Luteibacter sp. 621 Isolate Unclassified
12 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
17 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
18 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
19 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
20 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
21 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
22 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
25 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
26 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
27 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
28 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
29 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
30 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
31 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
32 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
78 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
79 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
89 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
90 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
93 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
94 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
95 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
133 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
134 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
135 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
148 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
152 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
153 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
154 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
155 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
156 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
157 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
158 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
159 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
160 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
167 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
168 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
169 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
170 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
171 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
172 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
181 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
189 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
216 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
217 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
220 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.26
Metatranscriptomes 0
Isolates 2.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.2
Nodule 0
Rhizoplane 2
Rhizosphere 63.09
Stem 0
Stem Tuber 0
Unclassified 14.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000401 3300001904 Bacteria 8141
2 JGI24740J21852_10024469 3300001979 Bacteria 2048
3 JGI24739J22299_10002765 3300001989 Bacteria 6747
4 JGI24739J22299_10029628 3300001989 Bacteria 1902
5 JGI24737J22298_10008820 3300001990 Bacteria 3367
6 JGI24735J21928_10002480 3300002067 Bacteria 6403
7 JGI25156J39149_1010852 3300002705 Bacteria 2108
8 JGI25162J39368_1000018 3300002737 Bacteria 277875
9 JGI25162J39368_1001353 3300002737 Bacteria 13563
10 JGI25157J39369_1000011 3300002741 Bacteria 206831
11 JGI25157J39369_1000139 3300002741 Bacteria 61206
12 JGI25157J39369_1005378 3300002741 Bacteria 2101
13 JGI25163J39215_1000293 3300002771 Bacteria 17118
14 JGI25164J39214_1000007 3300002772 Bacteria 312507
15 JGI25164J39214_1000030 3300002772 Bacteria 145974
16 JGI25165J46597_1000029 3300003214 Bacteria 312507
17 JGI25165J46597_1000057 3300003214 Bacteria 217135
18 JGI25153J46596_10015231 3300003215 Bacteria 3146
19 rootH2_10013011 3300003320 Bacteria 15439
20 Ga0055538_1002133 3300003751 Bacteria 3113
21 Ga0055539_1004265 3300003752 Bacteria 1913
22 Ga0055533_1003002 3300003756 Bacteria 3600
23 Ga0055525_1000013 3300003759 Bacteria 440870
24 Ga0055525_1000027 3300003759 Bacteria 340506
25 Ga0055527_1000054 3300003760 Bacteria 100670
26 Ga0055527_1000244 3300003760 Bacteria 33673
27 Ga0055535_1000025 3300003761 Bacteria 213549
28 Ga0055535_1000204 3300003761 Bacteria 62769
29 Ga0055535_1000473 3300003761 Bacteria 36624
30 Ga0055535_1000560 3300003761 Bacteria 31728
31 Ga0055535_1000628 3300003761 Bacteria 28228
32 Ga0055542_1000010 3300003762 Bacteria 414813
33 Ga0055542_1000024 3300003762 Bacteria 277875
34 Ga0055542_1000083 3300003762 Bacteria 126426
35 Ga0055542_1000243 3300003762 Bacteria 62769
36 Ga0055542_1000278 3300003762 Bacteria 57321
37 Ga0055542_1000359 3300003762 Bacteria 47683
38 Ga0055529_1000029 3300003763 Bacteria 277978
39 Ga0055529_1000137 3300003763 Bacteria 103695
40 Ga0055529_1000299 3300003763 Bacteria 57321
41 Ga0055529_1000942 3300003763 Bacteria 15411
42 Ga0065165_1000399 3300005262 Bacteria 70029
43 Ga0065165_1009476 3300005262 Bacteria 4361
44 Ga0070658_10000902 3300005327 Bacteria 25456
45 Ga0070670_100014286 3300005331 Bacteria 6813
46 Ga0070670_100021825 3300005331 Bacteria 5506
47 Ga0070670_100283821 3300005331 Bacteria 1446
48 Ga0070666_10000001 3300005335 Bacteria 543080
49 Ga0070666_10102360 3300005335 Bacteria 1975
50 Ga0070661_100108014 3300005344 Bacteria 2076
51 Ga0070661_100132556 3300005344 Bacteria 1873
52 Ga0070661_100205293 3300005344 Bacteria 1507
53 Ga0070668_100041412 3300005347 Bacteria 3529
54 Ga0070688_100019746 3300005365 Bacteria 3907
55 Ga0070667_100020781 3300005367 Bacteria 5453
56 Ga0070667_100035041 3300005367 Bacteria 4203
57 Ga0070663_100024563 3300005455 Bacteria 4059
58 Ga0070678_100035882 3300005456 Bacteria 3466
59 Ga0070662_100101627 3300005457 Bacteria 2177
60 Ga0068867_100045286 3300005459 Bacteria 3226
61 Ga0070685_10003765 3300005466 Bacteria 7669
62 Ga0070697_100184414 3300005536 Bacteria 1769
63 Ga0068853_100027111 3300005539 Bacteria 4814
64 Ga0070672_100007739 3300005543 Bacteria 7320
65 Ga0070665_100161548 3300005548 Bacteria 2242
66 Ga0068855_100010411 3300005563 Bacteria 11218
67 Ga0068855_100069338 3300005563 Bacteria 4103
68 Ga0068857_100010294 3300005577 Bacteria 8125
69 Ga0068854_100001021 3300005578 Bacteria 16798
70 Ga0068854_100050413 3300005578 Bacteria 2978
71 Ga0068856_100001604 3300005614 Bacteria 23639
72 Ga0068856_100096674 3300005614 Bacteria 2942
73 Ga0068852_100024539 3300005616 Bacteria 4875
74 Ga0068852_100071379 3300005616 Bacteria 3049
75 Ga0068852_100138888 3300005616 Bacteria 2247
76 Ga0068859_100287164 3300005617 Bacteria 1738
77 Ga0068851_10004464 3300005834 Bacteria 6313
78 Ga0068863_100317110 3300005841 Bacteria 1514
79 Ga0068858_100003000 3300005842 Bacteria 16922
80 Ga0068858_100119223 3300005842 Bacteria 2467
81 Ga0068858_100407659 3300005842 Bacteria 1306
82 Ga0068860_100036037 3300005843 Bacteria 4742
83 Ga0081455_10020795 3300005937 Bacteria 6168
84 Ga0075436_100049263 3300006914 Bacteria 2907
85 Ga0097620_100287174 3300006931 Bacteria 1738
86 Ga0105240_10000034 3300009093 Bacteria 278179
87 Ga0105240_10000517 3300009093 Bacteria 71134
88 Ga0105240_10000627 3300009093 Bacteria 65150
89 Ga0105240_10017860 3300009093 Bacteria 9543
90 Ga0105240_10023263 3300009093 Bacteria 8200
91 Ga0105240_10023860 3300009093 Bacteria 8079
92 Ga0105240_10057913 3300009093 Bacteria 4838
93 Ga0105240_10272686 3300009093 Bacteria 1947
94 Ga0105240_10400668 3300009093 Bacteria 1546
95 Ga0105240_10511628 3300009093 Bacteria 1334
96 Ga0105241_10084191 3300009174 Bacteria 2497
97 Ga0105237_10000565 3300009545 Bacteria 51782
98 Ga0105237_10041003 3300009545 Bacteria 4670
99 Ga0105237_10318374 3300009545 Bacteria 1559
100 Ga0105238_10001323 3300009551 Bacteria 24858
101 Ga0105238_10001614 3300009551 Bacteria 22566
102 Ga0105238_10006357 3300009551 Bacteria 11748
103 Ga0105238_10345672 3300009551 Bacteria 1476
104 Ga0105249_10008142 3300009553 Bacteria 9139
105 Ga0105239_10000028 3300010375 Bacteria 243470
106 Ga0105239_10333066 3300010375 Bacteria 1712
107 Ga0105239_10560019 3300010375 Bacteria 1302
108 Ga0157314_1000071 3300012500 Bacteria 10654
109 Ga0157370_10116516 3300013104 Bacteria 2495
110 Ga0157370_10418172 3300013104 Bacteria 1233
111 Ga0157369_10002147 3300013105 Bacteria 23766
112 Ga0157369_10078624 3300013105 Bacteria 3534
113 Ga0163162_10001283 3300013306 Bacteria 23465
114 Ga0182008_10023820 3300014497 Bacteria 3120
115 Ga0157376_10008287 3300014969 Bacteria 7490
116 Ga0182006_1000041 3300015261 Bacteria 203413
117 Ga0182007_10013427 3300015262 Bacteria 3123
118 Ga0182005_1000004 3300015265 Bacteria 609645
119 Ga0182005_1012901 3300015265 Bacteria 2355
120 Ga0209435_105866 3300025206 Bacteria 1374
121 Ga0209760_100186 3300025207 Bacteria 32225
122 Ga0209784_100026 3300025224 Bacteria 371540
123 Ga0209566_103660 3300025225 Bacteria 2281
124 Ga0209674_100063 3300025226 Bacteria 275507
125 Ga0209674_100079 3300025226 Bacteria 205836
126 Ga0209674_100558 3300025226 Bacteria 14781
127 Ga0209672_100005 3300025228 Bacteria 1069303
128 Ga0209672_100055 3300025228 Bacteria 221655
129 Ga0209672_100149 3300025228 Bacteria 62756
130 Ga0209672_100189 3300025228 Bacteria 50005
131 Ga0209672_104262 3300025228 Bacteria 2702
132 Ga0209563_100023 3300025230 Bacteria 636844
133 Ga0209563_100025 3300025230 Bacteria 596456
134 Ga0207427_100023 3300025231 Bacteria 439725
135 Ga0207427_100053 3300025231 Bacteria 217191
136 Ga0207427_102096 3300025231 Bacteria 5844
137 Ga0209437_100069 3300025233 Bacteria 307733
138 Ga0209437_100108 3300025233 Bacteria 217191
139 Ga0209437_100245 3300025233 Bacteria 88331
140 Ga0209258_100006 3300025242 Bacteria 1069303
141 Ga0209258_100012 3300025242 Bacteria 825544
142 Ga0209258_100055 3300025242 Bacteria 337291
143 Ga0209258_100059 3300025242 Bacteria 324934
144 Ga0209258_100255 3300025242 Bacteria 94924
145 Ga0209258_100815 3300025242 Bacteria 17833
146 Ga0209646_1000264 3300025246 Bacteria 51141
147 Ga0209646_1003396 3300025246 Bacteria 3157
148 Ga0209026_1000036 3300025250 Bacteria 296607
149 Ga0209026_1000055 3300025250 Bacteria 237197
150 Ga0209026_1000324 3300025250 Bacteria 49893
151 Ga0209677_102136 3300025253 Bacteria 7750
152 Ga0209148_1000005 3300025254 Bacteria 1806504
153 Ga0209148_1000010 3300025254 Bacteria 1265567
154 Ga0209148_1000012 3300025254 Bacteria 1069303
155 Ga0209148_1000014 3300025254 Bacteria 925277
156 Ga0209148_1000058 3300025254 Bacteria 357482
157 Ga0209148_1000221 3300025254 Bacteria 94627
158 Ga0209759_1000023 3300025256 Bacteria 321695
159 Ga0209759_1000159 3300025256 Bacteria 116456
160 Ga0209759_1000191 3300025256 Bacteria 97876
161 Ga0209759_1005159 3300025256 Bacteria 4653
162 Ga0209129_1000291 3300025258 Bacteria 47810
163 Ga0209129_1011247 3300025258 Bacteria 2151
164 Ga0209233_1000009 3300025261 Bacteria 1265567
165 Ga0209233_1000125 3300025261 Bacteria 217190
166 Ga0209233_1001491 3300025261 Bacteria 9201
167 Ga0209455_1000008 3300025272 Bacteria 1069303
168 Ga0209455_1000014 3300025272 Bacteria 806601
169 Ga0209455_1000018 3300025272 Bacteria 718034
170 Ga0209455_1000020 3300025272 Bacteria 702259
171 Ga0209455_1004898 3300025272 Bacteria 4259
172 Ga0209455_1009845 3300025272 Bacteria 2475
173 Ga0209758_1000289 3300025297 Bacteria 98983
174 Ga0209051_1008004 3300025303 Bacteria 5672
175 Ga0209257_1022187 3300025304 Bacteria 2274
176 Ga0207710_10011289 3300025900 Bacteria 3761
177 Ga0207680_10000003 3300025903 Bacteria 925264
178 Ga0207680_10068177 3300025903 Bacteria 2194
179 Ga0207680_10188951 3300025903 Bacteria 1397
180 Ga0207647_10000002 3300025904 Bacteria 400771
181 Ga0207647_10000111 3300025904 Bacteria 62900
182 Ga0207647_10003352 3300025904 Bacteria 12015
183 Ga0207647_10049232 3300025904 Bacteria 2615
184 Ga0207705_10004336 3300025909 Bacteria 10732
185 Ga0207695_10000033 3300025913 Bacteria 507477
186 Ga0207695_10000101 3300025913 Bacteria 258504
187 Ga0207695_10000116 3300025913 Bacteria 239510
188 Ga0207695_10000349 3300025913 Bacteria 106823
189 Ga0207695_10005539 3300025913 Bacteria 16698
190 Ga0207695_10023501 3300025913 Bacteria 6962
191 Ga0207695_10200718 3300025913 Bacteria 1909
192 Ga0207671_10000059 3300025914 Bacteria 179761
193 Ga0207671_10038505 3300025914 Bacteria 3544
194 Ga0207671_10041340 3300025914 Bacteria 3412
195 Ga0207694_10000151 3300025924 Bacteria 71870
196 Ga0207694_10001014 3300025924 Bacteria 24489
197 Ga0207694_10003846 3300025924 Bacteria 11869
198 Ga0207694_10042966 3300025924 Bacteria 3488
199 Ga0207694_10086978 3300025924 Bacteria 2461
200 Ga0207694_10450630 3300025924 Bacteria 1074
201 Ga0207650_10313257 3300025925 Bacteria 1284
202 Ga0207706_10128426 3300025933 Bacteria 2229
203 Ga0207704_10055759 3300025938 Bacteria 2417
204 Ga0207691_10031924 3300025940 Bacteria 4915
205 Ga0207667_10000031 3300025949 Bacteria 323587
206 Ga0207667_10000501 3300025949 Bacteria 51715
207 Ga0207667_10264722 3300025949 Bacteria 1758
208 Ga0207712_10000477 3300025961 Bacteria 33669
209 Ga0207640_10000227 3300025981 Bacteria 39566
210 Ga0207640_10000376 3300025981 Bacteria 28758
211 Ga0207640_10028522 3300025981 Bacteria 3414
212 Ga0207658_10020606 3300025986 Bacteria 4565
213 Ga0207658_10028107 3300025986 Bacteria 3958
214 Ga0207703_10001468 3300026035 Bacteria 21500
215 Ga0207703_10096262 3300026035 Bacteria 2499
216 Ga0207639_10000197 3300026041 Bacteria 45460
217 Ga0207678_10007165 3300026067 Bacteria 9886
218 Ga0207678_10016683 3300026067 Bacteria 6450
219 Ga0207678_10042321 3300026067 Bacteria 3946
220 Ga0207702_10041347 3300026078 Bacteria 3866
221 Ga0207702_10042607 3300026078 Bacteria 3808
222 Ga0207641_10110329 3300026088 Bacteria 2438
223 Ga0207648_10474463 3300026089 Bacteria 1142
224 Ga0207674_10000189 3300026116 Bacteria 75437
225 Ga0207674_10048103 3300026116 Bacteria 4367
226 Ga0207674_10165205 3300026116 Bacteria 2168
227 Ga0207698_10028111 3300026142 Bacteria 4005
228 Ga0207698_10319883 3300026142 Bacteria 1452
229 Ga0268266_10000006 3300028379 Bacteria 1410021
230 Ga0268266_10000011 3300028379 Bacteria 757403
231 Ga0268265_10092290 3300028380 Bacteria 2423
232 Ga0268264_10026081 3300028381 Bacteria 4773
233 Ga0307508_10160184 3300031616 Bacteria 1854
234 Ga0307510_10000357 3300033180 Bacteria 42997
235 Ga0307510_10016999 3300033180 Bacteria 8582
236 Ga0395899_0000076 3300037312 Bacteria 177673
237 Ga0395898_0000044 3300037466 Bacteria 298164
238 Ga0395898_0000132 3300037466 Bacteria 192211
239 Ga0436364_0085841 3300037853 Bacteria 3318
240 Ga0436364_0699384 3300037853 Bacteria 1767
241 Ga0395901_0046726 3300038443 Bacteria 4497
242 Ga0436363_0805447 3300039450 Bacteria 932
243 Ga0436363_1702891 3300039450 Bacteria 821
244 Ga0436362_0215946 3300039453 Bacteria 1816
245 Ga0466969_0004568 3300044656 Bacteria 7373
246 Ga0466969_0022253 3300044656 Bacteria 3273
247 Ga0466969_0071227 3300044656 Bacteria 1672
248 Ga0466982_0000010 3300044672 Bacteria 188341
249 Ga0466965_0025407 3300044683 Bacteria 2867
250 Ga0466966_0002102 3300044684 Bacteria 12937
251 Ga0466966_0030760 3300044684 Bacteria 3482
252 Ga0466966_0116840 3300044684 Bacteria 1641
253 Ga0466961_0002059 3300044693 Bacteria 12527
254 Ga0466961_0002618 3300044693 Bacteria 11183
255 Ga0466961_0006220 3300044693 Bacteria 7583
256 Ga0466961_0029330 3300044693 Bacteria 3537
257 Ga0466963_0056876 3300044694 Bacteria 2604
258 Ga0466963_0148562 3300044694 Bacteria 1627
259 Ga0453684_0155725 3300044712 Bacteria 2710
260 Ga0466971_0001198 3300044719 Bacteria 10772
261 Ga0466968_0041384 3300044735 Bacteria 1944
262 Ga0466970_0001099 3300044765 Bacteria 13111
263 Ga0466957_0142771 3300044842 Bacteria 1543
264 Ga0466959_0000871 3300045049 Bacteria 17801
265 Ga0466959_0008955 3300045049 Bacteria 7101
266 Ga0466959_0076341 3300045049 Bacteria 2419
267 Ga0466958_0012464 3300045836 Bacteria 4820
268 Ga0466967_0211115 3300045976 Bacteria 1841
269 Ga0466967_0385655 3300045976 Bacteria 1361
270 Ga0495617_000085 3300046452 Bacteria 67837
271 Ga0495590_0015686 3300046457 Bacteria 2745
272 Ga0495638_0000041 3300046460 Bacteria 235584
273 Ga0495650_0000122 3300046471 Bacteria 182888
274 Ga0495650_0000191 3300046471 Bacteria 132016
275 Ga0495584_0018293 3300046491 Bacteria 3562
276 Ga0495585_0000008 3300046492 Bacteria 278949
277 Ga0495607_0000003 3300046501 Bacteria 366900
278 Ga0495607_0000141 3300046501 Bacteria 75379
279 Ga0495583_0010089 3300046506 Bacteria 5554
280 Ga0495606_0000333 3300046507 Bacteria 81527
281 Ga0495606_0000905 3300046507 Bacteria 44064
282 Ga0495606_0060811 3300046507 Bacteria 2418
283 Ga0495616_0000001 3300046513 Bacteria 780061
284 Ga0495616_0000437 3300046513 Bacteria 31792
285 Ga0495620_0001004 3300046515 Bacteria 17443
286 Ga0495631_0000001 3300046518 Bacteria 216492
287 Ga0495632_0086397 3300046519 Bacteria 1492
288 Ga0495632_0112115 3300046519 Bacteria 1280
289 Ga0495637_0013861 3300046520 Bacteria 3816
290 Ga0495648_0000416 3300046524 Bacteria 46995
291 Ga0495609_0000651 3300046538 Bacteria 27033
292 Ga0495668_0003087 3300046616 Bacteria 12883
293 Ga0495611_0000002 3300046648 Bacteria 705677
294 Ga0495625_0000002 3300046660 Bacteria 813323
295 Ga0495625_0060643 3300046660 Bacteria 2680
296 Ga0495661_0000184 3300046665 Bacteria 71844
297 Ga0495661_0023000 3300046665 Bacteria 4051
298 Ga0495670_0001199 3300046691 Bacteria 12589
299 Ga0495670_0049873 3300046691 Bacteria 2095
300 Ga0495671_0000622 3300046692 Bacteria 25995
301 Ga0495589_0000111 3300046794 Bacteria 77466
302 Ga0495660_0000232 3300046810 Bacteria 54549
303 Ga0495660_0000265 3300046810 Bacteria 49322
304 Ga0495679_000003 3300047446 Bacteria 787868
305 Ga0495673_0000004 3300047469 Bacteria 1354526
306 Ga0495673_0000283 3300047469 Bacteria 68581
307 Ga0495686_0000028 3300047472 Bacteria 369493
308 Ga0495686_0003751 3300047472 Bacteria 12928
309 Ga0495686_0026744 3300047472 Bacteria 3774
310 Ga0496101_0002589 3300048904 Bacteria 11117
311 Ga0496101_0076358 3300048904 Bacteria 2468
312 Ga0496102_0222821 3300048905 Bacteria 1778
313 Ga0496104_0042342 3300048907 Bacteria 4273
314 Ga0496104_0140106 3300048907 Bacteria 2324
315 Ga0496105_0002359 3300048908 Bacteria 13682
316 Ga0496108_0187181 3300048911 Bacteria 1793
317 Ga0496115_0000839 3300048918 Bacteria 22460
318 Ga0496117_0006430 3300048920 Bacteria 11895
319 Ga0496117_0007466 3300048920 Bacteria 10669
320 Ga0496117_0096449 3300048920 Bacteria 1886
321 Ga0496118_0000417 3300048921 Bacteria 70807
322 Ga0496118_0000616 3300048921 Bacteria 58742
323 Ga0496118_0000706 3300048921 Bacteria 53858
324 Ga0496118_0000940 3300048921 Bacteria 45474
325 Ga0496118_0028858 3300048921 Bacteria 4664
326 Ga0496118_0187593 3300048921 Bacteria 1241
327 Ga0496119_0000030 3300048922 Bacteria 240167
328 Ga0496120_0000015 3300048923 Bacteria 310795
329 Ga0496120_0000033 3300048923 Bacteria 218355
330 Ga0496121_0000063 3300048924 Bacteria 273080
331 Ga0496121_0000116 3300048924 Bacteria 177260
332 Ga0496121_0000390 3300048924 Bacteria 89674
333 Ga0496121_0000770 3300048924 Bacteria 58816
334 Ga0496121_0012981 3300048924 Bacteria 9003
335 Ga0496121_0019765 3300048924 Bacteria 6714
336 Ga0496121_0025547 3300048924 Bacteria 5599
337 Ga0496121_0296236 3300048924 Bacteria 1100
338 Ga0496123_0096793 3300048926 Bacteria 1731
339 Ga0496125_0001364 3300048928 Bacteria 35921
340 Ga0496125_0004355 3300048928 Bacteria 16421
341 Ga0496125_0198532 3300048928 Bacteria 1316
342 Ga0496126_0000134 3300048929 Bacteria 169693
343 Ga0496126_0060936 3300048929 Bacteria 3391
344 Ga0496126_0066007 3300048929 Bacteria 3236
345 Ga0496126_0307759 3300048929 Bacteria 1305
346 Ga0495678_000019 3300049459 Bacteria 269723
347 Ga0495682_0000961 3300049460 Bacteria 17371
348 Ga0495682_0001267 3300049460 Bacteria 14179
349 Ga0501031_0001707 3300049568 Bacteria 13793
350 Ga0501032_0023705 3300049569 Bacteria 4237
351 Ga0501032_0064373 3300049569 Bacteria 2454
352 Ga0501033_0001726 3300049570 Bacteria 19121
353 Ga0501033_0128157 3300049570 Bacteria 1839
354 Ga0501034_0163749 3300049571 Bacteria 2193
355 Ga0501036_0020798 3300049572 Bacteria 5511
356 Ga0501037_0003557 3300049573 Bacteria 11305
357 Ga0501038_0001062 3300049574 Bacteria 24804
358 Ga0501043_0035304 3300049579 Bacteria 3932
359 Ga0501043_0093464 3300049579 Bacteria 2364
360 Ga0501046_0007785 3300049580 Bacteria 9399
361 Ga0501046_0132539 3300049580 Bacteria 1889
362 Ga0501047_0017172 3300049581 Bacteria 6926
363 Ga0501048_0034877 3300049582 Bacteria 3626
364 Ga0501067_0029398 3300049583 Bacteria 3045
365 Ga0501068_0001610 3300049584 Bacteria 12022
366 Ga0501069_0001719 3300049585 Bacteria 10907
367 Ga0501072_0001570 3300049588 Bacteria 17054
368 Ga0501073_0018576 3300049589 Bacteria 5026
369 Ga0501074_0032685 3300049590 Bacteria 3768
370 Ga0501076_0017205 3300049592 Bacteria 5491
371 Ga0501079_0001916 3300049741 Bacteria 14917
372 Ga0501080_0001660 3300049742 Bacteria 18940
373 Ga0501083_0020443 3300049744 Bacteria 4605
374 Ga0501035_0013282 3300049822 Bacteria 7599
375 Ga0501035_0107155 3300049822 Bacteria 2450
376 Ga0501035_0115075 3300049822 Bacteria 2354
377 Ga0501035_0208706 3300049822 Bacteria 1672
378 Ga0501044_0012806 3300049823 Bacteria 9083
379 Ga0501044_0014942 3300049823 Bacteria 8370
380 Ga0501044_0390030 3300049823 Bacteria 1306
381 Ga0501044_0625086 3300049823 Bacteria 968
382 nmdc:mga0n895_9566_c1 3300050512 Bacteria 8490
383 nmdc:mga08x19_150091_c1 3300050514 Bacteria 1578
384 Ga0500643_000101 3300053087 Bacteria 88318
385 Ga0500646_0002799 3300053090 Bacteria 4482
386 Ga0500555_002529 3300053103 Bacteria 5285
387 Ga0501084_0001252 3300054114 Bacteria 19987
388 Ga0501082_0001592 3300060353 Bacteria 20009
389 Ga0466962_0038805 3300061719 Bacteria 2281
390 Ga0466962_0050166 3300061719 Bacteria 1994

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_0805447 Ga0436363_0805447_21_695 224
2 3300050512 nmdc:mga0n895_9566_c1 nmdc:mga0n895_9566_c1_3660_4562 234
3 3300039450 Ga0436363_1702891 Ga0436363_1702891_20_730 236
4 3300049822 Ga0501035_0107155 Ga0501035_0107155_1660_2370 236
5 3300044712 Ga0453684_0155725 Ga0453684_0155725_1455_2306 242
6 3300037853 Ga0436364_0085841 Ga0436364_0085841_1641_2387 247
7 3300005617 Ga0068859_100287164 Ga0068859_1002871641 258
8 3300006931 Ga0097620_100287174 Ga0097620_1002871741 258
9 3300006914 Ga0075436_100049263 Ga0075436_1000492632 259
10 3300026089 Ga0207648_10474463 Ga0207648_104744631 259
11 3300050514 nmdc:mga08x19_150091_c1 nmdc:mga08x19_150091_c1_506_1399 259
12 3300005331 Ga0070670_100014286 Ga0070670_1000142862 261
13 3300005543 Ga0070672_100007739 Ga0070672_1000077396 261
14 3300005841 Ga0068863_100317110 Ga0068863_1003171101 261
15 3300025940 Ga0207691_10031924 Ga0207691_100319244 261
16 3300026088 Ga0207641_10110329 Ga0207641_101103293 261
17 3300003759 Ga0055525_1000013 Ga0055525_1000013343 262
18 3300005344 Ga0070661_100108014 Ga0070661_1001080142 262
19 3300005842 Ga0068858_100119223 Ga0068858_1001192233 262
20 3300009093 Ga0105240_10057913 Ga0105240_100579134 262
21 3300009093 Ga0105240_10400668 Ga0105240_104006683 262
22 3300025230 Ga0209563_100025 Ga0209563_100025244 262
23 3300026035 Ga0207703_10096262 Ga0207703_100962623 262
24 3300009093 Ga0105240_10511628 Ga0105240_105116282 263
25 3300037853 Ga0436364_0699384 Ga0436364_0699384_49_846 263
26 3300044694 Ga0466963_0148562 Ga0466963_0148562_205_1014 267
27 3300010375 Ga0105239_10560019 Ga0105239_105600192 269
28 3300025924 Ga0207694_10450630 Ga0207694_104506301 270
29 3300005344 Ga0070661_100205293 Ga0070661_1002052931 272
30 3300025261 Ga0209233_1001491 Ga0209233_10014914 273
31 3300048929 Ga0496126_0060936 Ga0496126_0060936_412_1311 273
32 3300009093 Ga0105240_10023263 Ga0105240_100232637 274
33 3300009545 Ga0105237_10041003 Ga0105237_100410033 274
34 3300009551 Ga0105238_10345672 Ga0105238_103456721 274
35 3300049568 Ga0501031_0001707 Ga0501031_0001707_7564_8394 274
36 3300049569 Ga0501032_0023705 Ga0501032_0023705_942_1772 274
37 3300049570 Ga0501033_0001726 Ga0501033_0001726_7008_7838 274
38 3300049571 Ga0501034_0163749 Ga0501034_0163749_466_1296 274
39 3300049572 Ga0501036_0020798 Ga0501036_0020798_2478_3308 274
40 3300049573 Ga0501037_0003557 Ga0501037_0003557_11_841 274
41 3300049574 Ga0501038_0001062 Ga0501038_0001062_15733_16563 274
42 3300049579 Ga0501043_0035304 Ga0501043_0035304_898_1728 274
43 3300049580 Ga0501046_0007785 Ga0501046_0007785_7851_8681 274
44 3300049581 Ga0501047_0017172 Ga0501047_0017172_2460_3290 274
45 3300049582 Ga0501048_0034877 Ga0501048_0034877_1901_2731 274
46 3300049583 Ga0501067_0029398 Ga0501067_0029398_11_841 274
47 3300049584 Ga0501068_0001610 Ga0501068_0001610_10465_11295 274
48 3300049585 Ga0501069_0001719 Ga0501069_0001719_4913_5743 274
49 3300049588 Ga0501072_0001570 Ga0501072_0001570_695_1525 274
50 3300049589 Ga0501073_0018576 Ga0501073_0018576_4186_5016 274
51 3300049590 Ga0501074_0032685 Ga0501074_0032685_2205_3035 274
52 3300049592 Ga0501076_0017205 Ga0501076_0017205_470_1300 274
53 3300049741 Ga0501079_0001916 Ga0501079_0001916_2205_3035 274
54 3300049742 Ga0501080_0001660 Ga0501080_0001660_15629_16459 274
55 3300049744 Ga0501083_0020443 Ga0501083_0020443_3765_4595 274
56 3300049822 Ga0501035_0013282 Ga0501035_0013282_5810_6640 274
57 3300049823 Ga0501044_0390030 Ga0501044_0390030_11_841 274
58 3300054114 Ga0501084_0001252 Ga0501084_0001252_16695_17525 274
59 3300060353 Ga0501082_0001592 Ga0501082_0001592_7136_7966 274
60 3300005262 Ga0065165_1000399 Ga0065165_100039957 275
61 3300009551 Ga0105238_10001614 Ga0105238_1000161420 275
62 3300013104 Ga0157370_10418172 Ga0157370_104181722 275
63 3300025228 Ga0209672_100149 Ga0209672_10014927 275
64 3300025914 Ga0207671_10041340 Ga0207671_100413403 275
65 3300025924 Ga0207694_10001014 Ga0207694_100010142 275
66 3300026067 Ga0207678_10042321 Ga0207678_100423212 275
67 3300039453 Ga0436362_0215946 Ga0436362_0215946_879_1712 275
68 3300048924 Ga0496121_0296236 Ga0496121_0296236_259_1086 275
69 3300049822 Ga0501035_0208706 Ga0501035_0208706_822_1655 275
70 3300049823 Ga0501044_0014942 Ga0501044_0014942_4121_4954 275
71 3300049823 Ga0501044_0625086 Ga0501044_0625086_73_906 275
72 3300005536 Ga0070697_100184414 Ga0070697_1001844142 276
73 3300005937 Ga0081455_10020795 Ga0081455_100207953 277
74 3300025272 Ga0209455_1009845 Ga0209455_10098452 277
75 3300028380 Ga0268265_10092290 Ga0268265_100922902 277
76 3300044656 Ga0466969_0071227 Ga0466969_0071227_750_1652 277
77 3300044684 Ga0466966_0116840 Ga0466966_0116840_218_1120 277
78 3300044693 Ga0466961_0029330 Ga0466961_0029330_210_1112 277
79 3300045049 Ga0466959_0000871 Ga0466959_0000871_16150_17052 277
80 3300045836 Ga0466958_0012464 Ga0466958_0012464_174_1076 277
81 3300046501 Ga0495607_0000003 Ga0495607_0000003_172506_173411 277
82 3300048929 Ga0496126_0066007 Ga0496126_0066007_1556_2455 277
83 3300005331 Ga0070670_100021825 Ga0070670_1000218253 278
84 3300005344 Ga0070661_100132556 Ga0070661_1001325561 278
85 3300005367 Ga0070667_100035041 Ga0070667_1000350413 278
86 3300005539 Ga0068853_100027111 Ga0068853_1000271113 278
87 3300005578 Ga0068854_100050413 Ga0068854_1000504131 278
88 3300005614 Ga0068856_100096674 Ga0068856_1000966743 278
89 3300005842 Ga0068858_100003000 Ga0068858_1000030005 278
90 3300025303 Ga0209051_1008004 Ga0209051_10080042 278
91 3300025914 Ga0207671_10038505 Ga0207671_100385053 278
92 3300025949 Ga0207667_10264722 Ga0207667_102647222 278
93 3300025981 Ga0207640_10028522 Ga0207640_100285223 278
94 3300025986 Ga0207658_10028107 Ga0207658_100281073 278
95 3300026035 Ga0207703_10001468 Ga0207703_1000146812 278
96 3300026041 Ga0207639_10000197 Ga0207639_1000019714 278
97 3300026078 Ga0207702_10042607 Ga0207702_100426073 278
98 3300014969 Ga0157376_10008287 Ga0157376_100082873 279
99 3300025913 Ga0207695_10023501 Ga0207695_100235014 280
100 3300025924 Ga0207694_10086978 Ga0207694_100869781 280
101 3300048918 Ga0496115_0000839 Ga0496115_0000839_16177_17079 280
102 3300046471 Ga0495650_0000122 Ga0495650_0000122_87525_88424 281
103 3300009545 Ga0105237_10318374 Ga0105237_103183742 282
104 3300001979 JGI24740J21852_10024469 JGI24740J21852_100244693 283
105 3300001989 JGI24739J22299_10002765 JGI24739J22299_100027655 283
106 3300001990 JGI24737J22298_10008820 JGI24737J22298_100088202 283
107 3300003215 JGI25153J46596_10015231 JGI25153J46596_100152312 283
108 3300005563 Ga0068855_100069338 Ga0068855_1000693381 283
109 3300005577 Ga0068857_100010294 Ga0068857_1000102942 283
110 3300005616 Ga0068852_100138888 Ga0068852_1001388882 283
111 3300005834 Ga0068851_10004464 Ga0068851_100044643 283
112 3300005842 Ga0068858_100407659 Ga0068858_1004076592 283
113 3300009093 Ga0105240_10023860 Ga0105240_100238606 283
114 3300009174 Ga0105241_10084191 Ga0105241_100841913 283
115 3300009545 Ga0105237_10000565 Ga0105237_1000056540 283
116 3300012500 Ga0157314_1000071 Ga0157314_10000717 283
117 3300013105 Ga0157369_10078624 Ga0157369_100786242 283
118 3300025258 Ga0209129_1011247 Ga0209129_10112472 283
119 3300025297 Ga0209758_1000289 Ga0209758_100028957 283
120 3300025904 Ga0207647_10003352 Ga0207647_100033525 283
121 3300025913 Ga0207695_10000349 Ga0207695_1000034969 283
122 3300025914 Ga0207671_10000059 Ga0207671_1000005995 283
123 3300025933 Ga0207706_10128426 Ga0207706_101284262 283
124 3300025949 Ga0207667_10000501 Ga0207667_1000050110 283
125 3300025981 Ga0207640_10000376 Ga0207640_100003765 283
126 3300026116 Ga0207674_10000189 Ga0207674_1000018965 283
127 3300026142 Ga0207698_10319883 Ga0207698_103198832 283
128 3300048924 Ga0496121_0012981 Ga0496121_0012981_1695_2588 283
129 3300048928 Ga0496125_0001364 Ga0496125_0001364_8785_9678 283
130 3300003760 Ga0055527_1000244 Ga0055527_10002443 284
131 3300005262 Ga0065165_1009476 Ga0065165_10094762 284
132 3300025228 Ga0209672_100055 Ga0209672_10005576 284
133 3300025242 Ga0209258_100012 Ga0209258_10001223 284
134 3300025254 Ga0209148_1000014 Ga0209148_1000014632 284
135 3300025272 Ga0209455_1000014 Ga0209455_1000014520 284
136 3300005563 Ga0068855_100010411 Ga0068855_1000104115 285
137 3300005578 Ga0068854_100001021 Ga0068854_10000102110 285
138 3300009093 Ga0105240_10017860 Ga0105240_100178602 285
139 3300025913 Ga0207695_10005539 Ga0207695_100055392 285
140 3300025949 Ga0207667_10000031 Ga0207667_10000031101 285
141 3300025981 Ga0207640_10000227 Ga0207640_100002279 285
142 3300048904 Ga0496101_0076358 Ga0496101_0076358_564_1469 285
143 3300048924 Ga0496121_0025547 Ga0496121_0025547_2021_2926 285
144 3300044672 Ga0466982_0000010 Ga0466982_0000010_108609_109511 286
145 3300044719 Ga0466971_0001198 Ga0466971_0001198_1421_2323 286
146 3300044735 Ga0466968_0041384 Ga0466968_0041384_138_1040 286
147 3300025231 Ga0207427_102096 Ga0207427_1020964 288
148 3300046492 Ga0495585_0000008 Ga0495585_0000008_46489_47391 288
149 3300046518 Ga0495631_0000001 Ga0495631_0000001_162048_162950 288
150 3300046524 Ga0495648_0000416 Ga0495648_0000416_33310_34212 288
151 3300046665 Ga0495661_0000184 Ga0495661_0000184_24996_25898 288
152 3300049460 Ga0495682_0001267 Ga0495682_0001267_11803_12705 288
153 3300044694 Ga0466963_0056876 Ga0466963_0056876_1347_2243 289
154 3300045976 Ga0466967_0211115 Ga0466967_0211115_368_1264 289
155 3300025225 Ga0209566_103660 Ga0209566_1036602 290
156 3300025256 Ga0209759_1005159 Ga0209759_10051593 290
157 3300031616 Ga0307508_10160184 Ga0307508_101601842 290
158 3300046452 Ga0495617_000085 Ga0495617_000085_10869_11771 290
159 3300046457 Ga0495590_0015686 Ga0495590_0015686_273_1175 290
160 3300046460 Ga0495638_0000041 Ga0495638_0000041_213012_213914 290
161 3300046501 Ga0495607_0000141 Ga0495607_0000141_53284_54186 290
162 3300046506 Ga0495583_0010089 Ga0495583_0010089_4489_5391 290
163 3300046513 Ga0495616_0000437 Ga0495616_0000437_30609_31511 290
164 3300046519 Ga0495632_0086397 Ga0495632_0086397_429_1331 290
165 3300046520 Ga0495637_0013861 Ga0495637_0013861_2659_3561 290
166 3300046538 Ga0495609_0000651 Ga0495609_0000651_14599_15501 290
167 3300046648 Ga0495611_0000002 Ga0495611_0000002_443267_444169 290
168 3300046660 Ga0495625_0000002 Ga0495625_0000002_447752_448654 290
169 3300046665 Ga0495661_0023000 Ga0495661_0023000_1812_2714 290
170 3300046691 Ga0495670_0001199 Ga0495670_0001199_7412_8314 290
171 3300046692 Ga0495671_0000622 Ga0495671_0000622_2819_3721 290
172 3300046794 Ga0495589_0000111 Ga0495589_0000111_62278_63180 290
173 3300046810 Ga0495660_0000232 Ga0495660_0000232_28355_29257 290
174 3300047446 Ga0495679_000003 Ga0495679_000003_351749_352651 290
175 3300047469 Ga0495673_0000283 Ga0495673_0000283_52799_53701 290
176 3300049459 Ga0495678_000019 Ga0495678_000019_69589_70491 290
177 3300049460 Ga0495682_0000961 Ga0495682_0000961_11344_12246 290
178 3300053087 Ga0500643_000101 Ga0500643_000101_70351_71253 290
179 3300053103 Ga0500555_002529 Ga0500555_002529_1768_2670 290
180 3300005548 Ga0070665_100161548 Ga0070665_1001615483 291
181 3300028379 Ga0268266_10000011 Ga0268266_10000011186 291
182 3300002741 JGI25157J39369_1000139 JGI25157J39369_100013919 292
183 3300025250 Ga0209026_1000055 Ga0209026_1000055130 292
184 3300025256 Ga0209759_1000191 Ga0209759_100019139 292
185 3300045976 Ga0466967_0385655 Ga0466967_0385655_30_911 293
186 3300049570 Ga0501033_0128157 Ga0501033_0128157_132_1013 293
187 3300049579 Ga0501043_0093464 Ga0501043_0093464_1123_2004 293
188 3300049822 Ga0501035_0115075 Ga0501035_0115075_615_1496 293
189 3300049823 Ga0501044_0012806 Ga0501044_0012806_1573_2454 293
190 3300010375 Ga0105239_10333066 Ga0105239_103330662 294
191 3300025258 Ga0209129_1000291 Ga0209129_100029114 294
192 3300026116 Ga0207674_10165205 Ga0207674_101652053 294
193 iso_pu_bacteria 2643221577 2643894711 295
194 iso_pu_bacteria 2643221685 2644476860 295
195 3300005457 Ga0070662_100101627 Ga0070662_1001016273 296
196 3300025924 Ga0207694_10042966 Ga0207694_100429663 296
197 iso_pu_bacteria 2738543009 2739226029 296
198 iso_pu_bacteria 2884411467 2884411988 296
199 iso_pu_bacteria 2928963466 2928963901 296
200 3300005459 Ga0068867_100045286 Ga0068867_1000452863 297
201 3300005616 Ga0068852_100024539 Ga0068852_1000245392 297
202 3300009093 Ga0105240_10272686 Ga0105240_102726863 297
203 3300009551 Ga0105238_10006357 Ga0105238_100063577 297
204 3300009553 Ga0105249_10008142 Ga0105249_100081423 297
205 3300025903 Ga0207680_10188951 Ga0207680_101889511 297
206 3300025904 Ga0207647_10000111 Ga0207647_1000011130 297
207 3300025913 Ga0207695_10200718 Ga0207695_102007183 297
208 3300025924 Ga0207694_10003846 Ga0207694_100038463 297
209 3300025938 Ga0207704_10055759 Ga0207704_100557593 297
210 3300025961 Ga0207712_10000477 Ga0207712_100004779 297
211 3300026067 Ga0207678_10007165 Ga0207678_100071655 297
212 3300026116 Ga0207674_10048103 Ga0207674_100481033 297
213 3300026142 Ga0207698_10028111 Ga0207698_100281113 297
214 3300028379 Ga0268266_10000006 Ga0268266_10000006158 297
215 3300046507 Ga0495606_0000333 Ga0495606_0000333_51863_52774 297
216 3300047472 Ga0495686_0003751 Ga0495686_0003751_5691_6602 297
217 3300048923 Ga0496120_0000015 Ga0496120_0000015_55145_56038 297
218 iso_pu_bacteria 2919085039 2919085396 297
219 3300003320 rootH2_10013011 rootH2_100130117 298
220 3300003761 Ga0055535_1000204 Ga0055535_100020433 298
221 3300003762 Ga0055542_1000243 Ga0055542_100024310 298
222 3300025242 Ga0209258_100255 Ga0209258_10025513 298
223 3300025254 Ga0209148_1000221 Ga0209148_100022113 298
224 3300025272 Ga0209455_1004898 Ga0209455_10048982 298
225 3300037466 Ga0395898_0000132 Ga0395898_0000132_182478_183374 298
226 3300044693 Ga0466961_0002059 Ga0466961_0002059_10000_10896 298
227 3300005335 Ga0070666_10102360 Ga0070666_101023602 299
228 3300005455 Ga0070663_100024563 Ga0070663_1000245634 299
229 3300005616 Ga0068852_100071379 Ga0068852_1000713792 299
230 3300009093 Ga0105240_10000627 Ga0105240_1000062750 299
231 3300025903 Ga0207680_10068177 Ga0207680_100681772 299
232 3300025913 Ga0207695_10000033 Ga0207695_10000033154 299
233 3300026067 Ga0207678_10016683 Ga0207678_100166832 299
234 3300048921 Ga0496118_0028858 Ga0496118_0028858_1795_2694 299
235 3300049569 Ga0501032_0064373 Ga0501032_0064373_613_1515 299
236 3300049580 Ga0501046_0132539 Ga0501046_0132539_590_1492 299
237 iso_pu_bacteria 2718218334 2721027463 299
238 iso_pu_bacteria 2818991440 2819564319 299
239 iso_pu_bacteria 2884338543 2884338787 299
240 iso_pu_bacteria 2904463128 2904464962 299
241 iso_pu_bacteria 2941471342 2941472080 299
242 3300001989 JGI24739J22299_10029628 JGI24739J22299_100296281 300
243 3300002067 JGI24735J21928_10002480 JGI24735J21928_100024806 300
244 3300002737 JGI25162J39368_1000018 JGI25162J39368_1000018161 300
245 3300002741 JGI25157J39369_1000011 JGI25157J39369_100001128 300
246 3300002771 JGI25163J39215_1000293 JGI25163J39215_100029310 300
247 3300002772 JGI25164J39214_1000007 JGI25164J39214_1000007161 300
248 3300003214 JGI25165J46597_1000029 JGI25165J46597_1000029126 300
249 3300003751 Ga0055538_1002133 Ga0055538_10021332 300
250 3300003752 Ga0055539_1004265 Ga0055539_10042652 300
251 3300003756 Ga0055533_1003002 Ga0055533_10030026 300
252 3300003759 Ga0055525_1000027 Ga0055525_100002729 300
253 3300003760 Ga0055527_1000054 Ga0055527_100005438 300
254 3300003761 Ga0055535_1000025 Ga0055535_100002532 300
255 3300003761 Ga0055535_1000473 Ga0055535_100047319 300
256 3300003761 Ga0055535_1000560 Ga0055535_10005604 300
257 3300003762 Ga0055542_1000010 Ga0055542_1000010289 300
258 3300003762 Ga0055542_1000024 Ga0055542_1000024161 300
259 3300003762 Ga0055542_1000083 Ga0055542_100008372 300
260 3300003762 Ga0055542_1000278 Ga0055542_10002786 300
261 3300003763 Ga0055529_1000029 Ga0055529_1000029161 300
262 3300003763 Ga0055529_1000299 Ga0055529_10002996 300
263 3300003763 Ga0055529_1000942 Ga0055529_10009424 300
264 3300005365 Ga0070688_100019746 Ga0070688_1000197465 300
265 3300005466 Ga0070685_10003765 Ga0070685_100037656 300
266 3300005614 Ga0068856_100001604 Ga0068856_10000160416 300
267 3300014497 Ga0182008_10023820 Ga0182008_100238202 300
268 3300015261 Ga0182006_1000041 Ga0182006_100004157 300
269 3300015262 Ga0182007_10013427 Ga0182007_100134274 300
270 3300015265 Ga0182005_1012901 Ga0182005_10129012 300
271 3300025206 Ga0209435_105866 Ga0209435_1058662 300
272 3300025207 Ga0209760_100186 Ga0209760_1001869 300
273 3300025224 Ga0209784_100026 Ga0209784_100026149 300
274 3300025226 Ga0209674_100063 Ga0209674_10006365 300
275 3300025226 Ga0209674_100079 Ga0209674_10007912 300
276 3300025226 Ga0209674_100558 Ga0209674_10055812 300
277 3300025228 Ga0209672_100005 Ga0209672_100005541 300
278 3300025228 Ga0209672_104262 Ga0209672_1042623 300
279 3300025230 Ga0209563_100023 Ga0209563_100023197 300
280 3300025231 Ga0207427_100023 Ga0207427_100023149 300
281 3300025233 Ga0209437_100069 Ga0209437_100069113 300
282 3300025233 Ga0209437_100245 Ga0209437_10024551 300
283 3300025242 Ga0209258_100006 Ga0209258_100006541 300
284 3300025242 Ga0209258_100059 Ga0209258_100059149 300
285 3300025242 Ga0209258_100815 Ga0209258_1008154 300
286 3300025246 Ga0209646_1000264 Ga0209646_100026440 300
287 3300025250 Ga0209026_1000036 Ga0209026_1000036104 300
288 3300025253 Ga0209677_102136 Ga0209677_1021367 300
289 3300025254 Ga0209148_1000005 Ga0209148_100000561 300
290 3300025254 Ga0209148_1000010 Ga0209148_1000010148 300
291 3300025254 Ga0209148_1000012 Ga0209148_1000012541 300
292 3300025256 Ga0209759_1000023 Ga0209759_100002325 300
293 3300025261 Ga0209233_1000009 Ga0209233_10000091023 300
294 3300025272 Ga0209455_1000008 Ga0209455_1000008541 300
295 3300025272 Ga0209455_1000020 Ga0209455_1000020455 300
296 3300025900 Ga0207710_10011289 Ga0207710_100112894 300
297 3300025904 Ga0207647_10049232 Ga0207647_100492321 300
298 3300026078 Ga0207702_10041347 Ga0207702_100413472 300
299 3300037312 Ga0395899_0000076 Ga0395899_0000076_77991_78893 300
300 3300037466 Ga0395898_0000044 Ga0395898_0000044_91397_92299 300
301 3300038443 Ga0395901_0046726 Ga0395901_0046726_3338_4240 300
302 3300044656 Ga0466969_0004568 Ga0466969_0004568_4046_4948 300
303 3300044656 Ga0466969_0022253 Ga0466969_0022253_1597_2499 300
304 3300044683 Ga0466965_0025407 Ga0466965_0025407_1202_2104 300
305 3300044684 Ga0466966_0002102 Ga0466966_0002102_8428_9330 300
306 3300044684 Ga0466966_0030760 Ga0466966_0030760_2454_3356 300
307 3300044693 Ga0466961_0002618 Ga0466961_0002618_7764_8666 300
308 3300044693 Ga0466961_0006220 Ga0466961_0006220_1207_2109 300
309 3300044765 Ga0466970_0001099 Ga0466970_0001099_6869_7771 300
310 3300044842 Ga0466957_0142771 Ga0466957_0142771_610_1512 300
311 3300045049 Ga0466959_0008955 Ga0466959_0008955_1460_2362 300
312 3300045049 Ga0466959_0076341 Ga0466959_0076341_980_1882 300
313 3300046616 Ga0495668_0003087 Ga0495668_0003087_9947_10849 300
314 3300046810 Ga0495660_0000265 Ga0495660_0000265_23415_24317 300
315 3300047469 Ga0495673_0000004 Ga0495673_0000004_1301486_1302388 300
316 3300048907 Ga0496104_0140106 Ga0496104_0140106_54_956 300
317 3300048924 Ga0496121_0000770 Ga0496121_0000770_48962_49864 300
318 3300061719 Ga0466962_0038805 Ga0466962_0038805_712_1614 300
319 3300061719 Ga0466962_0050166 Ga0466962_0050166_171_1073 300
320 3300002705 JGI25156J39149_1010852 JGI25156J39149_10108522 301
321 3300002737 JGI25162J39368_1001353 JGI25162J39368_100135311 301
322 3300002741 JGI25157J39369_1005378 JGI25157J39369_10053782 301
323 3300002772 JGI25164J39214_1000030 JGI25164J39214_10000302 301
324 3300003214 JGI25165J46597_1000057 JGI25165J46597_1000057124 301
325 3300003761 Ga0055535_1000628 Ga0055535_10006286 301
326 3300003762 Ga0055542_1000359 Ga0055542_10003596 301
327 3300003763 Ga0055529_1000137 Ga0055529_100013730 301
328 3300005327 Ga0070658_10000902 Ga0070658_1000090216 301
329 3300005331 Ga0070670_100283821 Ga0070670_1002838212 301
330 3300005335 Ga0070666_10000001 Ga0070666_10000001163 301
331 3300005347 Ga0070668_100041412 Ga0070668_1000414124 301
332 3300005367 Ga0070667_100020781 Ga0070667_1000207812 301
333 3300005456 Ga0070678_100035882 Ga0070678_1000358824 301
334 3300005843 Ga0068860_100036037 Ga0068860_1000360372 301
335 3300009093 Ga0105240_10000034 Ga0105240_10000034185 301
336 3300009093 Ga0105240_10000517 Ga0105240_100005178 301
337 3300009551 Ga0105238_10001323 Ga0105238_100013237 301
338 3300010375 Ga0105239_10000028 Ga0105239_1000002835 301
339 3300013306 Ga0163162_10001283 Ga0163162_100012839 301
340 3300025228 Ga0209672_100189 Ga0209672_10018942 301
341 3300025231 Ga0207427_100053 Ga0207427_10005362 301
342 3300025233 Ga0209437_100108 Ga0209437_100108121 301
343 3300025242 Ga0209258_100055 Ga0209258_100055103 301
344 3300025246 Ga0209646_1003396 Ga0209646_10033962 301
345 3300025250 Ga0209026_1000324 Ga0209026_100032415 301
346 3300025254 Ga0209148_1000058 Ga0209148_1000058168 301
347 3300025256 Ga0209759_1000159 Ga0209759_100015960 301
348 3300025261 Ga0209233_1000125 Ga0209233_100012562 301
349 3300025272 Ga0209455_1000018 Ga0209455_1000018168 301
350 3300025903 Ga0207680_10000003 Ga0207680_10000003212 301
351 3300025909 Ga0207705_10004336 Ga0207705_100043365 301
352 3300025913 Ga0207695_10000101 Ga0207695_1000010171 301
353 3300025913 Ga0207695_10000116 Ga0207695_1000011665 301
354 3300025924 Ga0207694_10000151 Ga0207694_1000015115 301
355 3300025925 Ga0207650_10313257 Ga0207650_103132572 301
356 3300025986 Ga0207658_10020606 Ga0207658_100206062 301
357 3300028381 Ga0268264_10026081 Ga0268264_100260814 301
358 3300033180 Ga0307510_10000357 Ga0307510_1000035715 301
359 3300033180 Ga0307510_10016999 Ga0307510_100169996 301
360 3300046471 Ga0495650_0000191 Ga0495650_0000191_2614_3519 301
361 3300046507 Ga0495606_0060811 Ga0495606_0060811_1467_2372 301
362 3300046519 Ga0495632_0112115 Ga0495632_0112115_305_1210 301
363 3300046660 Ga0495625_0060643 Ga0495625_0060643_680_1585 301
364 3300048907 Ga0496104_0042342 Ga0496104_0042342_1080_1985 301
365 3300048908 Ga0496105_0002359 Ga0496105_0002359_5235_6140 301
366 3300048920 Ga0496117_0007466 Ga0496117_0007466_5041_5946 301
367 3300048920 Ga0496117_0096449 Ga0496117_0096449_145_1050 301
368 3300048921 Ga0496118_0000417 Ga0496118_0000417_67300_68205 301
369 3300048921 Ga0496118_0000616 Ga0496118_0000616_27322_28227 301
370 3300048922 Ga0496119_0000030 Ga0496119_0000030_194380_195285 301
371 3300048923 Ga0496120_0000033 Ga0496120_0000033_44891_45796 301
372 3300048924 Ga0496121_0000063 Ga0496121_0000063_42126_43031 301
373 3300048924 Ga0496121_0019765 Ga0496121_0019765_5079_5984 301
374 3300048928 Ga0496125_0198532 Ga0496125_0198532_210_1115 301
375 3300048929 Ga0496126_0000134 Ga0496126_0000134_84933_85838 301
376 3300053090 Ga0500646_0002799 Ga0500646_0002799_27_932 301
377 3300001904 JGI24736J21556_1000401 JGI24736J21556_10004015 303
378 3300013104 Ga0157370_10116516 Ga0157370_101165163 303
379 3300013105 Ga0157369_10002147 Ga0157369_1000214714 303
380 3300015265 Ga0182005_1000004 Ga0182005_1000004212 303
381 3300025304 Ga0209257_1022187 Ga0209257_10221872 303
382 3300025904 Ga0207647_10000002 Ga0207647_10000002111 303
383 3300046491 Ga0495584_0018293 Ga0495584_0018293_2272_3183 303
384 3300046507 Ga0495606_0000905 Ga0495606_0000905_24318_25229 303
385 3300046513 Ga0495616_0000001 Ga0495616_0000001_213627_214538 303
386 3300046515 Ga0495620_0001004 Ga0495620_0001004_11220_12131 303
387 3300046691 Ga0495670_0049873 Ga0495670_0049873_553_1464 303
388 3300047472 Ga0495686_0000028 Ga0495686_0000028_40739_41650 303
389 3300047472 Ga0495686_0026744 Ga0495686_0026744_936_1847 303
390 3300048904 Ga0496101_0002589 Ga0496101_0002589_618_1529 303
391 3300048905 Ga0496102_0222821 Ga0496102_0222821_96_1007 303
392 3300048911 Ga0496108_0187181 Ga0496108_0187181_649_1560 303
393 3300048920 Ga0496117_0006430 Ga0496117_0006430_4109_5020 303
394 3300048921 Ga0496118_0000706 Ga0496118_0000706_36082_36993 303
395 3300048921 Ga0496118_0000940 Ga0496118_0000940_7754_8665 303
396 3300048921 Ga0496118_0187593 Ga0496118_0187593_255_1166 303
397 3300048924 Ga0496121_0000116 Ga0496121_0000116_50363_51274 303
398 3300048924 Ga0496121_0000390 Ga0496121_0000390_54033_54944 303
399 3300048926 Ga0496123_0096793 Ga0496123_0096793_221_1132 303
400 3300048928 Ga0496125_0004355 Ga0496125_0004355_11799_12710 303
401 3300048929 Ga0496126_0307759 Ga0496126_0307759_321_1232 303

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

69

300

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1k77-assembly1.cif.gz_A crystal structure of ec1530, a putative oxygenase from escherichia coli 0.831 50 294
3ngf-assembly1.cif.gz_A crystal structure of ap endonuclease, family 2 from brucella melitensis 0.8303 50 295
3kws-assembly1.cif.gz_B crystal structure of putative sugar isomerase (yp_001305149.1) from parabacteroides distasonis atcc 8503 at 1.68 a resolution 0.7968 52 300
3vyl-assembly2.cif.gz_H structure of l-ribulose 3-epimerase 0.7946 52 298
3ngf-assembly1.cif.gz_A crystal structure of ap endonuclease, family 2 from brucella melitensis 0.7926 50 295
ID Description Score Start End Superfamily
af_P30147_1_258_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8428 52 294 3.20.20.150
af_Q7T3H9_4_269_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8416 52 294 3.20.20.150
af_P36951_1_261_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8338 52 300 3.20.20.150
1k77A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8246 51 287 3.20.20.150
af_P36951_1_261_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7962 52 300 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A2V7GEV8-F1-model_v4 Xylose isomerase-like TIM barrel domain-containing protein 0.9379 100 303 GO:0016853
AF-A0A258WQI7-F1-model_v4 Hydroxypyruvate isomerase 0.9364 51 303 GO:0016853
AF-A0A0B6WYZ6-F1-model_v4 Hydroxypyruvate isomerase (EC 5.3.1.22) 0.9363 46 303 GO:0008903
AF-A0A1Q8AJ47-F1-model_v4 Hydroxypyruvate isomerase 0.9362 54 303 GO:0016853
AF-A0A520HS35-F1-model_v4 Hydroxypyruvate isomerase 0.9348 52 303 GO:0016853

Feature Viewer

pLDDT pTM Quality
83.65 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map