F434697

General Info

Members Datasets Scaffolds Average Seq Length
400 252 400 275

Family's Representative Sequence

Representative Sequence 3300049591|Ga0501075_0267765|Ga0501075_0267765_284_1216
Length 310
Sequence MRGLPDLLRARLAANGGRSYRQSDLIPLREGAMAAGSQSERAQAFRALHEQPGAFVIPNPWDVGTARILAGLGFEALATTSAGMAFALGRRDGAVGREEALAHARAIVAATPLPVSADLENGFGDAPETVAETIRLAASTGLVGASIEDASGDPDHPIYDRALAVERVAAAVEAAGSLPFPFTLTARAENFLHGRPDLDDTLSRLQAFEAAGADVLYAPGLRDLDSIRAVCEALAKPVNVIMAIAGTAFAVAELAAVGVRRTSLGSALSRVALGAFLRAAREIAERGTFTCAEEAAGFADLEPFLQGRAP

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
160 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
161 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
162 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
163 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
164 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
165 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
166 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
167 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
168 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
169 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
170 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
171 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
172 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
173 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
174 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
177 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
178 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
193 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
194 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
195 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
196 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
197 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
198 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
213 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
214 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
249 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.5
Nodule 0
Rhizoplane 1.5
Rhizosphere 94
Stem 0
Stem Tuber 0
Unclassified 2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10056770 3300005327 Bacteria 3183
2 Ga0070676_10000495 3300005328 Bacteria 18737
3 Ga0070690_100007780 3300005330 Bacteria 6143
4 Ga0070670_100013981 3300005331 Bacteria 6882
5 Ga0068869_100000166 3300005334 Bacteria 32985
6 Ga0068869_100000337 3300005334 Bacteria 25056
7 Ga0070680_100000311 3300005336 Bacteria 32479
8 Ga0070680_100000763 3300005336 Bacteria 22539
9 Ga0070680_100006493 3300005336 Bacteria 8897
10 Ga0070680_100057777 3300005336 Bacteria 3172
11 Ga0070682_100000904 3300005337 Bacteria 17336
12 Ga0068868_100000378 3300005338 Bacteria 30380
13 Ga0068868_100002587 3300005338 Bacteria 12546
14 Ga0070660_100002232 3300005339 Bacteria 13349
15 Ga0070689_100011186 3300005340 Bacteria 6421
16 Ga0070689_100018172 3300005340 Bacteria 5176
17 Ga0070691_10000874 3300005341 Bacteria 12209
18 Ga0070691_10004072 3300005341 Bacteria 6627
19 Ga0070691_10010969 3300005341 Bacteria 4139
20 Ga0070687_100023934 3300005343 Bacteria 2908
21 Ga0070687_100067337 3300005343 Bacteria 1911
22 Ga0070661_100000690 3300005344 Bacteria 24823
23 Ga0070692_10001138 3300005345 Bacteria 9329
24 Ga0070692_10001181 3300005345 Bacteria 9229
25 Ga0070692_10009393 3300005345 Bacteria 4409
26 Ga0070669_100113142 3300005353 Bacteria 2062
27 Ga0070675_100036057 3300005354 Bacteria 4023
28 Ga0070671_100027134 3300005355 Bacteria 4711
29 Ga0070674_100554390 3300005356 Bacteria 965
30 Ga0070659_100003885 3300005366 Bacteria 10645
31 Ga0070667_100484848 3300005367 Bacteria 1132
32 Ga0070703_10027151 3300005406 Bacteria 1705
33 Ga0070701_10000027 3300005438 Bacteria 38022
34 Ga0070701_10016989 3300005438 Bacteria 3394
35 Ga0070705_100000167 3300005440 Bacteria 38185
36 Ga0070705_100010535 3300005440 Bacteria 4632
37 Ga0070705_100064543 3300005440 Unclassified 2188
38 Ga0070700_100003008 3300005441 Bacteria 8643
39 Ga0070700_100031063 3300005441 Bacteria 3197
40 Ga0070694_100000096 3300005444 Bacteria 42431
41 Ga0070694_100000860 3300005444 Bacteria 17103
42 Ga0070708_100079640 3300005445 Bacteria 2964
43 Ga0070663_100283738 3300005455 Bacteria 1320
44 Ga0070678_100087552 3300005456 Bacteria 2379
45 Ga0070678_100250405 3300005456 Bacteria 1485
46 Ga0070662_100014293 3300005457 Bacteria 5301
47 Ga0070681_10001265 3300005458 Bacteria 22037
48 Ga0070681_10068197 3300005458 Bacteria 3524
49 Ga0068867_100000786 3300005459 Bacteria 21472
50 Ga0068867_100003298 3300005459 Bacteria 11365
51 Ga0070706_100079858 3300005467 Bacteria 3028
52 Ga0070706_100122487 3300005467 Bacteria 2424
53 Ga0070707_100139795 3300005468 Bacteria 2356
54 Ga0070707_100725167 3300005468 Bacteria 957
55 Ga0070698_100005830 3300005471 Bacteria 13472
56 Ga0070699_100008193 3300005518 Bacteria 9067
57 Ga0070699_100131664 3300005518 Bacteria 2205
58 Ga0070679_100001012 3300005530 Bacteria 24481
59 Ga0070679_100013386 3300005530 Bacteria 7855
60 Ga0070684_100017044 3300005535 Bacteria 5954
61 Ga0070697_100170786 3300005536 Bacteria 1840
62 Ga0068853_100001067 3300005539 Bacteria 19362
63 Ga0070686_100001404 3300005544 Bacteria 13583
64 Ga0070695_100009431 3300005545 Bacteria 5811
65 Ga0070695_100014893 3300005545 Bacteria 4691
66 Ga0070695_100049441 3300005545 Bacteria 2692
67 Ga0070696_100000655 3300005546 Bacteria 22149
68 Ga0070696_100001291 3300005546 Bacteria 16329
69 Ga0070693_100000003 3300005547 Bacteria 95793
70 Ga0070693_100000132 3300005547 Bacteria 33578
71 Ga0070665_100029828 3300005548 Bacteria 5489
72 Ga0070665_100051986 3300005548 Bacteria 4110
73 Ga0070704_100000056 3300005549 Bacteria 36580
74 Ga0070704_100063040 3300005549 Bacteria 2659
75 Ga0070704_100273515 3300005549 Bacteria 1396
76 Ga0068855_100000113 3300005563 Bacteria 100669
77 Ga0068855_100007058 3300005563 Bacteria 13625
78 Ga0068855_100085343 3300005563 Bacteria 3653
79 Ga0068857_100023128 3300005577 Bacteria 5467
80 Ga0068857_100080526 3300005577 Bacteria 2908
81 Ga0068854_100000304 3300005578 Bacteria 32367
82 Ga0068854_100001375 3300005578 Bacteria 14642
83 Ga0068856_100002272 3300005614 Bacteria 19821
84 Ga0068856_100171512 3300005614 Bacteria 2182
85 Ga0070702_100000004 3300005615 Bacteria 70302
86 Ga0070702_100002026 3300005615 Bacteria 8556
87 Ga0068852_100122329 3300005616 Bacteria 2385
88 Ga0068852_100497331 3300005616 Bacteria 1214
89 Ga0068859_100000364 3300005617 Bacteria 45031
90 Ga0068864_100014614 3300005618 Bacteria 6520
91 Ga0068861_100002640 3300005719 Bacteria 11727
92 Ga0068861_100009033 3300005719 Bacteria 6871
93 Ga0068851_10149828 3300005834 Bacteria 1274
94 Ga0068870_10000100 3300005840 Bacteria 28708
95 Ga0068870_10100549 3300005840 Bacteria 1633
96 Ga0068863_100102272 3300005841 Bacteria 2724
97 Ga0068858_100034863 3300005842 Bacteria 4668
98 Ga0068860_100001014 3300005843 Bacteria 31089
99 Ga0068860_100018800 3300005843 Bacteria 6713
100 Ga0068862_100002730 3300005844 Bacteria 15498
101 Ga0068862_100015174 3300005844 Bacteria 6397
102 Ga0068862_100185342 3300005844 Bacteria 1870
103 Ga0068862_100303135 3300005844 Bacteria 1470
104 Ga0081455_10009207 3300005937 Bacteria 10175
105 Ga0081538_10039513 3300005981 Bacteria 3025
106 Ga0070716_100427956 3300006173 Bacteria 959
107 Ga0070712_100058513 3300006175 Bacteria 2711
108 Ga0075366_10005759 3300006195 Bacteria 6728
109 Ga0097621_100000574 3300006237 Bacteria 25858
110 Ga0097621_100155130 3300006237 Bacteria 1965
111 Ga0068871_100000688 3300006358 Bacteria 23017
112 Ga0075428_100022540 3300006844 Bacteria 6972
113 Ga0075428_100211575 3300006844 Bacteria 2095
114 Ga0075430_100117186 3300006846 Bacteria 2220
115 Ga0075431_100001284 3300006847 Bacteria 22920
116 Ga0075431_100017605 3300006847 Bacteria 7263
117 Ga0075433_10001270 3300006852 Bacteria 18429
118 Ga0075434_100019777 3300006871 Bacteria 6519
119 Ga0075434_100238390 3300006871 Bacteria 1839
120 Ga0075429_100000496 3300006880 Bacteria 29568
121 Ga0075429_100032848 3300006880 Bacteria 4510
122 Ga0068865_100009905 3300006881 Bacteria 5922
123 Ga0075436_100067428 3300006914 Bacteria 2473
124 Ga0097620_100000364 3300006931 Bacteria 45031
125 Ga0075435_100150457 3300007076 Bacteria 1956
126 Ga0099795_10017844 3300007788 Bacteria 2270
127 Ga0099795_10059403 3300007788 Bacteria 1414
128 Ga0105240_10061063 3300009093 Bacteria 4697
129 Ga0111539_10466527 3300009094 Bacteria 1470
130 Ga0105245_10002146 3300009098 Bacteria 17867
131 Ga0105245_10234944 3300009098 Bacteria 1775
132 Ga0114129_10000149 3300009147 Bacteria 73883
133 Ga0114129_10011670 3300009147 Bacteria 12504
134 Ga0114129_10384829 3300009147 Bacteria 1852
135 Ga0114129_11213668 3300009147 Bacteria 939
136 Ga0105243_10000762 3300009148 Bacteria 30880
137 Ga0105243_10004881 3300009148 Bacteria 10523
138 Ga0105241_10004101 3300009174 Bacteria 10759
139 Ga0105241_10082555 3300009174 Bacteria 2519
140 Ga0105242_10000326 3300009176 Bacteria 38185
141 Ga0105242_10069341 3300009176 Bacteria 2920
142 Ga0105242_10528692 3300009176 Bacteria 1127
143 Ga0105248_10074969 3300009177 Bacteria 3803
144 Ga0105237_10368288 3300009545 Bacteria 1442
145 Ga0105249_10011495 3300009553 Bacteria 7776
146 Ga0105249_10437058 3300009553 Bacteria 1345
147 Ga0105028_101819 3300009993 Bacteria 2237
148 Ga0099796_10078025 3300010159 Bacteria 1209
149 Ga0099796_10081661 3300010159 Bacteria 1186
150 Ga0105239_10069063 3300010375 Bacteria 3882
151 Ga0105239_10608109 3300010375 Bacteria 1247
152 Ga0157373_10000159 3300013100 Bacteria 54799
153 Ga0157371_10143145 3300013102 Bacteria 1703
154 Ga0157378_10000192 3300013297 Bacteria 59014
155 Ga0157372_10000113 3300013307 Bacteria 85757
156 Ga0157375_11074736 3300013308 Bacteria 941
157 Ga0163163_10279979 3300014325 Bacteria 1719
158 Ga0157380_10030793 3300014326 Bacteria 4112
159 Ga0157376_10001688 3300014969 Bacteria 14679
160 Ga0209050_1005883 3300025298 Bacteria 7496
161 Ga0209051_1040503 3300025303 Bacteria 1669
162 Ga0209257_1001100 3300025304 Bacteria 35215
163 Ga0209257_1047365 3300025304 Bacteria 1237
164 Ga0207642_10003637 3300025899 Bacteria 4892
165 Ga0207688_10033833 3300025901 Bacteria 2828
166 Ga0207680_10285925 3300025903 Bacteria 1147
167 Ga0207645_10000434 3300025907 Bacteria 34660
168 Ga0207643_10000059 3300025908 Bacteria 73469
169 Ga0207643_10114108 3300025908 Bacteria 1594
170 Ga0207684_10029113 3300025910 Bacteria 4704
171 Ga0207684_10204900 3300025910 Bacteria 1702
172 Ga0207654_10001851 3300025911 Bacteria 10947
173 Ga0207654_10005597 3300025911 Bacteria 6355
174 Ga0207707_10000207 3300025912 Bacteria 62455
175 Ga0207707_10215906 3300025912 Bacteria 1670
176 Ga0207695_10026146 3300025913 Bacteria 6517
177 Ga0207693_10154071 3300025915 Bacteria 1808
178 Ga0207663_10244781 3300025916 Bacteria 1317
179 Ga0207660_10000425 3300025917 Bacteria 27778
180 Ga0207660_10016601 3300025917 Bacteria 4877
181 Ga0207660_10020677 3300025917 Bacteria 4421
182 Ga0207662_10000101 3300025918 Bacteria 40813
183 Ga0207662_10019757 3300025918 Bacteria 3838
184 Ga0207657_10000209 3300025919 Bacteria 60459
185 Ga0207649_10004671 3300025920 Bacteria 7408
186 Ga0207649_10429827 3300025920 Bacteria 993
187 Ga0207652_10000105 3300025921 Bacteria 91044
188 Ga0207652_10021418 3300025921 Bacteria 5335
189 Ga0207652_10057589 3300025921 Bacteria 3347
190 Ga0207646_10063532 3300025922 Bacteria 3296
191 Ga0207646_10612749 3300025922 Bacteria 977
192 Ga0207681_10074214 3300025923 Bacteria 2382
193 Ga0207694_10157074 3300025924 Bacteria 1835
194 Ga0207650_10003138 3300025925 Bacteria 11388
195 Ga0207659_10077933 3300025926 Bacteria 2441
196 Ga0207659_10107019 3300025926 Bacteria 2118
197 Ga0207687_10002779 3300025927 Bacteria 11874
198 Ga0207700_10372101 3300025928 Bacteria 1248
199 Ga0207644_10032175 3300025931 Bacteria 3657
200 Ga0207690_10001697 3300025932 Bacteria 13575
201 Ga0207706_10007226 3300025933 Bacteria 10269
202 Ga0207706_10437267 3300025933 Bacteria 1133
203 Ga0207686_10002692 3300025934 Bacteria 9643
204 Ga0207686_10097338 3300025934 Bacteria 1957
205 Ga0207709_10001269 3300025935 Bacteria 18055
206 Ga0207709_10155295 3300025935 Bacteria 1590
207 Ga0207670_10009854 3300025936 Bacteria 5471
208 Ga0207670_10026410 3300025936 Bacteria 3658
209 Ga0207670_10149837 3300025936 Bacteria 1730
210 Ga0207704_10031775 3300025938 Bacteria 2979
211 Ga0207665_10007219 3300025939 Bacteria 7352
212 Ga0207691_10373976 3300025940 Bacteria 1217
213 Ga0207711_10065209 3300025941 Bacteria 3148
214 Ga0207689_10000103 3300025942 Bacteria 69244
215 Ga0207689_10001068 3300025942 Bacteria 26392
216 Ga0207661_10135818 3300025944 Bacteria 2112
217 Ga0207679_10000209 3300025945 Bacteria 46566
218 Ga0207667_10000372 3300025949 Bacteria 60711
219 Ga0207712_10352473 3300025961 Bacteria 1224
220 Ga0207640_10002032 3300025981 Bacteria 10935
221 Ga0207677_10001533 3300026023 Bacteria 12230
222 Ga0207677_10012832 3300026023 Bacteria 4835
223 Ga0207703_10020230 3300026035 Bacteria 5204
224 Ga0207703_10080624 3300026035 Bacteria 2711
225 Ga0207678_10304435 3300026067 Bacteria 1370
226 Ga0207708_10000048 3300026075 Bacteria 114754
227 Ga0207708_10014476 3300026075 Bacteria 5903
228 Ga0207702_10001726 3300026078 Bacteria 21510
229 Ga0207702_10033331 3300026078 Bacteria 4302
230 Ga0207702_10082288 3300026078 Bacteria 2799
231 Ga0207641_10015338 3300026088 Bacteria 6279
232 Ga0207641_10377304 3300026088 Bacteria 1357
233 Ga0207648_10000124 3300026089 Bacteria 75549
234 Ga0207648_10000170 3300026089 Bacteria 67608
235 Ga0207676_10019160 3300026095 Bacteria 4987
236 Ga0207676_10019545 3300026095 Bacteria 4944
237 Ga0207676_10180957 3300026095 Bacteria 1846
238 Ga0207674_10000585 3300026116 Bacteria 47921
239 Ga0207674_10013493 3300026116 Bacteria 9062
240 Ga0207674_10362977 3300026116 Bacteria 1400
241 Ga0207675_100000593 3300026118 Bacteria 35437
242 Ga0207675_100016445 3300026118 Bacteria 6909
243 Ga0207683_10017124 3300026121 Bacteria 6169
244 Ga0207683_10284698 3300026121 Bacteria 1511
245 Ga0207698_10597794 3300026142 Bacteria 1087
246 Ga0207428_10002437 3300027907 Bacteria 18586
247 Ga0268266_10020571 3300028379 Bacteria 5623
248 Ga0268265_10003127 3300028380 Bacteria 12063
249 Ga0268265_10059983 3300028380 Bacteria 2913
250 Ga0268265_10332683 3300028380 Unclassified 1380
251 Ga0268264_10001425 3300028381 Bacteria 22366
252 Ga0268264_10005874 3300028381 Bacteria 10389
253 Ga0268264_10239854 3300028381 Bacteria 1679
254 Ga0307409_100092064 3300031995 Bacteria 2487
255 Ga0373930_0022827 3300034816 Bacteria 1240
256 Ga0373948_0025524 3300034817 Bacteria 1159
257 Ga0373950_0009438 3300034818 Bacteria 1559
258 Ga0373959_0041239 3300034820 Bacteria 969
259 Ga0373938_0039412 3300034957 Bacteria 1044
260 Ga0373926_0007068 3300035083 Bacteria 3735
261 Ga0373928_0016344 3300035084 Bacteria 1518
262 Ga0373934_0000089 3300035086 Bacteria 31589
263 Ga0373934_0006076 3300035086 Bacteria 4470
264 Ga0373944_0002308 3300035089 Bacteria 4857
265 Ga0373949_0005337 3300035090 Bacteria 2870
266 Ga0373949_0008834 3300035090 Bacteria 2204
267 Ga0373932_0001851 3300035112 Bacteria 5670
268 Ga0373932_0020026 3300035112 Bacteria 1750
269 Ga0373941_0004548 3300035115 Bacteria 3213
270 Ga0373941_0021383 3300035115 Bacteria 1825
271 Ga0373945_0002297 3300035116 Bacteria 5982
272 Ga0373954_0000626 3300035118 Bacteria 13489
273 Ga0373954_0018568 3300035118 Bacteria 3132
274 Ga0373956_0167986 3300035119 Bacteria 1035
275 Ga0373960_0003451 3300035121 Bacteria 3582
276 Ga0373960_0075607 3300035121 Bacteria 1050
277 Ga0373943_0092584 3300035170 Bacteria 1568
278 Ga0373942_0029599 3300035207 Bacteria 1438
279 Ga0373961_0050407 3300035241 Bacteria 1233
280 Ga0373962_0066356 3300035242 Bacteria 1070
281 Ga0373931_0000594 3300035691 Bacteria 14942
282 Ga0373931_0024853 3300035691 Bacteria 3039
283 Ga0373931_0071680 3300035691 Bacteria 1893
284 Ga0373931_0072007 3300035691 Bacteria 1889
285 Ga0373931_0235912 3300035691 Bacteria 1107
286 Ga0373935_0483543 3300035692 Bacteria 897
287 Ga0373927_0334675 3300035695 Bacteria 997
288 Ga0373933_0005232 3300035724 Bacteria 7079
289 Ga0373947_0371377 3300035725 Bacteria 962
290 Ga0373937_0042900 3300036401 Bacteria 4128
291 Ga0373937_0109627 3300036401 Bacteria 2567
292 Ga0373937_0567582 3300036401 Bacteria 1078
293 Ga0373925_0148933 3300037068 Bacteria 1836
294 Ga0373925_0152088 3300037068 Bacteria 1818
295 Ga0373925_0178279 3300037068 Bacteria 1680
296 Ga0395899_0004184 3300037312 Bacteria 11332
297 Ga0395899_0100288 3300037312 Bacteria 2091
298 Ga0395900_0045956 3300037418 Bacteria 4497
299 Ga0395900_0116844 3300037418 Bacteria 2737
300 Ga0395898_0014917 3300037466 Bacteria 7978
301 Ga0395898_0018563 3300037466 Bacteria 7090
302 Ga0395901_0004642 3300038443 Bacteria 13858
303 Ga0395901_0010633 3300038443 Bacteria 9325
304 Ga0395901_0013096 3300038443 Bacteria 8417
305 Ga0395901_0058965 3300038443 Bacteria 3993
306 Ga0400483_076041 3300039062 Bacteria 20398
307 Ga0400483_099545 3300039062 Bacteria 4785
308 Ga0400483_199249 3300039062 Bacteria 1443
309 Ga0400483_222778 3300039062 Bacteria 11316
310 Ga0400483_240732 3300039062 Bacteria 1371
311 Ga0436365_0326209 3300039437 Bacteria 2106
312 Ga0436365_1142450 3300039437 Bacteria 1773
313 Ga0436365_1596392 3300039437 Bacteria 3115
314 Ga0436362_1176906 3300039453 Unclassified 1478
315 Ga0439465_0004548 3300041413 Bacteria 4483
316 Ga0439441_029477 3300042001 Bacteria 1057
317 Ga0439448_0000128 3300042005 Bacteria 14238
318 Ga0439459_0001765 3300042438 Bacteria 3237
319 Ga0439460_0027686 3300042461 Bacteria 1594
320 Ga0451577_0046606 3300042876 Bacteria 3878
321 Ga0451577_0052708 3300042876 Bacteria 3632
322 Ga0451576_0016604 3300045051 Bacteria 8120
323 Ga0451576_0019565 3300045051 Bacteria 7388
324 Ga0451576_0024042 3300045051 Bacteria 6585
325 Ga0451576_0266430 3300045051 Bacteria 1791
326 Ga0495592_0118979 3300046454 Bacteria 1860
327 Ga0495592_0388799 3300046454 Bacteria 886
328 Ga0495603_0008408 3300046455 Bacteria 6233
329 Ga0495651_0174678 3300046462 Bacteria 1526
330 Ga0495580_0012133 3300046472 Bacteria 6626
331 Ga0495580_0114451 3300046472 Bacteria 1873
332 Ga0495639_0003282 3300046475 Bacteria 7023
333 Ga0495608_0019087 3300046511 Bacteria 4726
334 Ga0495628_0004597 3300046516 Bacteria 12201
335 Ga0495630_0126182 3300046517 Bacteria 1942
336 Ga0495630_0220149 3300046517 Bacteria 1449
337 Ga0495666_0014350 3300046526 Bacteria 3945
338 Ga0495666_0043000 3300046526 Bacteria 2183
339 Ga0495586_0004072 3300046535 Bacteria 7832
340 Ga0495645_0070989 3300046543 Bacteria 2512
341 Ga0495667_0173378 3300046559 Bacteria 1385
342 Ga0495599_0219657 3300046678 Bacteria 1163
343 Ga0495646_0007052 3300046680 Bacteria 7139
344 Ga0495647_0001622 3300046681 Bacteria 6951
345 Ga0495658_0003634 3300046683 Bacteria 7634
346 Ga0495658_0349597 3300046683 Bacteria 939
347 Ga0495636_0038198 3300047318 Bacteria 1985
348 Ga0495676_0110542 3300047321 Bacteria 2017
349 Ga0496106_0108534 3300048909 Bacteria 2159
350 Ga0496110_0263468 3300048913 Bacteria 1569
351 Ga0496110_0310667 3300048913 Bacteria 1436
352 Ga0496112_0056344 3300048915 Bacteria 3868
353 Ga0496112_0074003 3300048915 Bacteria 3368
354 Ga0496113_0012541 3300048916 Bacteria 5702
355 Ga0501033_0048350 3300049570 Bacteria 3160
356 Ga0501034_0016300 3300049571 Bacteria 7628
357 Ga0501034_0170443 3300049571 Bacteria 2144
358 Ga0501039_0277672 3300049575 Bacteria 1317
359 Ga0501042_0018652 3300049578 Bacteria 4807
360 Ga0501046_0317934 3300049580 Bacteria 1135
361 Ga0501047_0246588 3300049581 Bacteria 1635
362 Ga0501069_0110377 3300049585 Bacteria 1566
363 Ga0501071_0239133 3300049587 Bacteria 1369
364 Ga0501072_0193001 3300049588 Bacteria 1624
365 Ga0501075_0012336 3300049591 Bacteria 6072
366 Ga0501075_0267765 3300049591 Bacteria 1302
367 Ga0501079_0153863 3300049741 Bacteria 1793
368 Ga0501079_0429808 3300049741 Bacteria 1037
369 Ga0501081_0181859 3300049743 Bacteria 1521
370 Ga0501044_0022520 3300049823 Bacteria 6713
371 Ga0501045_0123192 3300049824 Bacteria 1925
372 nmdc:mga0yw44_7662_c1 3300050492 Bacteria 4796
373 nmdc:mga0k408_4564_c1 3300050493 Bacteria 6618
374 nmdc:mga06z11_49977_c1 3300050494 Bacteria 2135
375 nmdc:mga05p37_194093_c1 3300050507 Bacteria 2463
376 nmdc:mga05p37_3874_c1 3300050507 Bacteria 17498
377 nmdc:mga05p37_4197_c1 3300050507 Bacteria 16837
378 nmdc:mga09592_10845_c1 3300050508 Bacteria 7415
379 nmdc:mga09592_28735_c1 3300050508 Bacteria 4622
380 nmdc:mga0qj67_243577_c1 3300050509 Bacteria 1459
381 nmdc:mga06r32_3531_c1 3300050510 Bacteria 13964
382 nmdc:mga08y16_790_c1 3300050511 Bacteria 30222
383 nmdc:mga0n895_355702_c1 3300050512 Bacteria 1483
384 nmdc:mga0n895_461969_c1 3300050512 Bacteria 1281
385 nmdc:mga0n895_50402_c1 3300050512 Bacteria 4082
386 nmdc:mga0n895_7395_c1 3300050512 Bacteria 9424
387 nmdc:mga08x19_173620_c1 3300050514 Bacteria 1469
388 nmdc:mga08x19_175001_c1 3300050514 Bacteria 1463
389 nmdc:mga08x19_18991_c1 3300050514 Bacteria 4215
390 nmdc:mga0a205_60724_c1 3300050515 Bacteria 3651
391 nmdc:mga0a205_8224_c1 3300050515 Bacteria 9481
392 Ga0495601_0001532 3300053077 Bacteria 12756
393 Ga0500616_0001962 3300053153 Bacteria 18325
394 Ga0500552_000898 3300053733 Bacteria 2807
395 Ga0501084_0013356 3300054114 Bacteria 6795
396 Ga0501084_0153947 3300054114 Bacteria 1939
397 Ga0501082_0035024 3300060353 Bacteria 4327
398 Ga0530510_0077976 3300061734 Bacteria 2408
399 Ga0530510_0331902 3300061734 Bacteria 1141
400 Ga0530510_0423378 3300061734 Bacteria 1005

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035692 Ga0373935_0483543 Ga0373935_0483543_122_883 242
2 3300046454 Ga0495592_0388799 Ga0495592_0388799_110_871 242
3 3300039062 Ga0400483_076041 Ga0400483_076041_14573_15343 248
4 3300039062 Ga0400483_222778 Ga0400483_222778_10508_11278 248
5 3300046526 Ga0495666_0043000 Ga0495666_0043000_1358_2119 250
6 3300046543 Ga0495645_0070989 Ga0495645_0070989_927_1742 252
7 3300005440 Ga0070705_100064543 Ga0070705_1000645432 253
8 3300049741 Ga0501079_0429808 Ga0501079_0429808_112_951 256
9 3300009993 Ga0105028_101819 Ga0105028_1018192 257
10 3300046454 Ga0495592_0118979 Ga0495592_0118979_395_1222 258
11 3300046462 Ga0495651_0174678 Ga0495651_0174678_203_1030 258
12 3300046516 Ga0495628_0004597 Ga0495628_0004597_1151_1978 258
13 3300046678 Ga0495599_0219657 Ga0495599_0219657_225_1052 258
14 3300053077 Ga0495601_0001532 Ga0495601_0001532_10681_11508 258
15 3300047318 Ga0495636_0038198 Ga0495636_0038198_1019_1846 261
16 3300010159 Ga0099796_10081661 Ga0099796_100816612 262
17 3300035119 Ga0373956_0167986 Ga0373956_0167986_195_1001 262
18 3300046680 Ga0495646_0007052 Ga0495646_0007052_6305_7111 262
19 3300007788 Ga0099795_10017844 Ga0099795_100178442 264
20 3300035118 Ga0373954_0000626 Ga0373954_0000626_438_1265 264
21 3300036401 Ga0373937_0109627 Ga0373937_0109627_91_918 264
22 3300046517 Ga0495630_0126182 Ga0495630_0126182_420_1247 264
23 3300046559 Ga0495667_0173378 Ga0495667_0173378_293_1120 264
24 3300061734 Ga0530510_0331902 Ga0530510_0331902_226_1032 265
25 3300039062 Ga0400483_099545 Ga0400483_099545_2569_3375 266
26 3300039062 Ga0400483_199249 Ga0400483_199249_481_1287 266
27 3300039062 Ga0400483_240732 Ga0400483_240732_21_821 266
28 3300041413 Ga0439465_0004548 Ga0439465_0004548_1103_1927 267
29 3300025298 Ga0209050_1005883 Ga0209050_10058835 268
30 3300025303 Ga0209051_1040503 Ga0209051_10405032 268
31 3300025304 Ga0209257_1001100 Ga0209257_100110020 268
32 3300049587 Ga0501071_0239133 Ga0501071_0239133_511_1347 268
33 3300049588 Ga0501072_0193001 Ga0501072_0193001_38_874 268
34 3300049743 Ga0501081_0181859 Ga0501081_0181859_88_924 268
35 3300039453 Ga0436362_1176906 Ga0436362_1176906_101_919 269
36 3300046526 Ga0495666_0014350 Ga0495666_0014350_621_1442 269
37 3300005518 Ga0070699_100131664 Ga0070699_1001316642 270
38 3300009147 Ga0114129_11213668 Ga0114129_112136681 270
39 3300025304 Ga0209257_1047365 Ga0209257_10473651 270
40 3300035118 Ga0373954_0018568 Ga0373954_0018568_927_1757 270
41 3300035170 Ga0373943_0092584 Ga0373943_0092584_177_1007 270
42 3300035724 Ga0373933_0005232 Ga0373933_0005232_926_1756 270
43 3300035725 Ga0373947_0371377 Ga0373947_0371377_50_880 270
44 3300036401 Ga0373937_0042900 Ga0373937_0042900_1133_1963 270
45 3300037068 Ga0373925_0148933 Ga0373925_0148933_789_1619 270
46 3300046511 Ga0495608_0019087 Ga0495608_0019087_1110_1940 270
47 3300049591 Ga0501075_0267765 Ga0501075_0267765_284_1216 270
48 3300054114 Ga0501084_0153947 Ga0501084_0153947_874_1809 270
49 3300061734 Ga0530510_0077976 Ga0530510_0077976_1105_1932 270
50 3300005328 Ga0070676_10000495 Ga0070676_1000049511 271
51 3300005331 Ga0070670_100013981 Ga0070670_1000139813 271
52 3300005334 Ga0068869_100000166 Ga0068869_10000016611 271
53 3300005336 Ga0070680_100000311 Ga0070680_10000031111 271
54 3300005337 Ga0070682_100000904 Ga0070682_1000009043 271
55 3300005338 Ga0068868_100002587 Ga0068868_1000025877 271
56 3300005339 Ga0070660_100002232 Ga0070660_1000022324 271
57 3300005340 Ga0070689_100018172 Ga0070689_1000181722 271
58 3300005341 Ga0070691_10010969 Ga0070691_100109693 271
59 3300005343 Ga0070687_100067337 Ga0070687_1000673372 271
60 3300005344 Ga0070661_100000690 Ga0070661_10000069019 271
61 3300005345 Ga0070692_10001181 Ga0070692_100011818 271
62 3300005353 Ga0070669_100113142 Ga0070669_1001131422 271
63 3300005366 Ga0070659_100003885 Ga0070659_1000038853 271
64 3300005367 Ga0070667_100484848 Ga0070667_1004848482 271
65 3300005440 Ga0070705_100000167 Ga0070705_1000001672 271
66 3300005440 Ga0070705_100010535 Ga0070705_1000105354 271
67 3300005444 Ga0070694_100000860 Ga0070694_1000008607 271
68 3300005455 Ga0070663_100283738 Ga0070663_1002837382 271
69 3300005457 Ga0070662_100014293 Ga0070662_1000142932 271
70 3300005458 Ga0070681_10001265 Ga0070681_100012653 271
71 3300005459 Ga0068867_100000786 Ga0068867_1000007865 271
72 3300005467 Ga0070706_100122487 Ga0070706_1001224872 271
73 3300005468 Ga0070707_100139795 Ga0070707_1001397952 271
74 3300005471 Ga0070698_100005830 Ga0070698_1000058302 271
75 3300005518 Ga0070699_100008193 Ga0070699_1000081932 271
76 3300005530 Ga0070679_100013386 Ga0070679_1000133866 271
77 3300005535 Ga0070684_100017044 Ga0070684_1000170444 271
78 3300005536 Ga0070697_100170786 Ga0070697_1001707862 271
79 3300005539 Ga0068853_100001067 Ga0068853_10000106712 271
80 3300005545 Ga0070695_100014893 Ga0070695_1000148934 271
81 3300005546 Ga0070696_100000655 Ga0070696_10000065514 271
82 3300005547 Ga0070693_100000132 Ga0070693_1000001323 271
83 3300005549 Ga0070704_100000056 Ga0070704_10000005628 271
84 3300005563 Ga0068855_100000113 Ga0068855_10000011357 271
85 3300005577 Ga0068857_100023128 Ga0068857_1000231282 271
86 3300005578 Ga0068854_100001375 Ga0068854_1000013752 271
87 3300005614 Ga0068856_100002272 Ga0068856_1000022727 271
88 3300005615 Ga0070702_100002026 Ga0070702_1000020265 271
89 3300005616 Ga0068852_100122329 Ga0068852_1001223292 271
90 3300005617 Ga0068859_100000364 Ga0068859_10000036414 271
91 3300005618 Ga0068864_100014614 Ga0068864_1000146144 271
92 3300005719 Ga0068861_100009033 Ga0068861_1000090332 271
93 3300005834 Ga0068851_10149828 Ga0068851_101498282 271
94 3300005840 Ga0068870_10000100 Ga0068870_1000010019 271
95 3300005841 Ga0068863_100102272 Ga0068863_1001022722 271
96 3300005842 Ga0068858_100034863 Ga0068858_1000348633 271
97 3300005843 Ga0068860_100018800 Ga0068860_1000188003 271
98 3300005844 Ga0068862_100002730 Ga0068862_1000027307 271
99 3300005937 Ga0081455_10009207 Ga0081455_100092079 271
100 3300005981 Ga0081538_10039513 Ga0081538_100395132 271
101 3300006237 Ga0097621_100155130 Ga0097621_1001551302 271
102 3300006852 Ga0075433_10001270 Ga0075433_1000127011 271
103 3300006871 Ga0075434_100019777 Ga0075434_1000197773 271
104 3300006914 Ga0075436_100067428 Ga0075436_1000674282 271
105 3300006931 Ga0097620_100000364 Ga0097620_10000036426 271
106 3300007076 Ga0075435_100150457 Ga0075435_1001504572 271
107 3300009147 Ga0114129_10384829 Ga0114129_103848293 271
108 3300009174 Ga0105241_10004101 Ga0105241_100041013 271
109 3300009176 Ga0105242_10528692 Ga0105242_105286922 271
110 3300013100 Ga0157373_10000159 Ga0157373_1000015918 271
111 3300013102 Ga0157371_10143145 Ga0157371_101431452 271
112 3300013307 Ga0157372_10000113 Ga0157372_1000011343 271
113 3300014325 Ga0163163_10279979 Ga0163163_102799792 271
114 3300025901 Ga0207688_10033833 Ga0207688_100338332 271
115 3300025907 Ga0207645_10000434 Ga0207645_1000043417 271
116 3300025908 Ga0207643_10000059 Ga0207643_1000005925 271
117 3300025910 Ga0207684_10029113 Ga0207684_100291132 271
118 3300025911 Ga0207654_10001851 Ga0207654_100018513 271
119 3300025912 Ga0207707_10000207 Ga0207707_1000020737 271
120 3300025917 Ga0207660_10000425 Ga0207660_1000042517 271
121 3300025918 Ga0207662_10019757 Ga0207662_100197574 271
122 3300025919 Ga0207657_10000209 Ga0207657_1000020915 271
123 3300025920 Ga0207649_10004671 Ga0207649_100046714 271
124 3300025921 Ga0207652_10000105 Ga0207652_1000010512 271
125 3300025922 Ga0207646_10063532 Ga0207646_100635322 271
126 3300025923 Ga0207681_10074214 Ga0207681_100742142 271
127 3300025925 Ga0207650_10003138 Ga0207650_100031386 271
128 3300025926 Ga0207659_10107019 Ga0207659_101070192 271
129 3300025932 Ga0207690_10001697 Ga0207690_100016977 271
130 3300025933 Ga0207706_10007226 Ga0207706_100072262 271
131 3300025936 Ga0207670_10026410 Ga0207670_100264102 271
132 3300025939 Ga0207665_10007219 Ga0207665_100072193 271
133 3300025940 Ga0207691_10373976 Ga0207691_103739762 271
134 3300025942 Ga0207689_10001068 Ga0207689_1000106817 271
135 3300025944 Ga0207661_10135818 Ga0207661_101358182 271
136 3300025945 Ga0207679_10000209 Ga0207679_1000020927 271
137 3300025949 Ga0207667_10000372 Ga0207667_1000037219 271
138 3300026023 Ga0207677_10012832 Ga0207677_100128323 271
139 3300026035 Ga0207703_10080624 Ga0207703_100806242 271
140 3300026067 Ga0207678_10304435 Ga0207678_103044352 271
141 3300026078 Ga0207702_10001726 Ga0207702_100017262 271
142 3300026088 Ga0207641_10015338 Ga0207641_100153384 271
143 3300026089 Ga0207648_10000170 Ga0207648_1000017018 271
144 3300026095 Ga0207676_10019545 Ga0207676_100195454 271
145 3300026095 Ga0207676_10180957 Ga0207676_101809573 271
146 3300026116 Ga0207674_10000585 Ga0207674_100005857 271
147 3300026118 Ga0207675_100016445 Ga0207675_1000164452 271
148 3300028380 Ga0268265_10003127 Ga0268265_100031276 271
149 3300028381 Ga0268264_10005874 Ga0268264_100058745 271
150 3300034818 Ga0373950_0009438 Ga0373950_0009438_497_1327 271
151 3300035090 Ga0373949_0005337 Ga0373949_0005337_712_1542 271
152 3300035115 Ga0373941_0004548 Ga0373941_0004548_1449_2279 271
153 3300035121 Ga0373960_0003451 Ga0373960_0003451_499_1329 271
154 3300037068 Ga0373925_0152088 Ga0373925_0152088_737_1558 271
155 3300042005 Ga0439448_0000128 Ga0439448_0000128_9802_10632 271
156 3300042438 Ga0439459_0001765 Ga0439459_0001765_2370_3200 271
157 3300042876 Ga0451577_0052708 Ga0451577_0052708_2033_2863 271
158 3300048909 Ga0496106_0108534 Ga0496106_0108534_57_887 271
159 3300048913 Ga0496110_0310667 Ga0496110_0310667_362_1192 271
160 3300048915 Ga0496112_0056344 Ga0496112_0056344_1552_2382 271
161 3300049585 Ga0501069_0110377 Ga0501069_0110377_310_1140 271
162 3300050492 nmdc:mga0yw44_7662_c1 nmdc:mga0yw44_7662_c1_510_1325 271
163 3300050494 nmdc:mga06z11_49977_c1 nmdc:mga06z11_49977_c1_1223_2038 271
164 3300050507 nmdc:mga05p37_194093_c1 nmdc:mga05p37_194093_c1_878_1708 271
165 3300050512 nmdc:mga0n895_50402_c1 nmdc:mga0n895_50402_c1_1591_2421 271
166 3300050512 nmdc:mga0n895_7395_c1 nmdc:mga0n895_7395_c1_5776_6615 271
167 3300050514 nmdc:mga08x19_173620_c1 nmdc:mga08x19_173620_c1_370_1194 271
168 3300050514 nmdc:mga08x19_175001_c1 nmdc:mga08x19_175001_c1_505_1335 271
169 3300050515 nmdc:mga0a205_60724_c1 nmdc:mga0a205_60724_c1_1620_2450 271
170 3300050515 nmdc:mga0a205_8224_c1 nmdc:mga0a205_8224_c1_2938_3777 271
171 3300053153 Ga0500616_0001962 Ga0500616_0001962_11746_12567 271
172 3300053733 Ga0500552_000898 Ga0500552_000898_899_1714 271
173 3300005327 Ga0070658_10056770 Ga0070658_100567703 272
174 3300005330 Ga0070690_100007780 Ga0070690_1000077806 272
175 3300005334 Ga0068869_100000337 Ga0068869_1000003376 272
176 3300005336 Ga0070680_100000763 Ga0070680_10000076315 272
177 3300005336 Ga0070680_100006493 Ga0070680_1000064932 272
178 3300005336 Ga0070680_100057777 Ga0070680_1000577773 272
179 3300005338 Ga0068868_100000378 Ga0068868_10000037834 272
180 3300005340 Ga0070689_100011186 Ga0070689_1000111865 272
181 3300005341 Ga0070691_10000874 Ga0070691_100008746 272
182 3300005341 Ga0070691_10004072 Ga0070691_100040725 272
183 3300005343 Ga0070687_100023934 Ga0070687_1000239342 272
184 3300005345 Ga0070692_10001138 Ga0070692_100011386 272
185 3300005345 Ga0070692_10009393 Ga0070692_100093934 272
186 3300005354 Ga0070675_100036057 Ga0070675_1000360574 272
187 3300005355 Ga0070671_100027134 Ga0070671_1000271342 272
188 3300005356 Ga0070674_100554390 Ga0070674_1005543901 272
189 3300005406 Ga0070703_10027151 Ga0070703_100271512 272
190 3300005438 Ga0070701_10000027 Ga0070701_1000002739 272
191 3300005438 Ga0070701_10016989 Ga0070701_100169894 272
192 3300005441 Ga0070700_100003008 Ga0070700_1000030087 272
193 3300005441 Ga0070700_100031063 Ga0070700_1000310634 272
194 3300005444 Ga0070694_100000096 Ga0070694_10000009639 272
195 3300005445 Ga0070708_100079640 Ga0070708_1000796402 272
196 3300005456 Ga0070678_100087552 Ga0070678_1000875521 272
197 3300005456 Ga0070678_100250405 Ga0070678_1002504052 272
198 3300005458 Ga0070681_10068197 Ga0070681_100681972 272
199 3300005459 Ga0068867_100003298 Ga0068867_1000032987 272
200 3300005467 Ga0070706_100079858 Ga0070706_1000798582 272
201 3300005468 Ga0070707_100725167 Ga0070707_1007251671 272
202 3300005530 Ga0070679_100001012 Ga0070679_10000101222 272
203 3300005544 Ga0070686_100001404 Ga0070686_1000014043 272
204 3300005545 Ga0070695_100009431 Ga0070695_1000094313 272
205 3300005545 Ga0070695_100049441 Ga0070695_1000494412 272
206 3300005546 Ga0070696_100001291 Ga0070696_1000012915 272
207 3300005547 Ga0070693_100000003 Ga0070693_10000000334 272
208 3300005548 Ga0070665_100029828 Ga0070665_1000298284 272
209 3300005548 Ga0070665_100051986 Ga0070665_1000519864 272
210 3300005549 Ga0070704_100063040 Ga0070704_1000630402 272
211 3300005549 Ga0070704_100273515 Ga0070704_1002735152 272
212 3300005563 Ga0068855_100007058 Ga0068855_10000705816 272
213 3300005563 Ga0068855_100085343 Ga0068855_1000853433 272
214 3300005577 Ga0068857_100080526 Ga0068857_1000805262 272
215 3300005578 Ga0068854_100000304 Ga0068854_1000003046 272
216 3300005614 Ga0068856_100171512 Ga0068856_1001715123 272
217 3300005615 Ga0070702_100000004 Ga0070702_10000000430 272
218 3300005616 Ga0068852_100497331 Ga0068852_1004973312 272
219 3300005719 Ga0068861_100002640 Ga0068861_1000026403 272
220 3300005840 Ga0068870_10100549 Ga0068870_101005493 272
221 3300005843 Ga0068860_100001014 Ga0068860_1000010146 272
222 3300005844 Ga0068862_100015174 Ga0068862_1000151743 272
223 3300005844 Ga0068862_100185342 Ga0068862_1001853422 272
224 3300005844 Ga0068862_100303135 Ga0068862_1003031352 272
225 3300006173 Ga0070716_100427956 Ga0070716_1004279561 272
226 3300006175 Ga0070712_100058513 Ga0070712_1000585136 272
227 3300006195 Ga0075366_10005759 Ga0075366_100057597 272
228 3300006237 Ga0097621_100000574 Ga0097621_1000005744 272
229 3300006358 Ga0068871_100000688 Ga0068871_10000068815 272
230 3300006844 Ga0075428_100022540 Ga0075428_1000225403 272
231 3300006844 Ga0075428_100211575 Ga0075428_1002115752 272
232 3300006846 Ga0075430_100117186 Ga0075430_1001171862 272
233 3300006847 Ga0075431_100001284 Ga0075431_10000128418 272
234 3300006847 Ga0075431_100017605 Ga0075431_1000176054 272
235 3300006871 Ga0075434_100238390 Ga0075434_1002383902 272
236 3300006880 Ga0075429_100000496 Ga0075429_10000049634 272
237 3300006880 Ga0075429_100032848 Ga0075429_1000328486 272
238 3300006881 Ga0068865_100009905 Ga0068865_1000099056 272
239 3300007788 Ga0099795_10059403 Ga0099795_100594031 272
240 3300009093 Ga0105240_10061063 Ga0105240_100610634 272
241 3300009094 Ga0111539_10466527 Ga0111539_104665272 272
242 3300009098 Ga0105245_10002146 Ga0105245_1000214612 272
243 3300009098 Ga0105245_10234944 Ga0105245_102349443 272
244 3300009147 Ga0114129_10000149 Ga0114129_1000014911 272
245 3300009147 Ga0114129_10011670 Ga0114129_100116704 272
246 3300009148 Ga0105243_10000762 Ga0105243_1000076230 272
247 3300009148 Ga0105243_10004881 Ga0105243_100048812 272
248 3300009174 Ga0105241_10082555 Ga0105241_100825553 272
249 3300009176 Ga0105242_10000326 Ga0105242_1000032630 272
250 3300009176 Ga0105242_10069341 Ga0105242_100693414 272
251 3300009177 Ga0105248_10074969 Ga0105248_100749695 272
252 3300009545 Ga0105237_10368288 Ga0105237_103682882 272
253 3300009553 Ga0105249_10011495 Ga0105249_100114956 272
254 3300009553 Ga0105249_10437058 Ga0105249_104370582 272
255 3300010159 Ga0099796_10078025 Ga0099796_100780251 272
256 3300010375 Ga0105239_10069063 Ga0105239_100690632 272
257 3300010375 Ga0105239_10608109 Ga0105239_106081092 272
258 3300013297 Ga0157378_10000192 Ga0157378_1000019230 272
259 3300013308 Ga0157375_11074736 Ga0157375_110747361 272
260 3300014326 Ga0157380_10030793 Ga0157380_100307935 272
261 3300014969 Ga0157376_10001688 Ga0157376_1000168816 272
262 3300025899 Ga0207642_10003637 Ga0207642_100036373 272
263 3300025903 Ga0207680_10285925 Ga0207680_102859252 272
264 3300025908 Ga0207643_10114108 Ga0207643_101141082 272
265 3300025910 Ga0207684_10204900 Ga0207684_102049002 272
266 3300025911 Ga0207654_10005597 Ga0207654_100055976 272
267 3300025912 Ga0207707_10215906 Ga0207707_102159062 272
268 3300025913 Ga0207695_10026146 Ga0207695_100261464 272
269 3300025915 Ga0207693_10154071 Ga0207693_101540713 272
270 3300025916 Ga0207663_10244781 Ga0207663_102447811 272
271 3300025917 Ga0207660_10016601 Ga0207660_100166015 272
272 3300025917 Ga0207660_10020677 Ga0207660_100206775 272
273 3300025918 Ga0207662_10000101 Ga0207662_1000010130 272
274 3300025920 Ga0207649_10429827 Ga0207649_104298272 272
275 3300025921 Ga0207652_10021418 Ga0207652_100214185 272
276 3300025921 Ga0207652_10057589 Ga0207652_100575891 272
277 3300025922 Ga0207646_10612749 Ga0207646_106127492 272
278 3300025924 Ga0207694_10157074 Ga0207694_101570742 272
279 3300025926 Ga0207659_10077933 Ga0207659_100779332 272
280 3300025927 Ga0207687_10002779 Ga0207687_1000277910 272
281 3300025928 Ga0207700_10372101 Ga0207700_103721012 272
282 3300025931 Ga0207644_10032175 Ga0207644_100321752 272
283 3300025933 Ga0207706_10437267 Ga0207706_104372671 272
284 3300025934 Ga0207686_10002692 Ga0207686_100026923 272
285 3300025934 Ga0207686_10097338 Ga0207686_100973381 272
286 3300025935 Ga0207709_10001269 Ga0207709_1000126912 272
287 3300025935 Ga0207709_10155295 Ga0207709_101552953 272
288 3300025936 Ga0207670_10009854 Ga0207670_100098544 272
289 3300025936 Ga0207670_10149837 Ga0207670_101498373 272
290 3300025938 Ga0207704_10031775 Ga0207704_100317753 272
291 3300025941 Ga0207711_10065209 Ga0207711_100652094 272
292 3300025942 Ga0207689_10000103 Ga0207689_1000010344 272
293 3300025961 Ga0207712_10352473 Ga0207712_103524732 272
294 3300025981 Ga0207640_10002032 Ga0207640_100020327 272
295 3300026023 Ga0207677_10001533 Ga0207677_1000153313 272
296 3300026035 Ga0207703_10020230 Ga0207703_100202303 272
297 3300026075 Ga0207708_10000048 Ga0207708_1000004848 272
298 3300026075 Ga0207708_10014476 Ga0207708_100144765 272
299 3300026078 Ga0207702_10033331 Ga0207702_100333314 272
300 3300026078 Ga0207702_10082288 Ga0207702_100822882 272
301 3300026088 Ga0207641_10377304 Ga0207641_103773042 272
302 3300026089 Ga0207648_10000124 Ga0207648_1000012472 272
303 3300026095 Ga0207676_10019160 Ga0207676_100191605 272
304 3300026116 Ga0207674_10013493 Ga0207674_100134932 272
305 3300026116 Ga0207674_10362977 Ga0207674_103629772 272
306 3300026118 Ga0207675_100000593 Ga0207675_1000005937 272
307 3300026121 Ga0207683_10017124 Ga0207683_100171241 272
308 3300026121 Ga0207683_10284698 Ga0207683_102846982 272
309 3300026142 Ga0207698_10597794 Ga0207698_105977942 272
310 3300027907 Ga0207428_10002437 Ga0207428_1000243710 272
311 3300028379 Ga0268266_10020571 Ga0268266_100205714 272
312 3300028380 Ga0268265_10059983 Ga0268265_100599833 272
313 3300028380 Ga0268265_10332683 Ga0268265_103326832 272
314 3300028381 Ga0268264_10001425 Ga0268264_100014252 272
315 3300028381 Ga0268264_10239854 Ga0268264_102398542 272
316 3300031995 Ga0307409_100092064 Ga0307409_1000920642 272
317 3300034816 Ga0373930_0022827 Ga0373930_0022827_10_840 272
318 3300034817 Ga0373948_0025524 Ga0373948_0025524_258_1088 272
319 3300034820 Ga0373959_0041239 Ga0373959_0041239_80_910 272
320 3300034957 Ga0373938_0039412 Ga0373938_0039412_59_889 272
321 3300035083 Ga0373926_0007068 Ga0373926_0007068_1521_2351 272
322 3300035084 Ga0373928_0016344 Ga0373928_0016344_163_993 272
323 3300035086 Ga0373934_0000089 Ga0373934_0000089_16870_17703 272
324 3300035086 Ga0373934_0006076 Ga0373934_0006076_2422_3249 272
325 3300035089 Ga0373944_0002308 Ga0373944_0002308_2972_3802 272
326 3300035090 Ga0373949_0008834 Ga0373949_0008834_326_1156 272
327 3300035112 Ga0373932_0001851 Ga0373932_0001851_2030_2860 272
328 3300035112 Ga0373932_0020026 Ga0373932_0020026_170_988 272
329 3300035115 Ga0373941_0021383 Ga0373941_0021383_991_1809 272
330 3300035116 Ga0373945_0002297 Ga0373945_0002297_2310_3140 272
331 3300035121 Ga0373960_0075607 Ga0373960_0075607_166_984 272
332 3300035207 Ga0373942_0029599 Ga0373942_0029599_192_1022 272
333 3300035241 Ga0373961_0050407 Ga0373961_0050407_197_1015 272
334 3300035242 Ga0373962_0066356 Ga0373962_0066356_122_952 272
335 3300035691 Ga0373931_0000594 Ga0373931_0000594_655_1485 272
336 3300035691 Ga0373931_0024853 Ga0373931_0024853_1533_2363 272
337 3300035691 Ga0373931_0071680 Ga0373931_0071680_46_876 272
338 3300035691 Ga0373931_0072007 Ga0373931_0072007_401_1219 272
339 3300035691 Ga0373931_0235912 Ga0373931_0235912_233_1051 272
340 3300035695 Ga0373927_0334675 Ga0373927_0334675_42_860 272
341 3300036401 Ga0373937_0567582 Ga0373937_0567582_106_966 272
342 3300037068 Ga0373925_0178279 Ga0373925_0178279_206_1036 272
343 3300037312 Ga0395899_0004184 Ga0395899_0004184_741_1559 272
344 3300037312 Ga0395899_0100288 Ga0395899_0100288_256_1074 272
345 3300037418 Ga0395900_0045956 Ga0395900_0045956_3375_4193 272
346 3300037418 Ga0395900_0116844 Ga0395900_0116844_1528_2346 272
347 3300037466 Ga0395898_0014917 Ga0395898_0014917_5845_6663 272
348 3300037466 Ga0395898_0018563 Ga0395898_0018563_2658_3479 272
349 3300038443 Ga0395901_0004642 Ga0395901_0004642_1896_2717 272
350 3300038443 Ga0395901_0010633 Ga0395901_0010633_3511_4329 272
351 3300038443 Ga0395901_0013096 Ga0395901_0013096_1701_2522 272
352 3300038443 Ga0395901_0058965 Ga0395901_0058965_2784_3602 272
353 3300039437 Ga0436365_0326209 Ga0436365_0326209_67_885 272
354 3300039437 Ga0436365_1142450 Ga0436365_1142450_746_1606 272
355 3300039437 Ga0436365_1596392 Ga0436365_1596392_784_1689 272
356 3300042001 Ga0439441_029477 Ga0439441_029477_18_851 272
357 3300042461 Ga0439460_0027686 Ga0439460_0027686_332_1189 272
358 3300042876 Ga0451577_0046606 Ga0451577_0046606_333_1166 272
359 3300045051 Ga0451576_0016604 Ga0451576_0016604_5827_6657 272
360 3300045051 Ga0451576_0019565 Ga0451576_0019565_6114_6947 272
361 3300045051 Ga0451576_0024042 Ga0451576_0024042_5733_6563 272
362 3300045051 Ga0451576_0266430 Ga0451576_0266430_382_1221 272
363 3300046455 Ga0495603_0008408 Ga0495603_0008408_4337_5167 272
364 3300046472 Ga0495580_0012133 Ga0495580_0012133_2976_3806 272
365 3300046472 Ga0495580_0114451 Ga0495580_0114451_388_1215 272
366 3300046475 Ga0495639_0003282 Ga0495639_0003282_684_1514 272
367 3300046517 Ga0495630_0220149 Ga0495630_0220149_476_1306 272
368 3300046535 Ga0495586_0004072 Ga0495586_0004072_1673_2503 272
369 3300046681 Ga0495647_0001622 Ga0495647_0001622_868_1698 272
370 3300046683 Ga0495658_0003634 Ga0495658_0003634_4529_5359 272
371 3300046683 Ga0495658_0349597 Ga0495658_0349597_62_880 272
372 3300047321 Ga0495676_0110542 Ga0495676_0110542_904_1734 272
373 3300048913 Ga0496110_0263468 Ga0496110_0263468_205_1023 272
374 3300048915 Ga0496112_0074003 Ga0496112_0074003_1307_2125 272
375 3300048916 Ga0496113_0012541 Ga0496113_0012541_4098_4916 272
376 3300049570 Ga0501033_0048350 Ga0501033_0048350_1900_2754 272
377 3300049571 Ga0501034_0016300 Ga0501034_0016300_2398_3216 272
378 3300049571 Ga0501034_0170443 Ga0501034_0170443_641_1459 272
379 3300049575 Ga0501039_0277672 Ga0501039_0277672_35_862 272
380 3300049578 Ga0501042_0018652 Ga0501042_0018652_2634_3461 272
381 3300049580 Ga0501046_0317934 Ga0501046_0317934_107_943 272
382 3300049581 Ga0501047_0246588 Ga0501047_0246588_280_1098 272
383 3300049591 Ga0501075_0012336 Ga0501075_0012336_2294_3133 272
384 3300049741 Ga0501079_0153863 Ga0501079_0153863_139_996 272
385 3300049823 Ga0501044_0022520 Ga0501044_0022520_2232_3050 272
386 3300049824 Ga0501045_0123192 Ga0501045_0123192_596_1423 272
387 3300050493 nmdc:mga0k408_4564_c1 nmdc:mga0k408_4564_c1_5136_5954 272
388 3300050507 nmdc:mga05p37_3874_c1 nmdc:mga05p37_3874_c1_15567_16397 272
389 3300050507 nmdc:mga05p37_4197_c1 nmdc:mga05p37_4197_c1_10162_10989 272
390 3300050508 nmdc:mga09592_10845_c1 nmdc:mga09592_10845_c1_87_917 272
391 3300050508 nmdc:mga09592_28735_c1 nmdc:mga09592_28735_c1_302_1129 272
392 3300050509 nmdc:mga0qj67_243577_c1 nmdc:mga0qj67_243577_c1_342_1175 272
393 3300050510 nmdc:mga06r32_3531_c1 nmdc:mga06r32_3531_c1_6045_6872 272
394 3300050511 nmdc:mga08y16_790_c1 nmdc:mga08y16_790_c1_20789_21619 272
395 3300050512 nmdc:mga0n895_355702_c1 nmdc:mga0n895_355702_c1_570_1388 272
396 3300050512 nmdc:mga0n895_461969_c1 nmdc:mga0n895_461969_c1_326_1144 272
397 3300050514 nmdc:mga08x19_18991_c1 nmdc:mga08x19_18991_c1_665_1483 272
398 3300054114 Ga0501084_0013356 Ga0501084_0013356_2523_3362 272
399 3300060353 Ga0501082_0035024 Ga0501082_0035024_890_1717 272
400 3300061734 Ga0530510_0423378 Ga0530510_0423378_90_965 272

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13714

PEP_mutase

Phosphoenolpyruvate phosphomutase

45

284

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lsb-assembly1.cif.gz_A crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9601 4 272
4lsb-assembly1.cif.gz_B crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9598 4 272
4lsb-assembly1.cif.gz_A crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.9463 4 272
4lsb-assembly1.cif.gz_B crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 0.946 4 272
2ze3-assembly1.cif.gz_A-2 crystal structure of dfa0005 complexed with alpha-ketoglutarate: a novel member of the icl/pepm superfamily from alkali-tolerant deinococcus ficus 0.9041 4 259
ID Description Score Start End Superfamily
4lsbB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9654 4 230 3.20.20.60
4lsbB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9489 4 230 3.20.20.60
2ze3A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8989 4 230 3.20.20.60
af_P9WLN9_1_257_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8937 10 271 3.20.20.60
4mg4B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8857 2 253 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A537A4V5-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9897 1 200 GO:0016829
AF-A0A7Y7J3D7-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9806 1 272 GO:0016829
AF-A0A7Y7Y737-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9799 99 204 GO:0016829
AF-A0A1R3UR83-F1-model_v4 Probable carboxyvinyl-carboxyphosphonate phosphorylmutase (EC 2.7.8.23) 0.9794 4 270 GO:0008807
AF-A0A2A5B6A7-F1-model_v4 2-methylisocitrate lyase 0.979 1 270 GO:0016829

Feature Viewer

pLDDT pTM Quality
94.64 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map