F434697
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 400 | 252 | 400 | 275 |
Family's Representative Sequence
| Representative Sequence | 3300049591|Ga0501075_0267765|Ga0501075_0267765_284_1216 |
| Length | 310 |
| Sequence | MRGLPDLLRARLAANGGRSYRQSDLIPLREGAMAAGSQSERAQAFRALHEQPGAFVIPNPWDVGTARILAGLGFEALATTSAGMAFALGRRDGAVGREEALAHARAIVAATPLPVSADLENGFGDAPETVAETIRLAASTGLVGASIEDASGDPDHPIYDRALAVERVAAAVEAAGSLPFPFTLTARAENFLHGRPDLDDTLSRLQAFEAAGADVLYAPGLRDLDSIRAVCEALAKPVNVIMAIAGTAFAVAELAAVGVRRTSLGSALSRVALGAFLRAAREIAERGTFTCAEEAAGFADLEPFLQGRAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 78 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 90 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 159 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 160 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 161 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 162 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 163 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 164 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 165 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 166 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 167 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 168 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 169 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 171 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 176 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 179 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 182 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 183 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 184 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 187 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 188 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 189 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 190 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 191 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 192 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 193 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 194 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 195 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 196 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 197 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 198 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 199 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 200 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 219 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 220 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 221 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 222 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 237 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 238 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 239 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 249 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 250 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.5 |
| Nodule | 0 |
| Rhizoplane | 1.5 |
| Rhizosphere | 94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10056770 | 3300005327 | Bacteria | 3183 |
| 2 | Ga0070676_10000495 | 3300005328 | Bacteria | 18737 |
| 3 | Ga0070690_100007780 | 3300005330 | Bacteria | 6143 |
| 4 | Ga0070670_100013981 | 3300005331 | Bacteria | 6882 |
| 5 | Ga0068869_100000166 | 3300005334 | Bacteria | 32985 |
| 6 | Ga0068869_100000337 | 3300005334 | Bacteria | 25056 |
| 7 | Ga0070680_100000311 | 3300005336 | Bacteria | 32479 |
| 8 | Ga0070680_100000763 | 3300005336 | Bacteria | 22539 |
| 9 | Ga0070680_100006493 | 3300005336 | Bacteria | 8897 |
| 10 | Ga0070680_100057777 | 3300005336 | Bacteria | 3172 |
| 11 | Ga0070682_100000904 | 3300005337 | Bacteria | 17336 |
| 12 | Ga0068868_100000378 | 3300005338 | Bacteria | 30380 |
| 13 | Ga0068868_100002587 | 3300005338 | Bacteria | 12546 |
| 14 | Ga0070660_100002232 | 3300005339 | Bacteria | 13349 |
| 15 | Ga0070689_100011186 | 3300005340 | Bacteria | 6421 |
| 16 | Ga0070689_100018172 | 3300005340 | Bacteria | 5176 |
| 17 | Ga0070691_10000874 | 3300005341 | Bacteria | 12209 |
| 18 | Ga0070691_10004072 | 3300005341 | Bacteria | 6627 |
| 19 | Ga0070691_10010969 | 3300005341 | Bacteria | 4139 |
| 20 | Ga0070687_100023934 | 3300005343 | Bacteria | 2908 |
| 21 | Ga0070687_100067337 | 3300005343 | Bacteria | 1911 |
| 22 | Ga0070661_100000690 | 3300005344 | Bacteria | 24823 |
| 23 | Ga0070692_10001138 | 3300005345 | Bacteria | 9329 |
| 24 | Ga0070692_10001181 | 3300005345 | Bacteria | 9229 |
| 25 | Ga0070692_10009393 | 3300005345 | Bacteria | 4409 |
| 26 | Ga0070669_100113142 | 3300005353 | Bacteria | 2062 |
| 27 | Ga0070675_100036057 | 3300005354 | Bacteria | 4023 |
| 28 | Ga0070671_100027134 | 3300005355 | Bacteria | 4711 |
| 29 | Ga0070674_100554390 | 3300005356 | Bacteria | 965 |
| 30 | Ga0070659_100003885 | 3300005366 | Bacteria | 10645 |
| 31 | Ga0070667_100484848 | 3300005367 | Bacteria | 1132 |
| 32 | Ga0070703_10027151 | 3300005406 | Bacteria | 1705 |
| 33 | Ga0070701_10000027 | 3300005438 | Bacteria | 38022 |
| 34 | Ga0070701_10016989 | 3300005438 | Bacteria | 3394 |
| 35 | Ga0070705_100000167 | 3300005440 | Bacteria | 38185 |
| 36 | Ga0070705_100010535 | 3300005440 | Bacteria | 4632 |
| 37 | Ga0070705_100064543 | 3300005440 | Unclassified | 2188 |
| 38 | Ga0070700_100003008 | 3300005441 | Bacteria | 8643 |
| 39 | Ga0070700_100031063 | 3300005441 | Bacteria | 3197 |
| 40 | Ga0070694_100000096 | 3300005444 | Bacteria | 42431 |
| 41 | Ga0070694_100000860 | 3300005444 | Bacteria | 17103 |
| 42 | Ga0070708_100079640 | 3300005445 | Bacteria | 2964 |
| 43 | Ga0070663_100283738 | 3300005455 | Bacteria | 1320 |
| 44 | Ga0070678_100087552 | 3300005456 | Bacteria | 2379 |
| 45 | Ga0070678_100250405 | 3300005456 | Bacteria | 1485 |
| 46 | Ga0070662_100014293 | 3300005457 | Bacteria | 5301 |
| 47 | Ga0070681_10001265 | 3300005458 | Bacteria | 22037 |
| 48 | Ga0070681_10068197 | 3300005458 | Bacteria | 3524 |
| 49 | Ga0068867_100000786 | 3300005459 | Bacteria | 21472 |
| 50 | Ga0068867_100003298 | 3300005459 | Bacteria | 11365 |
| 51 | Ga0070706_100079858 | 3300005467 | Bacteria | 3028 |
| 52 | Ga0070706_100122487 | 3300005467 | Bacteria | 2424 |
| 53 | Ga0070707_100139795 | 3300005468 | Bacteria | 2356 |
| 54 | Ga0070707_100725167 | 3300005468 | Bacteria | 957 |
| 55 | Ga0070698_100005830 | 3300005471 | Bacteria | 13472 |
| 56 | Ga0070699_100008193 | 3300005518 | Bacteria | 9067 |
| 57 | Ga0070699_100131664 | 3300005518 | Bacteria | 2205 |
| 58 | Ga0070679_100001012 | 3300005530 | Bacteria | 24481 |
| 59 | Ga0070679_100013386 | 3300005530 | Bacteria | 7855 |
| 60 | Ga0070684_100017044 | 3300005535 | Bacteria | 5954 |
| 61 | Ga0070697_100170786 | 3300005536 | Bacteria | 1840 |
| 62 | Ga0068853_100001067 | 3300005539 | Bacteria | 19362 |
| 63 | Ga0070686_100001404 | 3300005544 | Bacteria | 13583 |
| 64 | Ga0070695_100009431 | 3300005545 | Bacteria | 5811 |
| 65 | Ga0070695_100014893 | 3300005545 | Bacteria | 4691 |
| 66 | Ga0070695_100049441 | 3300005545 | Bacteria | 2692 |
| 67 | Ga0070696_100000655 | 3300005546 | Bacteria | 22149 |
| 68 | Ga0070696_100001291 | 3300005546 | Bacteria | 16329 |
| 69 | Ga0070693_100000003 | 3300005547 | Bacteria | 95793 |
| 70 | Ga0070693_100000132 | 3300005547 | Bacteria | 33578 |
| 71 | Ga0070665_100029828 | 3300005548 | Bacteria | 5489 |
| 72 | Ga0070665_100051986 | 3300005548 | Bacteria | 4110 |
| 73 | Ga0070704_100000056 | 3300005549 | Bacteria | 36580 |
| 74 | Ga0070704_100063040 | 3300005549 | Bacteria | 2659 |
| 75 | Ga0070704_100273515 | 3300005549 | Bacteria | 1396 |
| 76 | Ga0068855_100000113 | 3300005563 | Bacteria | 100669 |
| 77 | Ga0068855_100007058 | 3300005563 | Bacteria | 13625 |
| 78 | Ga0068855_100085343 | 3300005563 | Bacteria | 3653 |
| 79 | Ga0068857_100023128 | 3300005577 | Bacteria | 5467 |
| 80 | Ga0068857_100080526 | 3300005577 | Bacteria | 2908 |
| 81 | Ga0068854_100000304 | 3300005578 | Bacteria | 32367 |
| 82 | Ga0068854_100001375 | 3300005578 | Bacteria | 14642 |
| 83 | Ga0068856_100002272 | 3300005614 | Bacteria | 19821 |
| 84 | Ga0068856_100171512 | 3300005614 | Bacteria | 2182 |
| 85 | Ga0070702_100000004 | 3300005615 | Bacteria | 70302 |
| 86 | Ga0070702_100002026 | 3300005615 | Bacteria | 8556 |
| 87 | Ga0068852_100122329 | 3300005616 | Bacteria | 2385 |
| 88 | Ga0068852_100497331 | 3300005616 | Bacteria | 1214 |
| 89 | Ga0068859_100000364 | 3300005617 | Bacteria | 45031 |
| 90 | Ga0068864_100014614 | 3300005618 | Bacteria | 6520 |
| 91 | Ga0068861_100002640 | 3300005719 | Bacteria | 11727 |
| 92 | Ga0068861_100009033 | 3300005719 | Bacteria | 6871 |
| 93 | Ga0068851_10149828 | 3300005834 | Bacteria | 1274 |
| 94 | Ga0068870_10000100 | 3300005840 | Bacteria | 28708 |
| 95 | Ga0068870_10100549 | 3300005840 | Bacteria | 1633 |
| 96 | Ga0068863_100102272 | 3300005841 | Bacteria | 2724 |
| 97 | Ga0068858_100034863 | 3300005842 | Bacteria | 4668 |
| 98 | Ga0068860_100001014 | 3300005843 | Bacteria | 31089 |
| 99 | Ga0068860_100018800 | 3300005843 | Bacteria | 6713 |
| 100 | Ga0068862_100002730 | 3300005844 | Bacteria | 15498 |
| 101 | Ga0068862_100015174 | 3300005844 | Bacteria | 6397 |
| 102 | Ga0068862_100185342 | 3300005844 | Bacteria | 1870 |
| 103 | Ga0068862_100303135 | 3300005844 | Bacteria | 1470 |
| 104 | Ga0081455_10009207 | 3300005937 | Bacteria | 10175 |
| 105 | Ga0081538_10039513 | 3300005981 | Bacteria | 3025 |
| 106 | Ga0070716_100427956 | 3300006173 | Bacteria | 959 |
| 107 | Ga0070712_100058513 | 3300006175 | Bacteria | 2711 |
| 108 | Ga0075366_10005759 | 3300006195 | Bacteria | 6728 |
| 109 | Ga0097621_100000574 | 3300006237 | Bacteria | 25858 |
| 110 | Ga0097621_100155130 | 3300006237 | Bacteria | 1965 |
| 111 | Ga0068871_100000688 | 3300006358 | Bacteria | 23017 |
| 112 | Ga0075428_100022540 | 3300006844 | Bacteria | 6972 |
| 113 | Ga0075428_100211575 | 3300006844 | Bacteria | 2095 |
| 114 | Ga0075430_100117186 | 3300006846 | Bacteria | 2220 |
| 115 | Ga0075431_100001284 | 3300006847 | Bacteria | 22920 |
| 116 | Ga0075431_100017605 | 3300006847 | Bacteria | 7263 |
| 117 | Ga0075433_10001270 | 3300006852 | Bacteria | 18429 |
| 118 | Ga0075434_100019777 | 3300006871 | Bacteria | 6519 |
| 119 | Ga0075434_100238390 | 3300006871 | Bacteria | 1839 |
| 120 | Ga0075429_100000496 | 3300006880 | Bacteria | 29568 |
| 121 | Ga0075429_100032848 | 3300006880 | Bacteria | 4510 |
| 122 | Ga0068865_100009905 | 3300006881 | Bacteria | 5922 |
| 123 | Ga0075436_100067428 | 3300006914 | Bacteria | 2473 |
| 124 | Ga0097620_100000364 | 3300006931 | Bacteria | 45031 |
| 125 | Ga0075435_100150457 | 3300007076 | Bacteria | 1956 |
| 126 | Ga0099795_10017844 | 3300007788 | Bacteria | 2270 |
| 127 | Ga0099795_10059403 | 3300007788 | Bacteria | 1414 |
| 128 | Ga0105240_10061063 | 3300009093 | Bacteria | 4697 |
| 129 | Ga0111539_10466527 | 3300009094 | Bacteria | 1470 |
| 130 | Ga0105245_10002146 | 3300009098 | Bacteria | 17867 |
| 131 | Ga0105245_10234944 | 3300009098 | Bacteria | 1775 |
| 132 | Ga0114129_10000149 | 3300009147 | Bacteria | 73883 |
| 133 | Ga0114129_10011670 | 3300009147 | Bacteria | 12504 |
| 134 | Ga0114129_10384829 | 3300009147 | Bacteria | 1852 |
| 135 | Ga0114129_11213668 | 3300009147 | Bacteria | 939 |
| 136 | Ga0105243_10000762 | 3300009148 | Bacteria | 30880 |
| 137 | Ga0105243_10004881 | 3300009148 | Bacteria | 10523 |
| 138 | Ga0105241_10004101 | 3300009174 | Bacteria | 10759 |
| 139 | Ga0105241_10082555 | 3300009174 | Bacteria | 2519 |
| 140 | Ga0105242_10000326 | 3300009176 | Bacteria | 38185 |
| 141 | Ga0105242_10069341 | 3300009176 | Bacteria | 2920 |
| 142 | Ga0105242_10528692 | 3300009176 | Bacteria | 1127 |
| 143 | Ga0105248_10074969 | 3300009177 | Bacteria | 3803 |
| 144 | Ga0105237_10368288 | 3300009545 | Bacteria | 1442 |
| 145 | Ga0105249_10011495 | 3300009553 | Bacteria | 7776 |
| 146 | Ga0105249_10437058 | 3300009553 | Bacteria | 1345 |
| 147 | Ga0105028_101819 | 3300009993 | Bacteria | 2237 |
| 148 | Ga0099796_10078025 | 3300010159 | Bacteria | 1209 |
| 149 | Ga0099796_10081661 | 3300010159 | Bacteria | 1186 |
| 150 | Ga0105239_10069063 | 3300010375 | Bacteria | 3882 |
| 151 | Ga0105239_10608109 | 3300010375 | Bacteria | 1247 |
| 152 | Ga0157373_10000159 | 3300013100 | Bacteria | 54799 |
| 153 | Ga0157371_10143145 | 3300013102 | Bacteria | 1703 |
| 154 | Ga0157378_10000192 | 3300013297 | Bacteria | 59014 |
| 155 | Ga0157372_10000113 | 3300013307 | Bacteria | 85757 |
| 156 | Ga0157375_11074736 | 3300013308 | Bacteria | 941 |
| 157 | Ga0163163_10279979 | 3300014325 | Bacteria | 1719 |
| 158 | Ga0157380_10030793 | 3300014326 | Bacteria | 4112 |
| 159 | Ga0157376_10001688 | 3300014969 | Bacteria | 14679 |
| 160 | Ga0209050_1005883 | 3300025298 | Bacteria | 7496 |
| 161 | Ga0209051_1040503 | 3300025303 | Bacteria | 1669 |
| 162 | Ga0209257_1001100 | 3300025304 | Bacteria | 35215 |
| 163 | Ga0209257_1047365 | 3300025304 | Bacteria | 1237 |
| 164 | Ga0207642_10003637 | 3300025899 | Bacteria | 4892 |
| 165 | Ga0207688_10033833 | 3300025901 | Bacteria | 2828 |
| 166 | Ga0207680_10285925 | 3300025903 | Bacteria | 1147 |
| 167 | Ga0207645_10000434 | 3300025907 | Bacteria | 34660 |
| 168 | Ga0207643_10000059 | 3300025908 | Bacteria | 73469 |
| 169 | Ga0207643_10114108 | 3300025908 | Bacteria | 1594 |
| 170 | Ga0207684_10029113 | 3300025910 | Bacteria | 4704 |
| 171 | Ga0207684_10204900 | 3300025910 | Bacteria | 1702 |
| 172 | Ga0207654_10001851 | 3300025911 | Bacteria | 10947 |
| 173 | Ga0207654_10005597 | 3300025911 | Bacteria | 6355 |
| 174 | Ga0207707_10000207 | 3300025912 | Bacteria | 62455 |
| 175 | Ga0207707_10215906 | 3300025912 | Bacteria | 1670 |
| 176 | Ga0207695_10026146 | 3300025913 | Bacteria | 6517 |
| 177 | Ga0207693_10154071 | 3300025915 | Bacteria | 1808 |
| 178 | Ga0207663_10244781 | 3300025916 | Bacteria | 1317 |
| 179 | Ga0207660_10000425 | 3300025917 | Bacteria | 27778 |
| 180 | Ga0207660_10016601 | 3300025917 | Bacteria | 4877 |
| 181 | Ga0207660_10020677 | 3300025917 | Bacteria | 4421 |
| 182 | Ga0207662_10000101 | 3300025918 | Bacteria | 40813 |
| 183 | Ga0207662_10019757 | 3300025918 | Bacteria | 3838 |
| 184 | Ga0207657_10000209 | 3300025919 | Bacteria | 60459 |
| 185 | Ga0207649_10004671 | 3300025920 | Bacteria | 7408 |
| 186 | Ga0207649_10429827 | 3300025920 | Bacteria | 993 |
| 187 | Ga0207652_10000105 | 3300025921 | Bacteria | 91044 |
| 188 | Ga0207652_10021418 | 3300025921 | Bacteria | 5335 |
| 189 | Ga0207652_10057589 | 3300025921 | Bacteria | 3347 |
| 190 | Ga0207646_10063532 | 3300025922 | Bacteria | 3296 |
| 191 | Ga0207646_10612749 | 3300025922 | Bacteria | 977 |
| 192 | Ga0207681_10074214 | 3300025923 | Bacteria | 2382 |
| 193 | Ga0207694_10157074 | 3300025924 | Bacteria | 1835 |
| 194 | Ga0207650_10003138 | 3300025925 | Bacteria | 11388 |
| 195 | Ga0207659_10077933 | 3300025926 | Bacteria | 2441 |
| 196 | Ga0207659_10107019 | 3300025926 | Bacteria | 2118 |
| 197 | Ga0207687_10002779 | 3300025927 | Bacteria | 11874 |
| 198 | Ga0207700_10372101 | 3300025928 | Bacteria | 1248 |
| 199 | Ga0207644_10032175 | 3300025931 | Bacteria | 3657 |
| 200 | Ga0207690_10001697 | 3300025932 | Bacteria | 13575 |
| 201 | Ga0207706_10007226 | 3300025933 | Bacteria | 10269 |
| 202 | Ga0207706_10437267 | 3300025933 | Bacteria | 1133 |
| 203 | Ga0207686_10002692 | 3300025934 | Bacteria | 9643 |
| 204 | Ga0207686_10097338 | 3300025934 | Bacteria | 1957 |
| 205 | Ga0207709_10001269 | 3300025935 | Bacteria | 18055 |
| 206 | Ga0207709_10155295 | 3300025935 | Bacteria | 1590 |
| 207 | Ga0207670_10009854 | 3300025936 | Bacteria | 5471 |
| 208 | Ga0207670_10026410 | 3300025936 | Bacteria | 3658 |
| 209 | Ga0207670_10149837 | 3300025936 | Bacteria | 1730 |
| 210 | Ga0207704_10031775 | 3300025938 | Bacteria | 2979 |
| 211 | Ga0207665_10007219 | 3300025939 | Bacteria | 7352 |
| 212 | Ga0207691_10373976 | 3300025940 | Bacteria | 1217 |
| 213 | Ga0207711_10065209 | 3300025941 | Bacteria | 3148 |
| 214 | Ga0207689_10000103 | 3300025942 | Bacteria | 69244 |
| 215 | Ga0207689_10001068 | 3300025942 | Bacteria | 26392 |
| 216 | Ga0207661_10135818 | 3300025944 | Bacteria | 2112 |
| 217 | Ga0207679_10000209 | 3300025945 | Bacteria | 46566 |
| 218 | Ga0207667_10000372 | 3300025949 | Bacteria | 60711 |
| 219 | Ga0207712_10352473 | 3300025961 | Bacteria | 1224 |
| 220 | Ga0207640_10002032 | 3300025981 | Bacteria | 10935 |
| 221 | Ga0207677_10001533 | 3300026023 | Bacteria | 12230 |
| 222 | Ga0207677_10012832 | 3300026023 | Bacteria | 4835 |
| 223 | Ga0207703_10020230 | 3300026035 | Bacteria | 5204 |
| 224 | Ga0207703_10080624 | 3300026035 | Bacteria | 2711 |
| 225 | Ga0207678_10304435 | 3300026067 | Bacteria | 1370 |
| 226 | Ga0207708_10000048 | 3300026075 | Bacteria | 114754 |
| 227 | Ga0207708_10014476 | 3300026075 | Bacteria | 5903 |
| 228 | Ga0207702_10001726 | 3300026078 | Bacteria | 21510 |
| 229 | Ga0207702_10033331 | 3300026078 | Bacteria | 4302 |
| 230 | Ga0207702_10082288 | 3300026078 | Bacteria | 2799 |
| 231 | Ga0207641_10015338 | 3300026088 | Bacteria | 6279 |
| 232 | Ga0207641_10377304 | 3300026088 | Bacteria | 1357 |
| 233 | Ga0207648_10000124 | 3300026089 | Bacteria | 75549 |
| 234 | Ga0207648_10000170 | 3300026089 | Bacteria | 67608 |
| 235 | Ga0207676_10019160 | 3300026095 | Bacteria | 4987 |
| 236 | Ga0207676_10019545 | 3300026095 | Bacteria | 4944 |
| 237 | Ga0207676_10180957 | 3300026095 | Bacteria | 1846 |
| 238 | Ga0207674_10000585 | 3300026116 | Bacteria | 47921 |
| 239 | Ga0207674_10013493 | 3300026116 | Bacteria | 9062 |
| 240 | Ga0207674_10362977 | 3300026116 | Bacteria | 1400 |
| 241 | Ga0207675_100000593 | 3300026118 | Bacteria | 35437 |
| 242 | Ga0207675_100016445 | 3300026118 | Bacteria | 6909 |
| 243 | Ga0207683_10017124 | 3300026121 | Bacteria | 6169 |
| 244 | Ga0207683_10284698 | 3300026121 | Bacteria | 1511 |
| 245 | Ga0207698_10597794 | 3300026142 | Bacteria | 1087 |
| 246 | Ga0207428_10002437 | 3300027907 | Bacteria | 18586 |
| 247 | Ga0268266_10020571 | 3300028379 | Bacteria | 5623 |
| 248 | Ga0268265_10003127 | 3300028380 | Bacteria | 12063 |
| 249 | Ga0268265_10059983 | 3300028380 | Bacteria | 2913 |
| 250 | Ga0268265_10332683 | 3300028380 | Unclassified | 1380 |
| 251 | Ga0268264_10001425 | 3300028381 | Bacteria | 22366 |
| 252 | Ga0268264_10005874 | 3300028381 | Bacteria | 10389 |
| 253 | Ga0268264_10239854 | 3300028381 | Bacteria | 1679 |
| 254 | Ga0307409_100092064 | 3300031995 | Bacteria | 2487 |
| 255 | Ga0373930_0022827 | 3300034816 | Bacteria | 1240 |
| 256 | Ga0373948_0025524 | 3300034817 | Bacteria | 1159 |
| 257 | Ga0373950_0009438 | 3300034818 | Bacteria | 1559 |
| 258 | Ga0373959_0041239 | 3300034820 | Bacteria | 969 |
| 259 | Ga0373938_0039412 | 3300034957 | Bacteria | 1044 |
| 260 | Ga0373926_0007068 | 3300035083 | Bacteria | 3735 |
| 261 | Ga0373928_0016344 | 3300035084 | Bacteria | 1518 |
| 262 | Ga0373934_0000089 | 3300035086 | Bacteria | 31589 |
| 263 | Ga0373934_0006076 | 3300035086 | Bacteria | 4470 |
| 264 | Ga0373944_0002308 | 3300035089 | Bacteria | 4857 |
| 265 | Ga0373949_0005337 | 3300035090 | Bacteria | 2870 |
| 266 | Ga0373949_0008834 | 3300035090 | Bacteria | 2204 |
| 267 | Ga0373932_0001851 | 3300035112 | Bacteria | 5670 |
| 268 | Ga0373932_0020026 | 3300035112 | Bacteria | 1750 |
| 269 | Ga0373941_0004548 | 3300035115 | Bacteria | 3213 |
| 270 | Ga0373941_0021383 | 3300035115 | Bacteria | 1825 |
| 271 | Ga0373945_0002297 | 3300035116 | Bacteria | 5982 |
| 272 | Ga0373954_0000626 | 3300035118 | Bacteria | 13489 |
| 273 | Ga0373954_0018568 | 3300035118 | Bacteria | 3132 |
| 274 | Ga0373956_0167986 | 3300035119 | Bacteria | 1035 |
| 275 | Ga0373960_0003451 | 3300035121 | Bacteria | 3582 |
| 276 | Ga0373960_0075607 | 3300035121 | Bacteria | 1050 |
| 277 | Ga0373943_0092584 | 3300035170 | Bacteria | 1568 |
| 278 | Ga0373942_0029599 | 3300035207 | Bacteria | 1438 |
| 279 | Ga0373961_0050407 | 3300035241 | Bacteria | 1233 |
| 280 | Ga0373962_0066356 | 3300035242 | Bacteria | 1070 |
| 281 | Ga0373931_0000594 | 3300035691 | Bacteria | 14942 |
| 282 | Ga0373931_0024853 | 3300035691 | Bacteria | 3039 |
| 283 | Ga0373931_0071680 | 3300035691 | Bacteria | 1893 |
| 284 | Ga0373931_0072007 | 3300035691 | Bacteria | 1889 |
| 285 | Ga0373931_0235912 | 3300035691 | Bacteria | 1107 |
| 286 | Ga0373935_0483543 | 3300035692 | Bacteria | 897 |
| 287 | Ga0373927_0334675 | 3300035695 | Bacteria | 997 |
| 288 | Ga0373933_0005232 | 3300035724 | Bacteria | 7079 |
| 289 | Ga0373947_0371377 | 3300035725 | Bacteria | 962 |
| 290 | Ga0373937_0042900 | 3300036401 | Bacteria | 4128 |
| 291 | Ga0373937_0109627 | 3300036401 | Bacteria | 2567 |
| 292 | Ga0373937_0567582 | 3300036401 | Bacteria | 1078 |
| 293 | Ga0373925_0148933 | 3300037068 | Bacteria | 1836 |
| 294 | Ga0373925_0152088 | 3300037068 | Bacteria | 1818 |
| 295 | Ga0373925_0178279 | 3300037068 | Bacteria | 1680 |
| 296 | Ga0395899_0004184 | 3300037312 | Bacteria | 11332 |
| 297 | Ga0395899_0100288 | 3300037312 | Bacteria | 2091 |
| 298 | Ga0395900_0045956 | 3300037418 | Bacteria | 4497 |
| 299 | Ga0395900_0116844 | 3300037418 | Bacteria | 2737 |
| 300 | Ga0395898_0014917 | 3300037466 | Bacteria | 7978 |
| 301 | Ga0395898_0018563 | 3300037466 | Bacteria | 7090 |
| 302 | Ga0395901_0004642 | 3300038443 | Bacteria | 13858 |
| 303 | Ga0395901_0010633 | 3300038443 | Bacteria | 9325 |
| 304 | Ga0395901_0013096 | 3300038443 | Bacteria | 8417 |
| 305 | Ga0395901_0058965 | 3300038443 | Bacteria | 3993 |
| 306 | Ga0400483_076041 | 3300039062 | Bacteria | 20398 |
| 307 | Ga0400483_099545 | 3300039062 | Bacteria | 4785 |
| 308 | Ga0400483_199249 | 3300039062 | Bacteria | 1443 |
| 309 | Ga0400483_222778 | 3300039062 | Bacteria | 11316 |
| 310 | Ga0400483_240732 | 3300039062 | Bacteria | 1371 |
| 311 | Ga0436365_0326209 | 3300039437 | Bacteria | 2106 |
| 312 | Ga0436365_1142450 | 3300039437 | Bacteria | 1773 |
| 313 | Ga0436365_1596392 | 3300039437 | Bacteria | 3115 |
| 314 | Ga0436362_1176906 | 3300039453 | Unclassified | 1478 |
| 315 | Ga0439465_0004548 | 3300041413 | Bacteria | 4483 |
| 316 | Ga0439441_029477 | 3300042001 | Bacteria | 1057 |
| 317 | Ga0439448_0000128 | 3300042005 | Bacteria | 14238 |
| 318 | Ga0439459_0001765 | 3300042438 | Bacteria | 3237 |
| 319 | Ga0439460_0027686 | 3300042461 | Bacteria | 1594 |
| 320 | Ga0451577_0046606 | 3300042876 | Bacteria | 3878 |
| 321 | Ga0451577_0052708 | 3300042876 | Bacteria | 3632 |
| 322 | Ga0451576_0016604 | 3300045051 | Bacteria | 8120 |
| 323 | Ga0451576_0019565 | 3300045051 | Bacteria | 7388 |
| 324 | Ga0451576_0024042 | 3300045051 | Bacteria | 6585 |
| 325 | Ga0451576_0266430 | 3300045051 | Bacteria | 1791 |
| 326 | Ga0495592_0118979 | 3300046454 | Bacteria | 1860 |
| 327 | Ga0495592_0388799 | 3300046454 | Bacteria | 886 |
| 328 | Ga0495603_0008408 | 3300046455 | Bacteria | 6233 |
| 329 | Ga0495651_0174678 | 3300046462 | Bacteria | 1526 |
| 330 | Ga0495580_0012133 | 3300046472 | Bacteria | 6626 |
| 331 | Ga0495580_0114451 | 3300046472 | Bacteria | 1873 |
| 332 | Ga0495639_0003282 | 3300046475 | Bacteria | 7023 |
| 333 | Ga0495608_0019087 | 3300046511 | Bacteria | 4726 |
| 334 | Ga0495628_0004597 | 3300046516 | Bacteria | 12201 |
| 335 | Ga0495630_0126182 | 3300046517 | Bacteria | 1942 |
| 336 | Ga0495630_0220149 | 3300046517 | Bacteria | 1449 |
| 337 | Ga0495666_0014350 | 3300046526 | Bacteria | 3945 |
| 338 | Ga0495666_0043000 | 3300046526 | Bacteria | 2183 |
| 339 | Ga0495586_0004072 | 3300046535 | Bacteria | 7832 |
| 340 | Ga0495645_0070989 | 3300046543 | Bacteria | 2512 |
| 341 | Ga0495667_0173378 | 3300046559 | Bacteria | 1385 |
| 342 | Ga0495599_0219657 | 3300046678 | Bacteria | 1163 |
| 343 | Ga0495646_0007052 | 3300046680 | Bacteria | 7139 |
| 344 | Ga0495647_0001622 | 3300046681 | Bacteria | 6951 |
| 345 | Ga0495658_0003634 | 3300046683 | Bacteria | 7634 |
| 346 | Ga0495658_0349597 | 3300046683 | Bacteria | 939 |
| 347 | Ga0495636_0038198 | 3300047318 | Bacteria | 1985 |
| 348 | Ga0495676_0110542 | 3300047321 | Bacteria | 2017 |
| 349 | Ga0496106_0108534 | 3300048909 | Bacteria | 2159 |
| 350 | Ga0496110_0263468 | 3300048913 | Bacteria | 1569 |
| 351 | Ga0496110_0310667 | 3300048913 | Bacteria | 1436 |
| 352 | Ga0496112_0056344 | 3300048915 | Bacteria | 3868 |
| 353 | Ga0496112_0074003 | 3300048915 | Bacteria | 3368 |
| 354 | Ga0496113_0012541 | 3300048916 | Bacteria | 5702 |
| 355 | Ga0501033_0048350 | 3300049570 | Bacteria | 3160 |
| 356 | Ga0501034_0016300 | 3300049571 | Bacteria | 7628 |
| 357 | Ga0501034_0170443 | 3300049571 | Bacteria | 2144 |
| 358 | Ga0501039_0277672 | 3300049575 | Bacteria | 1317 |
| 359 | Ga0501042_0018652 | 3300049578 | Bacteria | 4807 |
| 360 | Ga0501046_0317934 | 3300049580 | Bacteria | 1135 |
| 361 | Ga0501047_0246588 | 3300049581 | Bacteria | 1635 |
| 362 | Ga0501069_0110377 | 3300049585 | Bacteria | 1566 |
| 363 | Ga0501071_0239133 | 3300049587 | Bacteria | 1369 |
| 364 | Ga0501072_0193001 | 3300049588 | Bacteria | 1624 |
| 365 | Ga0501075_0012336 | 3300049591 | Bacteria | 6072 |
| 366 | Ga0501075_0267765 | 3300049591 | Bacteria | 1302 |
| 367 | Ga0501079_0153863 | 3300049741 | Bacteria | 1793 |
| 368 | Ga0501079_0429808 | 3300049741 | Bacteria | 1037 |
| 369 | Ga0501081_0181859 | 3300049743 | Bacteria | 1521 |
| 370 | Ga0501044_0022520 | 3300049823 | Bacteria | 6713 |
| 371 | Ga0501045_0123192 | 3300049824 | Bacteria | 1925 |
| 372 | nmdc:mga0yw44_7662_c1 | 3300050492 | Bacteria | 4796 |
| 373 | nmdc:mga0k408_4564_c1 | 3300050493 | Bacteria | 6618 |
| 374 | nmdc:mga06z11_49977_c1 | 3300050494 | Bacteria | 2135 |
| 375 | nmdc:mga05p37_194093_c1 | 3300050507 | Bacteria | 2463 |
| 376 | nmdc:mga05p37_3874_c1 | 3300050507 | Bacteria | 17498 |
| 377 | nmdc:mga05p37_4197_c1 | 3300050507 | Bacteria | 16837 |
| 378 | nmdc:mga09592_10845_c1 | 3300050508 | Bacteria | 7415 |
| 379 | nmdc:mga09592_28735_c1 | 3300050508 | Bacteria | 4622 |
| 380 | nmdc:mga0qj67_243577_c1 | 3300050509 | Bacteria | 1459 |
| 381 | nmdc:mga06r32_3531_c1 | 3300050510 | Bacteria | 13964 |
| 382 | nmdc:mga08y16_790_c1 | 3300050511 | Bacteria | 30222 |
| 383 | nmdc:mga0n895_355702_c1 | 3300050512 | Bacteria | 1483 |
| 384 | nmdc:mga0n895_461969_c1 | 3300050512 | Bacteria | 1281 |
| 385 | nmdc:mga0n895_50402_c1 | 3300050512 | Bacteria | 4082 |
| 386 | nmdc:mga0n895_7395_c1 | 3300050512 | Bacteria | 9424 |
| 387 | nmdc:mga08x19_173620_c1 | 3300050514 | Bacteria | 1469 |
| 388 | nmdc:mga08x19_175001_c1 | 3300050514 | Bacteria | 1463 |
| 389 | nmdc:mga08x19_18991_c1 | 3300050514 | Bacteria | 4215 |
| 390 | nmdc:mga0a205_60724_c1 | 3300050515 | Bacteria | 3651 |
| 391 | nmdc:mga0a205_8224_c1 | 3300050515 | Bacteria | 9481 |
| 392 | Ga0495601_0001532 | 3300053077 | Bacteria | 12756 |
| 393 | Ga0500616_0001962 | 3300053153 | Bacteria | 18325 |
| 394 | Ga0500552_000898 | 3300053733 | Bacteria | 2807 |
| 395 | Ga0501084_0013356 | 3300054114 | Bacteria | 6795 |
| 396 | Ga0501084_0153947 | 3300054114 | Bacteria | 1939 |
| 397 | Ga0501082_0035024 | 3300060353 | Bacteria | 4327 |
| 398 | Ga0530510_0077976 | 3300061734 | Bacteria | 2408 |
| 399 | Ga0530510_0331902 | 3300061734 | Bacteria | 1141 |
| 400 | Ga0530510_0423378 | 3300061734 | Bacteria | 1005 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035692 | Ga0373935_0483543 | Ga0373935_0483543_122_883 | 242 |
| 2 | 3300046454 | Ga0495592_0388799 | Ga0495592_0388799_110_871 | 242 |
| 3 | 3300039062 | Ga0400483_076041 | Ga0400483_076041_14573_15343 | 248 |
| 4 | 3300039062 | Ga0400483_222778 | Ga0400483_222778_10508_11278 | 248 |
| 5 | 3300046526 | Ga0495666_0043000 | Ga0495666_0043000_1358_2119 | 250 |
| 6 | 3300046543 | Ga0495645_0070989 | Ga0495645_0070989_927_1742 | 252 |
| 7 | 3300005440 | Ga0070705_100064543 | Ga0070705_1000645432 | 253 |
| 8 | 3300049741 | Ga0501079_0429808 | Ga0501079_0429808_112_951 | 256 |
| 9 | 3300009993 | Ga0105028_101819 | Ga0105028_1018192 | 257 |
| 10 | 3300046454 | Ga0495592_0118979 | Ga0495592_0118979_395_1222 | 258 |
| 11 | 3300046462 | Ga0495651_0174678 | Ga0495651_0174678_203_1030 | 258 |
| 12 | 3300046516 | Ga0495628_0004597 | Ga0495628_0004597_1151_1978 | 258 |
| 13 | 3300046678 | Ga0495599_0219657 | Ga0495599_0219657_225_1052 | 258 |
| 14 | 3300053077 | Ga0495601_0001532 | Ga0495601_0001532_10681_11508 | 258 |
| 15 | 3300047318 | Ga0495636_0038198 | Ga0495636_0038198_1019_1846 | 261 |
| 16 | 3300010159 | Ga0099796_10081661 | Ga0099796_100816612 | 262 |
| 17 | 3300035119 | Ga0373956_0167986 | Ga0373956_0167986_195_1001 | 262 |
| 18 | 3300046680 | Ga0495646_0007052 | Ga0495646_0007052_6305_7111 | 262 |
| 19 | 3300007788 | Ga0099795_10017844 | Ga0099795_100178442 | 264 |
| 20 | 3300035118 | Ga0373954_0000626 | Ga0373954_0000626_438_1265 | 264 |
| 21 | 3300036401 | Ga0373937_0109627 | Ga0373937_0109627_91_918 | 264 |
| 22 | 3300046517 | Ga0495630_0126182 | Ga0495630_0126182_420_1247 | 264 |
| 23 | 3300046559 | Ga0495667_0173378 | Ga0495667_0173378_293_1120 | 264 |
| 24 | 3300061734 | Ga0530510_0331902 | Ga0530510_0331902_226_1032 | 265 |
| 25 | 3300039062 | Ga0400483_099545 | Ga0400483_099545_2569_3375 | 266 |
| 26 | 3300039062 | Ga0400483_199249 | Ga0400483_199249_481_1287 | 266 |
| 27 | 3300039062 | Ga0400483_240732 | Ga0400483_240732_21_821 | 266 |
| 28 | 3300041413 | Ga0439465_0004548 | Ga0439465_0004548_1103_1927 | 267 |
| 29 | 3300025298 | Ga0209050_1005883 | Ga0209050_10058835 | 268 |
| 30 | 3300025303 | Ga0209051_1040503 | Ga0209051_10405032 | 268 |
| 31 | 3300025304 | Ga0209257_1001100 | Ga0209257_100110020 | 268 |
| 32 | 3300049587 | Ga0501071_0239133 | Ga0501071_0239133_511_1347 | 268 |
| 33 | 3300049588 | Ga0501072_0193001 | Ga0501072_0193001_38_874 | 268 |
| 34 | 3300049743 | Ga0501081_0181859 | Ga0501081_0181859_88_924 | 268 |
| 35 | 3300039453 | Ga0436362_1176906 | Ga0436362_1176906_101_919 | 269 |
| 36 | 3300046526 | Ga0495666_0014350 | Ga0495666_0014350_621_1442 | 269 |
| 37 | 3300005518 | Ga0070699_100131664 | Ga0070699_1001316642 | 270 |
| 38 | 3300009147 | Ga0114129_11213668 | Ga0114129_112136681 | 270 |
| 39 | 3300025304 | Ga0209257_1047365 | Ga0209257_10473651 | 270 |
| 40 | 3300035118 | Ga0373954_0018568 | Ga0373954_0018568_927_1757 | 270 |
| 41 | 3300035170 | Ga0373943_0092584 | Ga0373943_0092584_177_1007 | 270 |
| 42 | 3300035724 | Ga0373933_0005232 | Ga0373933_0005232_926_1756 | 270 |
| 43 | 3300035725 | Ga0373947_0371377 | Ga0373947_0371377_50_880 | 270 |
| 44 | 3300036401 | Ga0373937_0042900 | Ga0373937_0042900_1133_1963 | 270 |
| 45 | 3300037068 | Ga0373925_0148933 | Ga0373925_0148933_789_1619 | 270 |
| 46 | 3300046511 | Ga0495608_0019087 | Ga0495608_0019087_1110_1940 | 270 |
| 47 | 3300049591 | Ga0501075_0267765 | Ga0501075_0267765_284_1216 | 270 |
| 48 | 3300054114 | Ga0501084_0153947 | Ga0501084_0153947_874_1809 | 270 |
| 49 | 3300061734 | Ga0530510_0077976 | Ga0530510_0077976_1105_1932 | 270 |
| 50 | 3300005328 | Ga0070676_10000495 | Ga0070676_1000049511 | 271 |
| 51 | 3300005331 | Ga0070670_100013981 | Ga0070670_1000139813 | 271 |
| 52 | 3300005334 | Ga0068869_100000166 | Ga0068869_10000016611 | 271 |
| 53 | 3300005336 | Ga0070680_100000311 | Ga0070680_10000031111 | 271 |
| 54 | 3300005337 | Ga0070682_100000904 | Ga0070682_1000009043 | 271 |
| 55 | 3300005338 | Ga0068868_100002587 | Ga0068868_1000025877 | 271 |
| 56 | 3300005339 | Ga0070660_100002232 | Ga0070660_1000022324 | 271 |
| 57 | 3300005340 | Ga0070689_100018172 | Ga0070689_1000181722 | 271 |
| 58 | 3300005341 | Ga0070691_10010969 | Ga0070691_100109693 | 271 |
| 59 | 3300005343 | Ga0070687_100067337 | Ga0070687_1000673372 | 271 |
| 60 | 3300005344 | Ga0070661_100000690 | Ga0070661_10000069019 | 271 |
| 61 | 3300005345 | Ga0070692_10001181 | Ga0070692_100011818 | 271 |
| 62 | 3300005353 | Ga0070669_100113142 | Ga0070669_1001131422 | 271 |
| 63 | 3300005366 | Ga0070659_100003885 | Ga0070659_1000038853 | 271 |
| 64 | 3300005367 | Ga0070667_100484848 | Ga0070667_1004848482 | 271 |
| 65 | 3300005440 | Ga0070705_100000167 | Ga0070705_1000001672 | 271 |
| 66 | 3300005440 | Ga0070705_100010535 | Ga0070705_1000105354 | 271 |
| 67 | 3300005444 | Ga0070694_100000860 | Ga0070694_1000008607 | 271 |
| 68 | 3300005455 | Ga0070663_100283738 | Ga0070663_1002837382 | 271 |
| 69 | 3300005457 | Ga0070662_100014293 | Ga0070662_1000142932 | 271 |
| 70 | 3300005458 | Ga0070681_10001265 | Ga0070681_100012653 | 271 |
| 71 | 3300005459 | Ga0068867_100000786 | Ga0068867_1000007865 | 271 |
| 72 | 3300005467 | Ga0070706_100122487 | Ga0070706_1001224872 | 271 |
| 73 | 3300005468 | Ga0070707_100139795 | Ga0070707_1001397952 | 271 |
| 74 | 3300005471 | Ga0070698_100005830 | Ga0070698_1000058302 | 271 |
| 75 | 3300005518 | Ga0070699_100008193 | Ga0070699_1000081932 | 271 |
| 76 | 3300005530 | Ga0070679_100013386 | Ga0070679_1000133866 | 271 |
| 77 | 3300005535 | Ga0070684_100017044 | Ga0070684_1000170444 | 271 |
| 78 | 3300005536 | Ga0070697_100170786 | Ga0070697_1001707862 | 271 |
| 79 | 3300005539 | Ga0068853_100001067 | Ga0068853_10000106712 | 271 |
| 80 | 3300005545 | Ga0070695_100014893 | Ga0070695_1000148934 | 271 |
| 81 | 3300005546 | Ga0070696_100000655 | Ga0070696_10000065514 | 271 |
| 82 | 3300005547 | Ga0070693_100000132 | Ga0070693_1000001323 | 271 |
| 83 | 3300005549 | Ga0070704_100000056 | Ga0070704_10000005628 | 271 |
| 84 | 3300005563 | Ga0068855_100000113 | Ga0068855_10000011357 | 271 |
| 85 | 3300005577 | Ga0068857_100023128 | Ga0068857_1000231282 | 271 |
| 86 | 3300005578 | Ga0068854_100001375 | Ga0068854_1000013752 | 271 |
| 87 | 3300005614 | Ga0068856_100002272 | Ga0068856_1000022727 | 271 |
| 88 | 3300005615 | Ga0070702_100002026 | Ga0070702_1000020265 | 271 |
| 89 | 3300005616 | Ga0068852_100122329 | Ga0068852_1001223292 | 271 |
| 90 | 3300005617 | Ga0068859_100000364 | Ga0068859_10000036414 | 271 |
| 91 | 3300005618 | Ga0068864_100014614 | Ga0068864_1000146144 | 271 |
| 92 | 3300005719 | Ga0068861_100009033 | Ga0068861_1000090332 | 271 |
| 93 | 3300005834 | Ga0068851_10149828 | Ga0068851_101498282 | 271 |
| 94 | 3300005840 | Ga0068870_10000100 | Ga0068870_1000010019 | 271 |
| 95 | 3300005841 | Ga0068863_100102272 | Ga0068863_1001022722 | 271 |
| 96 | 3300005842 | Ga0068858_100034863 | Ga0068858_1000348633 | 271 |
| 97 | 3300005843 | Ga0068860_100018800 | Ga0068860_1000188003 | 271 |
| 98 | 3300005844 | Ga0068862_100002730 | Ga0068862_1000027307 | 271 |
| 99 | 3300005937 | Ga0081455_10009207 | Ga0081455_100092079 | 271 |
| 100 | 3300005981 | Ga0081538_10039513 | Ga0081538_100395132 | 271 |
| 101 | 3300006237 | Ga0097621_100155130 | Ga0097621_1001551302 | 271 |
| 102 | 3300006852 | Ga0075433_10001270 | Ga0075433_1000127011 | 271 |
| 103 | 3300006871 | Ga0075434_100019777 | Ga0075434_1000197773 | 271 |
| 104 | 3300006914 | Ga0075436_100067428 | Ga0075436_1000674282 | 271 |
| 105 | 3300006931 | Ga0097620_100000364 | Ga0097620_10000036426 | 271 |
| 106 | 3300007076 | Ga0075435_100150457 | Ga0075435_1001504572 | 271 |
| 107 | 3300009147 | Ga0114129_10384829 | Ga0114129_103848293 | 271 |
| 108 | 3300009174 | Ga0105241_10004101 | Ga0105241_100041013 | 271 |
| 109 | 3300009176 | Ga0105242_10528692 | Ga0105242_105286922 | 271 |
| 110 | 3300013100 | Ga0157373_10000159 | Ga0157373_1000015918 | 271 |
| 111 | 3300013102 | Ga0157371_10143145 | Ga0157371_101431452 | 271 |
| 112 | 3300013307 | Ga0157372_10000113 | Ga0157372_1000011343 | 271 |
| 113 | 3300014325 | Ga0163163_10279979 | Ga0163163_102799792 | 271 |
| 114 | 3300025901 | Ga0207688_10033833 | Ga0207688_100338332 | 271 |
| 115 | 3300025907 | Ga0207645_10000434 | Ga0207645_1000043417 | 271 |
| 116 | 3300025908 | Ga0207643_10000059 | Ga0207643_1000005925 | 271 |
| 117 | 3300025910 | Ga0207684_10029113 | Ga0207684_100291132 | 271 |
| 118 | 3300025911 | Ga0207654_10001851 | Ga0207654_100018513 | 271 |
| 119 | 3300025912 | Ga0207707_10000207 | Ga0207707_1000020737 | 271 |
| 120 | 3300025917 | Ga0207660_10000425 | Ga0207660_1000042517 | 271 |
| 121 | 3300025918 | Ga0207662_10019757 | Ga0207662_100197574 | 271 |
| 122 | 3300025919 | Ga0207657_10000209 | Ga0207657_1000020915 | 271 |
| 123 | 3300025920 | Ga0207649_10004671 | Ga0207649_100046714 | 271 |
| 124 | 3300025921 | Ga0207652_10000105 | Ga0207652_1000010512 | 271 |
| 125 | 3300025922 | Ga0207646_10063532 | Ga0207646_100635322 | 271 |
| 126 | 3300025923 | Ga0207681_10074214 | Ga0207681_100742142 | 271 |
| 127 | 3300025925 | Ga0207650_10003138 | Ga0207650_100031386 | 271 |
| 128 | 3300025926 | Ga0207659_10107019 | Ga0207659_101070192 | 271 |
| 129 | 3300025932 | Ga0207690_10001697 | Ga0207690_100016977 | 271 |
| 130 | 3300025933 | Ga0207706_10007226 | Ga0207706_100072262 | 271 |
| 131 | 3300025936 | Ga0207670_10026410 | Ga0207670_100264102 | 271 |
| 132 | 3300025939 | Ga0207665_10007219 | Ga0207665_100072193 | 271 |
| 133 | 3300025940 | Ga0207691_10373976 | Ga0207691_103739762 | 271 |
| 134 | 3300025942 | Ga0207689_10001068 | Ga0207689_1000106817 | 271 |
| 135 | 3300025944 | Ga0207661_10135818 | Ga0207661_101358182 | 271 |
| 136 | 3300025945 | Ga0207679_10000209 | Ga0207679_1000020927 | 271 |
| 137 | 3300025949 | Ga0207667_10000372 | Ga0207667_1000037219 | 271 |
| 138 | 3300026023 | Ga0207677_10012832 | Ga0207677_100128323 | 271 |
| 139 | 3300026035 | Ga0207703_10080624 | Ga0207703_100806242 | 271 |
| 140 | 3300026067 | Ga0207678_10304435 | Ga0207678_103044352 | 271 |
| 141 | 3300026078 | Ga0207702_10001726 | Ga0207702_100017262 | 271 |
| 142 | 3300026088 | Ga0207641_10015338 | Ga0207641_100153384 | 271 |
| 143 | 3300026089 | Ga0207648_10000170 | Ga0207648_1000017018 | 271 |
| 144 | 3300026095 | Ga0207676_10019545 | Ga0207676_100195454 | 271 |
| 145 | 3300026095 | Ga0207676_10180957 | Ga0207676_101809573 | 271 |
| 146 | 3300026116 | Ga0207674_10000585 | Ga0207674_100005857 | 271 |
| 147 | 3300026118 | Ga0207675_100016445 | Ga0207675_1000164452 | 271 |
| 148 | 3300028380 | Ga0268265_10003127 | Ga0268265_100031276 | 271 |
| 149 | 3300028381 | Ga0268264_10005874 | Ga0268264_100058745 | 271 |
| 150 | 3300034818 | Ga0373950_0009438 | Ga0373950_0009438_497_1327 | 271 |
| 151 | 3300035090 | Ga0373949_0005337 | Ga0373949_0005337_712_1542 | 271 |
| 152 | 3300035115 | Ga0373941_0004548 | Ga0373941_0004548_1449_2279 | 271 |
| 153 | 3300035121 | Ga0373960_0003451 | Ga0373960_0003451_499_1329 | 271 |
| 154 | 3300037068 | Ga0373925_0152088 | Ga0373925_0152088_737_1558 | 271 |
| 155 | 3300042005 | Ga0439448_0000128 | Ga0439448_0000128_9802_10632 | 271 |
| 156 | 3300042438 | Ga0439459_0001765 | Ga0439459_0001765_2370_3200 | 271 |
| 157 | 3300042876 | Ga0451577_0052708 | Ga0451577_0052708_2033_2863 | 271 |
| 158 | 3300048909 | Ga0496106_0108534 | Ga0496106_0108534_57_887 | 271 |
| 159 | 3300048913 | Ga0496110_0310667 | Ga0496110_0310667_362_1192 | 271 |
| 160 | 3300048915 | Ga0496112_0056344 | Ga0496112_0056344_1552_2382 | 271 |
| 161 | 3300049585 | Ga0501069_0110377 | Ga0501069_0110377_310_1140 | 271 |
| 162 | 3300050492 | nmdc:mga0yw44_7662_c1 | nmdc:mga0yw44_7662_c1_510_1325 | 271 |
| 163 | 3300050494 | nmdc:mga06z11_49977_c1 | nmdc:mga06z11_49977_c1_1223_2038 | 271 |
| 164 | 3300050507 | nmdc:mga05p37_194093_c1 | nmdc:mga05p37_194093_c1_878_1708 | 271 |
| 165 | 3300050512 | nmdc:mga0n895_50402_c1 | nmdc:mga0n895_50402_c1_1591_2421 | 271 |
| 166 | 3300050512 | nmdc:mga0n895_7395_c1 | nmdc:mga0n895_7395_c1_5776_6615 | 271 |
| 167 | 3300050514 | nmdc:mga08x19_173620_c1 | nmdc:mga08x19_173620_c1_370_1194 | 271 |
| 168 | 3300050514 | nmdc:mga08x19_175001_c1 | nmdc:mga08x19_175001_c1_505_1335 | 271 |
| 169 | 3300050515 | nmdc:mga0a205_60724_c1 | nmdc:mga0a205_60724_c1_1620_2450 | 271 |
| 170 | 3300050515 | nmdc:mga0a205_8224_c1 | nmdc:mga0a205_8224_c1_2938_3777 | 271 |
| 171 | 3300053153 | Ga0500616_0001962 | Ga0500616_0001962_11746_12567 | 271 |
| 172 | 3300053733 | Ga0500552_000898 | Ga0500552_000898_899_1714 | 271 |
| 173 | 3300005327 | Ga0070658_10056770 | Ga0070658_100567703 | 272 |
| 174 | 3300005330 | Ga0070690_100007780 | Ga0070690_1000077806 | 272 |
| 175 | 3300005334 | Ga0068869_100000337 | Ga0068869_1000003376 | 272 |
| 176 | 3300005336 | Ga0070680_100000763 | Ga0070680_10000076315 | 272 |
| 177 | 3300005336 | Ga0070680_100006493 | Ga0070680_1000064932 | 272 |
| 178 | 3300005336 | Ga0070680_100057777 | Ga0070680_1000577773 | 272 |
| 179 | 3300005338 | Ga0068868_100000378 | Ga0068868_10000037834 | 272 |
| 180 | 3300005340 | Ga0070689_100011186 | Ga0070689_1000111865 | 272 |
| 181 | 3300005341 | Ga0070691_10000874 | Ga0070691_100008746 | 272 |
| 182 | 3300005341 | Ga0070691_10004072 | Ga0070691_100040725 | 272 |
| 183 | 3300005343 | Ga0070687_100023934 | Ga0070687_1000239342 | 272 |
| 184 | 3300005345 | Ga0070692_10001138 | Ga0070692_100011386 | 272 |
| 185 | 3300005345 | Ga0070692_10009393 | Ga0070692_100093934 | 272 |
| 186 | 3300005354 | Ga0070675_100036057 | Ga0070675_1000360574 | 272 |
| 187 | 3300005355 | Ga0070671_100027134 | Ga0070671_1000271342 | 272 |
| 188 | 3300005356 | Ga0070674_100554390 | Ga0070674_1005543901 | 272 |
| 189 | 3300005406 | Ga0070703_10027151 | Ga0070703_100271512 | 272 |
| 190 | 3300005438 | Ga0070701_10000027 | Ga0070701_1000002739 | 272 |
| 191 | 3300005438 | Ga0070701_10016989 | Ga0070701_100169894 | 272 |
| 192 | 3300005441 | Ga0070700_100003008 | Ga0070700_1000030087 | 272 |
| 193 | 3300005441 | Ga0070700_100031063 | Ga0070700_1000310634 | 272 |
| 194 | 3300005444 | Ga0070694_100000096 | Ga0070694_10000009639 | 272 |
| 195 | 3300005445 | Ga0070708_100079640 | Ga0070708_1000796402 | 272 |
| 196 | 3300005456 | Ga0070678_100087552 | Ga0070678_1000875521 | 272 |
| 197 | 3300005456 | Ga0070678_100250405 | Ga0070678_1002504052 | 272 |
| 198 | 3300005458 | Ga0070681_10068197 | Ga0070681_100681972 | 272 |
| 199 | 3300005459 | Ga0068867_100003298 | Ga0068867_1000032987 | 272 |
| 200 | 3300005467 | Ga0070706_100079858 | Ga0070706_1000798582 | 272 |
| 201 | 3300005468 | Ga0070707_100725167 | Ga0070707_1007251671 | 272 |
| 202 | 3300005530 | Ga0070679_100001012 | Ga0070679_10000101222 | 272 |
| 203 | 3300005544 | Ga0070686_100001404 | Ga0070686_1000014043 | 272 |
| 204 | 3300005545 | Ga0070695_100009431 | Ga0070695_1000094313 | 272 |
| 205 | 3300005545 | Ga0070695_100049441 | Ga0070695_1000494412 | 272 |
| 206 | 3300005546 | Ga0070696_100001291 | Ga0070696_1000012915 | 272 |
| 207 | 3300005547 | Ga0070693_100000003 | Ga0070693_10000000334 | 272 |
| 208 | 3300005548 | Ga0070665_100029828 | Ga0070665_1000298284 | 272 |
| 209 | 3300005548 | Ga0070665_100051986 | Ga0070665_1000519864 | 272 |
| 210 | 3300005549 | Ga0070704_100063040 | Ga0070704_1000630402 | 272 |
| 211 | 3300005549 | Ga0070704_100273515 | Ga0070704_1002735152 | 272 |
| 212 | 3300005563 | Ga0068855_100007058 | Ga0068855_10000705816 | 272 |
| 213 | 3300005563 | Ga0068855_100085343 | Ga0068855_1000853433 | 272 |
| 214 | 3300005577 | Ga0068857_100080526 | Ga0068857_1000805262 | 272 |
| 215 | 3300005578 | Ga0068854_100000304 | Ga0068854_1000003046 | 272 |
| 216 | 3300005614 | Ga0068856_100171512 | Ga0068856_1001715123 | 272 |
| 217 | 3300005615 | Ga0070702_100000004 | Ga0070702_10000000430 | 272 |
| 218 | 3300005616 | Ga0068852_100497331 | Ga0068852_1004973312 | 272 |
| 219 | 3300005719 | Ga0068861_100002640 | Ga0068861_1000026403 | 272 |
| 220 | 3300005840 | Ga0068870_10100549 | Ga0068870_101005493 | 272 |
| 221 | 3300005843 | Ga0068860_100001014 | Ga0068860_1000010146 | 272 |
| 222 | 3300005844 | Ga0068862_100015174 | Ga0068862_1000151743 | 272 |
| 223 | 3300005844 | Ga0068862_100185342 | Ga0068862_1001853422 | 272 |
| 224 | 3300005844 | Ga0068862_100303135 | Ga0068862_1003031352 | 272 |
| 225 | 3300006173 | Ga0070716_100427956 | Ga0070716_1004279561 | 272 |
| 226 | 3300006175 | Ga0070712_100058513 | Ga0070712_1000585136 | 272 |
| 227 | 3300006195 | Ga0075366_10005759 | Ga0075366_100057597 | 272 |
| 228 | 3300006237 | Ga0097621_100000574 | Ga0097621_1000005744 | 272 |
| 229 | 3300006358 | Ga0068871_100000688 | Ga0068871_10000068815 | 272 |
| 230 | 3300006844 | Ga0075428_100022540 | Ga0075428_1000225403 | 272 |
| 231 | 3300006844 | Ga0075428_100211575 | Ga0075428_1002115752 | 272 |
| 232 | 3300006846 | Ga0075430_100117186 | Ga0075430_1001171862 | 272 |
| 233 | 3300006847 | Ga0075431_100001284 | Ga0075431_10000128418 | 272 |
| 234 | 3300006847 | Ga0075431_100017605 | Ga0075431_1000176054 | 272 |
| 235 | 3300006871 | Ga0075434_100238390 | Ga0075434_1002383902 | 272 |
| 236 | 3300006880 | Ga0075429_100000496 | Ga0075429_10000049634 | 272 |
| 237 | 3300006880 | Ga0075429_100032848 | Ga0075429_1000328486 | 272 |
| 238 | 3300006881 | Ga0068865_100009905 | Ga0068865_1000099056 | 272 |
| 239 | 3300007788 | Ga0099795_10059403 | Ga0099795_100594031 | 272 |
| 240 | 3300009093 | Ga0105240_10061063 | Ga0105240_100610634 | 272 |
| 241 | 3300009094 | Ga0111539_10466527 | Ga0111539_104665272 | 272 |
| 242 | 3300009098 | Ga0105245_10002146 | Ga0105245_1000214612 | 272 |
| 243 | 3300009098 | Ga0105245_10234944 | Ga0105245_102349443 | 272 |
| 244 | 3300009147 | Ga0114129_10000149 | Ga0114129_1000014911 | 272 |
| 245 | 3300009147 | Ga0114129_10011670 | Ga0114129_100116704 | 272 |
| 246 | 3300009148 | Ga0105243_10000762 | Ga0105243_1000076230 | 272 |
| 247 | 3300009148 | Ga0105243_10004881 | Ga0105243_100048812 | 272 |
| 248 | 3300009174 | Ga0105241_10082555 | Ga0105241_100825553 | 272 |
| 249 | 3300009176 | Ga0105242_10000326 | Ga0105242_1000032630 | 272 |
| 250 | 3300009176 | Ga0105242_10069341 | Ga0105242_100693414 | 272 |
| 251 | 3300009177 | Ga0105248_10074969 | Ga0105248_100749695 | 272 |
| 252 | 3300009545 | Ga0105237_10368288 | Ga0105237_103682882 | 272 |
| 253 | 3300009553 | Ga0105249_10011495 | Ga0105249_100114956 | 272 |
| 254 | 3300009553 | Ga0105249_10437058 | Ga0105249_104370582 | 272 |
| 255 | 3300010159 | Ga0099796_10078025 | Ga0099796_100780251 | 272 |
| 256 | 3300010375 | Ga0105239_10069063 | Ga0105239_100690632 | 272 |
| 257 | 3300010375 | Ga0105239_10608109 | Ga0105239_106081092 | 272 |
| 258 | 3300013297 | Ga0157378_10000192 | Ga0157378_1000019230 | 272 |
| 259 | 3300013308 | Ga0157375_11074736 | Ga0157375_110747361 | 272 |
| 260 | 3300014326 | Ga0157380_10030793 | Ga0157380_100307935 | 272 |
| 261 | 3300014969 | Ga0157376_10001688 | Ga0157376_1000168816 | 272 |
| 262 | 3300025899 | Ga0207642_10003637 | Ga0207642_100036373 | 272 |
| 263 | 3300025903 | Ga0207680_10285925 | Ga0207680_102859252 | 272 |
| 264 | 3300025908 | Ga0207643_10114108 | Ga0207643_101141082 | 272 |
| 265 | 3300025910 | Ga0207684_10204900 | Ga0207684_102049002 | 272 |
| 266 | 3300025911 | Ga0207654_10005597 | Ga0207654_100055976 | 272 |
| 267 | 3300025912 | Ga0207707_10215906 | Ga0207707_102159062 | 272 |
| 268 | 3300025913 | Ga0207695_10026146 | Ga0207695_100261464 | 272 |
| 269 | 3300025915 | Ga0207693_10154071 | Ga0207693_101540713 | 272 |
| 270 | 3300025916 | Ga0207663_10244781 | Ga0207663_102447811 | 272 |
| 271 | 3300025917 | Ga0207660_10016601 | Ga0207660_100166015 | 272 |
| 272 | 3300025917 | Ga0207660_10020677 | Ga0207660_100206775 | 272 |
| 273 | 3300025918 | Ga0207662_10000101 | Ga0207662_1000010130 | 272 |
| 274 | 3300025920 | Ga0207649_10429827 | Ga0207649_104298272 | 272 |
| 275 | 3300025921 | Ga0207652_10021418 | Ga0207652_100214185 | 272 |
| 276 | 3300025921 | Ga0207652_10057589 | Ga0207652_100575891 | 272 |
| 277 | 3300025922 | Ga0207646_10612749 | Ga0207646_106127492 | 272 |
| 278 | 3300025924 | Ga0207694_10157074 | Ga0207694_101570742 | 272 |
| 279 | 3300025926 | Ga0207659_10077933 | Ga0207659_100779332 | 272 |
| 280 | 3300025927 | Ga0207687_10002779 | Ga0207687_1000277910 | 272 |
| 281 | 3300025928 | Ga0207700_10372101 | Ga0207700_103721012 | 272 |
| 282 | 3300025931 | Ga0207644_10032175 | Ga0207644_100321752 | 272 |
| 283 | 3300025933 | Ga0207706_10437267 | Ga0207706_104372671 | 272 |
| 284 | 3300025934 | Ga0207686_10002692 | Ga0207686_100026923 | 272 |
| 285 | 3300025934 | Ga0207686_10097338 | Ga0207686_100973381 | 272 |
| 286 | 3300025935 | Ga0207709_10001269 | Ga0207709_1000126912 | 272 |
| 287 | 3300025935 | Ga0207709_10155295 | Ga0207709_101552953 | 272 |
| 288 | 3300025936 | Ga0207670_10009854 | Ga0207670_100098544 | 272 |
| 289 | 3300025936 | Ga0207670_10149837 | Ga0207670_101498373 | 272 |
| 290 | 3300025938 | Ga0207704_10031775 | Ga0207704_100317753 | 272 |
| 291 | 3300025941 | Ga0207711_10065209 | Ga0207711_100652094 | 272 |
| 292 | 3300025942 | Ga0207689_10000103 | Ga0207689_1000010344 | 272 |
| 293 | 3300025961 | Ga0207712_10352473 | Ga0207712_103524732 | 272 |
| 294 | 3300025981 | Ga0207640_10002032 | Ga0207640_100020327 | 272 |
| 295 | 3300026023 | Ga0207677_10001533 | Ga0207677_1000153313 | 272 |
| 296 | 3300026035 | Ga0207703_10020230 | Ga0207703_100202303 | 272 |
| 297 | 3300026075 | Ga0207708_10000048 | Ga0207708_1000004848 | 272 |
| 298 | 3300026075 | Ga0207708_10014476 | Ga0207708_100144765 | 272 |
| 299 | 3300026078 | Ga0207702_10033331 | Ga0207702_100333314 | 272 |
| 300 | 3300026078 | Ga0207702_10082288 | Ga0207702_100822882 | 272 |
| 301 | 3300026088 | Ga0207641_10377304 | Ga0207641_103773042 | 272 |
| 302 | 3300026089 | Ga0207648_10000124 | Ga0207648_1000012472 | 272 |
| 303 | 3300026095 | Ga0207676_10019160 | Ga0207676_100191605 | 272 |
| 304 | 3300026116 | Ga0207674_10013493 | Ga0207674_100134932 | 272 |
| 305 | 3300026116 | Ga0207674_10362977 | Ga0207674_103629772 | 272 |
| 306 | 3300026118 | Ga0207675_100000593 | Ga0207675_1000005937 | 272 |
| 307 | 3300026121 | Ga0207683_10017124 | Ga0207683_100171241 | 272 |
| 308 | 3300026121 | Ga0207683_10284698 | Ga0207683_102846982 | 272 |
| 309 | 3300026142 | Ga0207698_10597794 | Ga0207698_105977942 | 272 |
| 310 | 3300027907 | Ga0207428_10002437 | Ga0207428_1000243710 | 272 |
| 311 | 3300028379 | Ga0268266_10020571 | Ga0268266_100205714 | 272 |
| 312 | 3300028380 | Ga0268265_10059983 | Ga0268265_100599833 | 272 |
| 313 | 3300028380 | Ga0268265_10332683 | Ga0268265_103326832 | 272 |
| 314 | 3300028381 | Ga0268264_10001425 | Ga0268264_100014252 | 272 |
| 315 | 3300028381 | Ga0268264_10239854 | Ga0268264_102398542 | 272 |
| 316 | 3300031995 | Ga0307409_100092064 | Ga0307409_1000920642 | 272 |
| 317 | 3300034816 | Ga0373930_0022827 | Ga0373930_0022827_10_840 | 272 |
| 318 | 3300034817 | Ga0373948_0025524 | Ga0373948_0025524_258_1088 | 272 |
| 319 | 3300034820 | Ga0373959_0041239 | Ga0373959_0041239_80_910 | 272 |
| 320 | 3300034957 | Ga0373938_0039412 | Ga0373938_0039412_59_889 | 272 |
| 321 | 3300035083 | Ga0373926_0007068 | Ga0373926_0007068_1521_2351 | 272 |
| 322 | 3300035084 | Ga0373928_0016344 | Ga0373928_0016344_163_993 | 272 |
| 323 | 3300035086 | Ga0373934_0000089 | Ga0373934_0000089_16870_17703 | 272 |
| 324 | 3300035086 | Ga0373934_0006076 | Ga0373934_0006076_2422_3249 | 272 |
| 325 | 3300035089 | Ga0373944_0002308 | Ga0373944_0002308_2972_3802 | 272 |
| 326 | 3300035090 | Ga0373949_0008834 | Ga0373949_0008834_326_1156 | 272 |
| 327 | 3300035112 | Ga0373932_0001851 | Ga0373932_0001851_2030_2860 | 272 |
| 328 | 3300035112 | Ga0373932_0020026 | Ga0373932_0020026_170_988 | 272 |
| 329 | 3300035115 | Ga0373941_0021383 | Ga0373941_0021383_991_1809 | 272 |
| 330 | 3300035116 | Ga0373945_0002297 | Ga0373945_0002297_2310_3140 | 272 |
| 331 | 3300035121 | Ga0373960_0075607 | Ga0373960_0075607_166_984 | 272 |
| 332 | 3300035207 | Ga0373942_0029599 | Ga0373942_0029599_192_1022 | 272 |
| 333 | 3300035241 | Ga0373961_0050407 | Ga0373961_0050407_197_1015 | 272 |
| 334 | 3300035242 | Ga0373962_0066356 | Ga0373962_0066356_122_952 | 272 |
| 335 | 3300035691 | Ga0373931_0000594 | Ga0373931_0000594_655_1485 | 272 |
| 336 | 3300035691 | Ga0373931_0024853 | Ga0373931_0024853_1533_2363 | 272 |
| 337 | 3300035691 | Ga0373931_0071680 | Ga0373931_0071680_46_876 | 272 |
| 338 | 3300035691 | Ga0373931_0072007 | Ga0373931_0072007_401_1219 | 272 |
| 339 | 3300035691 | Ga0373931_0235912 | Ga0373931_0235912_233_1051 | 272 |
| 340 | 3300035695 | Ga0373927_0334675 | Ga0373927_0334675_42_860 | 272 |
| 341 | 3300036401 | Ga0373937_0567582 | Ga0373937_0567582_106_966 | 272 |
| 342 | 3300037068 | Ga0373925_0178279 | Ga0373925_0178279_206_1036 | 272 |
| 343 | 3300037312 | Ga0395899_0004184 | Ga0395899_0004184_741_1559 | 272 |
| 344 | 3300037312 | Ga0395899_0100288 | Ga0395899_0100288_256_1074 | 272 |
| 345 | 3300037418 | Ga0395900_0045956 | Ga0395900_0045956_3375_4193 | 272 |
| 346 | 3300037418 | Ga0395900_0116844 | Ga0395900_0116844_1528_2346 | 272 |
| 347 | 3300037466 | Ga0395898_0014917 | Ga0395898_0014917_5845_6663 | 272 |
| 348 | 3300037466 | Ga0395898_0018563 | Ga0395898_0018563_2658_3479 | 272 |
| 349 | 3300038443 | Ga0395901_0004642 | Ga0395901_0004642_1896_2717 | 272 |
| 350 | 3300038443 | Ga0395901_0010633 | Ga0395901_0010633_3511_4329 | 272 |
| 351 | 3300038443 | Ga0395901_0013096 | Ga0395901_0013096_1701_2522 | 272 |
| 352 | 3300038443 | Ga0395901_0058965 | Ga0395901_0058965_2784_3602 | 272 |
| 353 | 3300039437 | Ga0436365_0326209 | Ga0436365_0326209_67_885 | 272 |
| 354 | 3300039437 | Ga0436365_1142450 | Ga0436365_1142450_746_1606 | 272 |
| 355 | 3300039437 | Ga0436365_1596392 | Ga0436365_1596392_784_1689 | 272 |
| 356 | 3300042001 | Ga0439441_029477 | Ga0439441_029477_18_851 | 272 |
| 357 | 3300042461 | Ga0439460_0027686 | Ga0439460_0027686_332_1189 | 272 |
| 358 | 3300042876 | Ga0451577_0046606 | Ga0451577_0046606_333_1166 | 272 |
| 359 | 3300045051 | Ga0451576_0016604 | Ga0451576_0016604_5827_6657 | 272 |
| 360 | 3300045051 | Ga0451576_0019565 | Ga0451576_0019565_6114_6947 | 272 |
| 361 | 3300045051 | Ga0451576_0024042 | Ga0451576_0024042_5733_6563 | 272 |
| 362 | 3300045051 | Ga0451576_0266430 | Ga0451576_0266430_382_1221 | 272 |
| 363 | 3300046455 | Ga0495603_0008408 | Ga0495603_0008408_4337_5167 | 272 |
| 364 | 3300046472 | Ga0495580_0012133 | Ga0495580_0012133_2976_3806 | 272 |
| 365 | 3300046472 | Ga0495580_0114451 | Ga0495580_0114451_388_1215 | 272 |
| 366 | 3300046475 | Ga0495639_0003282 | Ga0495639_0003282_684_1514 | 272 |
| 367 | 3300046517 | Ga0495630_0220149 | Ga0495630_0220149_476_1306 | 272 |
| 368 | 3300046535 | Ga0495586_0004072 | Ga0495586_0004072_1673_2503 | 272 |
| 369 | 3300046681 | Ga0495647_0001622 | Ga0495647_0001622_868_1698 | 272 |
| 370 | 3300046683 | Ga0495658_0003634 | Ga0495658_0003634_4529_5359 | 272 |
| 371 | 3300046683 | Ga0495658_0349597 | Ga0495658_0349597_62_880 | 272 |
| 372 | 3300047321 | Ga0495676_0110542 | Ga0495676_0110542_904_1734 | 272 |
| 373 | 3300048913 | Ga0496110_0263468 | Ga0496110_0263468_205_1023 | 272 |
| 374 | 3300048915 | Ga0496112_0074003 | Ga0496112_0074003_1307_2125 | 272 |
| 375 | 3300048916 | Ga0496113_0012541 | Ga0496113_0012541_4098_4916 | 272 |
| 376 | 3300049570 | Ga0501033_0048350 | Ga0501033_0048350_1900_2754 | 272 |
| 377 | 3300049571 | Ga0501034_0016300 | Ga0501034_0016300_2398_3216 | 272 |
| 378 | 3300049571 | Ga0501034_0170443 | Ga0501034_0170443_641_1459 | 272 |
| 379 | 3300049575 | Ga0501039_0277672 | Ga0501039_0277672_35_862 | 272 |
| 380 | 3300049578 | Ga0501042_0018652 | Ga0501042_0018652_2634_3461 | 272 |
| 381 | 3300049580 | Ga0501046_0317934 | Ga0501046_0317934_107_943 | 272 |
| 382 | 3300049581 | Ga0501047_0246588 | Ga0501047_0246588_280_1098 | 272 |
| 383 | 3300049591 | Ga0501075_0012336 | Ga0501075_0012336_2294_3133 | 272 |
| 384 | 3300049741 | Ga0501079_0153863 | Ga0501079_0153863_139_996 | 272 |
| 385 | 3300049823 | Ga0501044_0022520 | Ga0501044_0022520_2232_3050 | 272 |
| 386 | 3300049824 | Ga0501045_0123192 | Ga0501045_0123192_596_1423 | 272 |
| 387 | 3300050493 | nmdc:mga0k408_4564_c1 | nmdc:mga0k408_4564_c1_5136_5954 | 272 |
| 388 | 3300050507 | nmdc:mga05p37_3874_c1 | nmdc:mga05p37_3874_c1_15567_16397 | 272 |
| 389 | 3300050507 | nmdc:mga05p37_4197_c1 | nmdc:mga05p37_4197_c1_10162_10989 | 272 |
| 390 | 3300050508 | nmdc:mga09592_10845_c1 | nmdc:mga09592_10845_c1_87_917 | 272 |
| 391 | 3300050508 | nmdc:mga09592_28735_c1 | nmdc:mga09592_28735_c1_302_1129 | 272 |
| 392 | 3300050509 | nmdc:mga0qj67_243577_c1 | nmdc:mga0qj67_243577_c1_342_1175 | 272 |
| 393 | 3300050510 | nmdc:mga06r32_3531_c1 | nmdc:mga06r32_3531_c1_6045_6872 | 272 |
| 394 | 3300050511 | nmdc:mga08y16_790_c1 | nmdc:mga08y16_790_c1_20789_21619 | 272 |
| 395 | 3300050512 | nmdc:mga0n895_355702_c1 | nmdc:mga0n895_355702_c1_570_1388 | 272 |
| 396 | 3300050512 | nmdc:mga0n895_461969_c1 | nmdc:mga0n895_461969_c1_326_1144 | 272 |
| 397 | 3300050514 | nmdc:mga08x19_18991_c1 | nmdc:mga08x19_18991_c1_665_1483 | 272 |
| 398 | 3300054114 | Ga0501084_0013356 | Ga0501084_0013356_2523_3362 | 272 |
| 399 | 3300060353 | Ga0501082_0035024 | Ga0501082_0035024_890_1717 | 272 |
| 400 | 3300061734 | Ga0530510_0423378 | Ga0530510_0423378_90_965 | 272 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lsb-assembly1.cif.gz_A | crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 | 0.9601 | 4 | 272 |
| 4lsb-assembly1.cif.gz_B | crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 | 0.9598 | 4 | 272 |
| 4lsb-assembly1.cif.gz_A | crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 | 0.9463 | 4 | 272 |
| 4lsb-assembly1.cif.gz_B | crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315 | 0.946 | 4 | 272 |
| 2ze3-assembly1.cif.gz_A-2 | crystal structure of dfa0005 complexed with alpha-ketoglutarate: a novel member of the icl/pepm superfamily from alkali-tolerant deinococcus ficus | 0.9041 | 4 | 259 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4lsbB01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9654 | 4 | 230 | 3.20.20.60 |
| 4lsbB01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9489 | 4 | 230 | 3.20.20.60 |
| 2ze3A01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.8989 | 4 | 230 | 3.20.20.60 |
| af_P9WLN9_1_257_3.20.20.60 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.8937 | 10 | 271 | 3.20.20.60 |
| 4mg4B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.8857 | 2 | 253 | 3.20.20.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537A4V5-F1-model_v4 | Isocitrate lyase/phosphoenolpyruvate mutase family protein | 0.9897 | 1 | 200 |
GO:0016829
|
| AF-A0A7Y7J3D7-F1-model_v4 | Isocitrate lyase/phosphoenolpyruvate mutase family protein | 0.9806 | 1 | 272 |
GO:0016829
|
| AF-A0A7Y7Y737-F1-model_v4 | Isocitrate lyase/phosphoenolpyruvate mutase family protein | 0.9799 | 99 | 204 |
GO:0016829
|
| AF-A0A1R3UR83-F1-model_v4 | Probable carboxyvinyl-carboxyphosphonate phosphorylmutase (EC 2.7.8.23) | 0.9794 | 4 | 270 |
GO:0008807
|
| AF-A0A2A5B6A7-F1-model_v4 | 2-methylisocitrate lyase | 0.979 | 1 | 270 |
GO:0016829
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar