F434675

General Info

Members Datasets Scaffolds Average Seq Length
400 260 800 151

Family's Representative Sequence

Representative Sequence 3300048906|Ga0496103_0411752|Ga0496103_0411752_39_569
Length 176
Sequence VADLLTISEVSKRSGVAASALRFYEERGLIESERAASGGHRRYPRPVLRRIAFIVFAQRVGLTLEEIGAELARLPPDRVPSRREWAKLSSGWSERIDAKIAELERLKLGLTECIGCGCLSLDRCRLANPGDRAGAAGPGPRYWLGDRPSALLTAAGEAGALLTAHRPRSAPRQPAP

Samples

Sample ID Description Type Environment
1 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
162 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
180 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
181 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
182 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
206 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
207 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
216 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
217 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
241 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
242 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
243 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
244 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
245 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
246 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
260 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.25
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3
Nodule 0
Rhizoplane 11
Rhizosphere 83.25
Stem 0
Stem Tuber 0
Unclassified 11.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496103_0411752 3300048906 Bacteria 868
2 JGI24743J22301_10071673 3300001991 Unclassified 723
3 JGI24744J21845_10084527 3300002077 Unclassified 581
4 JGI24751J29686_10109286 3300002459 Unclassified 579
5 JGI25407J50210_10024930 3300003373 Bacteria 1551
6 Ga0065712_10283478 3300005290 Bacteria 891
7 Ga0065712_10433923 3300005290 Unclassified 700
8 Ga0065715_10159782 3300005293 Bacteria 1641
9 Ga0065715_10345721 3300005293 Bacteria 959
10 Ga0070658_10948453 3300005327 Bacteria 748
11 Ga0070676_10431480 3300005328 Bacteria 923
12 Ga0070683_100447807 3300005329 Bacteria 1232
13 Ga0070670_100250905 3300005331 Bacteria 1542
14 Ga0070670_100684671 3300005331 Bacteria 921
15 Ga0070666_10810662 3300005335 Bacteria 690
16 Ga0070680_101555844 3300005336 Bacteria 573
17 Ga0070682_100068966 3300005337 Bacteria 2257
18 Ga0068868_100022858 3300005338 Bacteria 4726
19 Ga0068868_100407969 3300005338 Unclassified 1174
20 Ga0068868_100519608 3300005338 Bacteria 1045
21 Ga0070660_100386912 3300005339 Bacteria 1155
22 Ga0070692_11225644 3300005345 Bacteria 535
23 Ga0070668_100229878 3300005347 Bacteria 1533
24 Ga0070675_100221420 3300005354 Bacteria 1648
25 Ga0070675_100342886 3300005354 Unclassified 1324
26 Ga0070671_100168000 3300005355 Bacteria 1855
27 Ga0070671_100438251 3300005355 Unclassified 1120
28 Ga0070674_100746299 3300005356 Unclassified 841
29 Ga0070673_101714934 3300005364 Bacteria 594
30 Ga0070688_101318273 3300005365 Unclassified 583
31 Ga0070659_100111685 3300005366 Bacteria 2207
32 Ga0070659_100877313 3300005366 Bacteria 783
33 Ga0070667_100414764 3300005367 Unclassified 1227
34 Ga0070667_101028233 3300005367 Bacteria 769
35 Ga0070709_10222780 3300005434 Bacteria 1346
36 Ga0070709_10339776 3300005434 Bacteria 1107
37 Ga0070714_100021451 3300005435 Bacteria 5285
38 Ga0070714_100269953 3300005435 Bacteria 1577
39 Ga0070713_100184186 3300005436 Bacteria 1878
40 Ga0070713_102269495 3300005436 Bacteria 525
41 Ga0070710_10189996 3300005437 Bacteria 1291
42 Ga0070711_100063458 3300005439 Bacteria 2578
43 Ga0070711_100080726 3300005439 Bacteria 2316
44 Ga0070705_100272703 3300005440 Bacteria 1199
45 Ga0070705_100277851 3300005440 Bacteria 1189
46 Ga0070700_100004519 3300005441 Bacteria 7274
47 Ga0070700_100308493 3300005441 Bacteria 1158
48 Ga0070694_100024259 3300005444 Bacteria 3914
49 Ga0070694_100316523 3300005444 Bacteria 1200
50 Ga0070663_101050432 3300005455 Bacteria 710
51 Ga0070678_100104014 3300005456 Bacteria 2207
52 Ga0070678_100649940 3300005456 Bacteria 946
53 Ga0070662_100248052 3300005457 Bacteria 1430
54 Ga0070662_100628428 3300005457 Bacteria 905
55 Ga0070681_10165661 3300005458 Bacteria 2133
56 Ga0068867_100857310 3300005459 Unclassified 814
57 Ga0070685_10280146 3300005466 Bacteria 1116
58 Ga0070698_100008172 3300005471 Bacteria 11313
59 Ga0070699_100158837 3300005518 Bacteria 2000
60 Ga0070699_100376126 3300005518 Bacteria 1282
61 Ga0070699_101148445 3300005518 Unclassified 712
62 Ga0070679_100328234 3300005530 Bacteria 1479
63 Ga0070684_100021431 3300005535 Bacteria 5378
64 Ga0070684_100499744 3300005535 Unclassified 1126
65 Ga0070697_100053421 3300005536 Unclassified 3284
66 Ga0070697_100137482 3300005536 Bacteria 2053
67 Ga0070697_100835638 3300005536 Bacteria 816
68 Ga0070672_100049967 3300005543 Bacteria 3256
69 Ga0070695_100100726 3300005545 Bacteria 1945
70 Ga0070696_100188785 3300005546 Bacteria 1533
71 Ga0070696_100249133 3300005546 Bacteria 1343
72 Ga0070693_100019705 3300005547 Bacteria 3543
73 Ga0070704_100010027 3300005549 Bacteria 5756
74 Ga0070704_100043578 3300005549 Bacteria 3112
75 Ga0070704_101167726 3300005549 Bacteria 701
76 Ga0068855_100127968 3300005563 Bacteria 2903
77 Ga0068855_100760361 3300005563 Bacteria 1033
78 Ga0070664_100023031 3300005564 Bacteria 5139
79 Ga0068857_100200974 3300005577 Bacteria 1817
80 Ga0068857_100418062 3300005577 Bacteria 1250
81 Ga0068854_101214576 3300005578 Bacteria 676
82 Ga0068856_100338981 3300005614 Bacteria 1521
83 Ga0068852_101242689 3300005616 Bacteria 766
84 Ga0068859_100187375 3300005617 Bacteria 2153
85 Ga0068864_100046225 3300005618 Bacteria 3735
86 Ga0068864_100799537 3300005618 Bacteria 927
87 Ga0068866_10338396 3300005718 Bacteria 952
88 Ga0068851_10102284 3300005834 Bacteria 1522
89 Ga0068870_10391577 3300005840 Bacteria 902
90 Ga0068870_10652597 3300005840 Bacteria 721
91 Ga0068863_101806534 3300005841 Bacteria 621
92 Ga0068862_100534614 3300005844 Unclassified 1117
93 Ga0081455_10102177 3300005937 Bacteria 2299
94 Ga0081455_10124398 3300005937 Bacteria 2026
95 Ga0081538_10000753 3300005981 Bacteria 35354
96 Ga0081539_10003044 3300005985 Bacteria 21682
97 Ga0070717_10040200 3300006028 Bacteria 3809
98 Ga0070717_10065609 3300006028 Bacteria 3018
99 Ga0070717_10377814 3300006028 Bacteria 1270
100 Ga0070717_11432830 3300006028 Bacteria 627
101 Ga0075365_10047548 3300006038 Bacteria 2820
102 Ga0075364_10252018 3300006051 Bacteria 1200
103 Ga0070712_100014247 3300006175 Bacteria 5103
104 Ga0070712_100016504 3300006175 Bacteria 4772
105 Ga0070712_100292496 3300006175 Bacteria 1315
106 Ga0075362_10197852 3300006177 Bacteria 977
107 Ga0075366_10169314 3300006195 Bacteria 1325
108 Ga0068871_100216848 3300006358 Bacteria 1657
109 Ga0068871_101146135 3300006358 Unclassified 728
110 Ga0068871_101695963 3300006358 Bacteria 599
111 Ga0075428_100236200 3300006844 Bacteria 1972
112 Ga0075430_100001206 3300006846 Bacteria 20786
113 Ga0075430_101368841 3300006846 Unclassified 582
114 Ga0075431_100059116 3300006847 Bacteria 3956
115 Ga0075431_101624089 3300006847 Bacteria 604
116 Ga0075433_10076593 3300006852 Bacteria 2945
117 Ga0075433_10294189 3300006852 Unclassified 1438
118 Ga0075434_100032255 3300006871 Bacteria 5165
119 Ga0075434_100101050 3300006871 Bacteria 2890
120 Ga0075429_100500693 3300006880 Bacteria 1065
121 Ga0075429_100996511 3300006880 Unclassified 732
122 Ga0068865_100255627 3300006881 Bacteria 1385
123 Ga0068865_101195602 3300006881 Bacteria 673
124 Ga0075436_100010868 3300006914 Bacteria 6247
125 Ga0097620_100187378 3300006931 Bacteria 2153
126 Ga0075435_100288693 3300007076 Bacteria 1401
127 Ga0075435_100809155 3300007076 Bacteria 816
128 Ga0099794_10496771 3300007265 Unclassified 642
129 Ga0111539_10008532 3300009094 Bacteria 13018
130 Ga0111539_10900457 3300009094 Bacteria 1029
131 Ga0111539_12518019 3300009094 Bacteria 597
132 Ga0105245_10027560 3300009098 Bacteria 5006
133 Ga0105245_10720392 3300009098 Bacteria 1032
134 Ga0105247_10221644 3300009101 Bacteria 1280
135 Ga0114129_10001824 3300009147 Bacteria 28997
136 Ga0114129_10088888 3300009147 Bacteria 4283
137 Ga0114129_10661794 3300009147 Bacteria 1347
138 Ga0114129_11108440 3300009147 Bacteria 990
139 Ga0114129_12735731 3300009147 Bacteria 587
140 Ga0105241_10169967 3300009174 Bacteria 1800
141 Ga0105248_10282021 3300009177 Bacteria 1870
142 Ga0105237_10873733 3300009545 Bacteria 906
143 Ga0105238_11349562 3300009551 Bacteria 740
144 Ga0105249_10077868 3300009553 Bacteria 3075
145 Ga0105239_10116229 3300010375 Bacteria 2968
146 Ga0105239_10981120 3300010375 Bacteria 971
147 Ga0105239_11073421 3300010375 Unclassified 927
148 Ga0105239_12831926 3300010375 Bacteria 566
149 Ga0157369_10010641 3300013105 Bacteria 10472
150 Ga0157369_10738904 3300013105 Bacteria 1013
151 Ga0157374_10221648 3300013296 Bacteria 1856
152 Ga0157378_10343544 3300013297 Bacteria 1456
153 Ga0157378_11753104 3300013297 Bacteria 669
154 Ga0163162_10088133 3300013306 Bacteria 3183
155 Ga0157375_10314854 3300013308 Bacteria 1729
156 Ga0157375_11222215 3300013308 Bacteria 882
157 Ga0163163_10287748 3300014325 Unclassified 1695
158 Ga0157380_10795346 3300014326 Bacteria 962
159 Ga0157379_10599442 3300014968 Bacteria 1028
160 Ga0157376_10021325 3300014969 Bacteria 5031
161 Ga0206353_10571991 3300020082 Bacteria 590
162 Ga0213874_10201416 3300021377 Bacteria 716
163 Ga0213876_10083530 3300021384 Bacteria 1689
164 Ga0213876_10338573 3300021384 Bacteria 800
165 Ga0207697_10007029 3300025315 Bacteria 5040
166 Ga0207692_10939618 3300025898 Bacteria 570
167 Ga0207710_10114120 3300025900 Bacteria 1285
168 Ga0207688_10002357 3300025901 Bacteria 10159
169 Ga0207688_10055316 3300025901 Bacteria 2227
170 Ga0207680_10701989 3300025903 Bacteria 725
171 Ga0207680_10717322 3300025903 Unclassified 717
172 Ga0207647_10003666 3300025904 Bacteria 11490
173 Ga0207685_10242020 3300025905 Bacteria 868
174 Ga0207699_10065949 3300025906 Bacteria 2196
175 Ga0207699_10083077 3300025906 Bacteria 1991
176 Ga0207645_10395091 3300025907 Bacteria 929
177 Ga0207643_10253135 3300025908 Bacteria 1085
178 Ga0207705_10775308 3300025909 Unclassified 745
179 Ga0207684_10932939 3300025910 Bacteria 728
180 Ga0207671_10721358 3300025914 Bacteria 792
181 Ga0207693_10006469 3300025915 Bacteria 9707
182 Ga0207693_10074934 3300025915 Bacteria 2650
183 Ga0207693_10699530 3300025915 Unclassified 785
184 Ga0207693_10895270 3300025915 Bacteria 681
185 Ga0207663_10054978 3300025916 Bacteria 2495
186 Ga0207663_11597219 3300025916 Bacteria 525
187 Ga0207660_11398775 3300025917 Bacteria 567
188 Ga0207657_10380818 3300025919 Bacteria 1111
189 Ga0207646_10392749 3300025922 Bacteria 1253
190 Ga0207650_10357673 3300025925 Unclassified 1202
191 Ga0207650_10416340 3300025925 Bacteria 1114
192 Ga0207650_10569492 3300025925 Bacteria 951
193 Ga0207659_10206358 3300025926 Bacteria 1572
194 Ga0207687_10063820 3300025927 Bacteria 2609
195 Ga0207700_10220977 3300025928 Bacteria 1606
196 Ga0207700_10424850 3300025928 Bacteria 1168
197 Ga0207644_10151139 3300025931 Bacteria 1797
198 Ga0207644_10406108 3300025931 Unclassified 1114
199 Ga0207690_10046315 3300025932 Bacteria 2879
200 Ga0207706_10082917 3300025933 Bacteria 2818
201 Ga0207706_10465120 3300025933 Bacteria 1093
202 Ga0207706_11162707 3300025933 Unclassified 642
203 Ga0207669_10399609 3300025937 Bacteria 1076
204 Ga0207704_10087889 3300025938 Bacteria 2031
205 Ga0207704_10208966 3300025938 Bacteria 1435
206 Ga0207665_10694436 3300025939 Bacteria 800
207 Ga0207691_10143232 3300025940 Bacteria 2105
208 Ga0207711_10373851 3300025941 Bacteria 1322
209 Ga0207711_10571234 3300025941 Bacteria 1055
210 Ga0207689_10299122 3300025942 Bacteria 1334
211 Ga0207661_10318172 3300025944 Bacteria 1398
212 Ga0207661_11621246 3300025944 Bacteria 592
213 Ga0207651_10652298 3300025960 Bacteria 924
214 Ga0207651_11996117 3300025960 Bacteria 521
215 Ga0207668_10584698 3300025972 Bacteria 971
216 Ga0207640_11212926 3300025981 Unclassified 671
217 Ga0207677_10130854 3300026023 Bacteria 1905
218 Ga0207677_10311727 3300026023 Bacteria 1304
219 Ga0207678_10116955 3300026067 Bacteria 2275
220 Ga0207708_10023235 3300026075 Bacteria 4684
221 Ga0207708_10258900 3300026075 Bacteria 1404
222 Ga0207708_10316679 3300026075 Bacteria 1272
223 Ga0207702_10158597 3300026078 Bacteria 2064
224 Ga0207648_10006142 3300026089 Bacteria 11972
225 Ga0207648_10418973 3300026089 Bacteria 1216
226 Ga0207676_10755604 3300026095 Bacteria 946
227 Ga0207674_10439883 3300026116 Bacteria 1260
228 Ga0207683_10689441 3300026121 Bacteria 947
229 Ga0207698_10418282 3300026142 Bacteria 1285
230 Ga0207698_10665803 3300026142 Bacteria 1033
231 Ga0209179_1105872 3300027512 Bacteria 627
232 Ga0209999_1048821 3300027543 Bacteria 798
233 Ga0209983_1050236 3300027665 Bacteria 912
234 Ga0209966_1032667 3300027695 Bacteria 1061
235 Ga0209998_10000544 3300027717 Bacteria 10177
236 Ga0207428_10007545 3300027907 Bacteria 9912
237 Ga0268266_10507926 3300028379 Unclassified 1151
238 Ga0268265_11263876 3300028380 Unclassified 737
239 Ga0307409_101145999 3300031995 Bacteria 800
240 Ga0307409_101696861 3300031995 Unclassified 660
241 Ga0307510_10011358 3300033180 Bacteria 10578
242 Ga0373936_0043914 3300035113 Unclassified 1797
243 Ga0373945_0165783 3300035116 Bacteria 903
244 Ga0373953_0276497 3300035117 Bacteria 732
245 Ga0373943_0461642 3300035170 Bacteria 739
246 Ga0373955_0391488 3300035172 Bacteria 844
247 Ga0373924_0458523 3300035410 Bacteria 572
248 Ga0373935_0694064 3300035692 Bacteria 748
249 Ga0373935_0766100 3300035692 Bacteria 712
250 Ga0373927_0011446 3300035695 Bacteria 5909
251 Ga0373947_0002204 3300035725 Bacteria 11798
252 Ga0373937_0264608 3300036401 Bacteria 1622
253 Ga0373937_2157198 3300036401 Bacteria 503
254 Ga0373925_0000803 3300037068 Bacteria 28924
255 Ga0395900_0089317 3300037418 Bacteria 3168
256 Ga0395900_0343860 3300037418 Bacteria 1467
257 Ga0395898_0042170 3300037466 Bacteria 4504
258 Ga0395898_0398289 3300037466 Bacteria 1313
259 Ga0395898_0596793 3300037466 Bacteria 1047
260 Ga0395898_0737520 3300037466 Bacteria 927
261 Ga0395905_0094501 3300037471 Bacteria 2805
262 Ga0436364_0120442 3300037853 Bacteria 861
263 Ga0436364_1308992 3300037853 Bacteria 699
264 Ga0395901_0015117 3300038443 Bacteria 7849
265 Ga0395901_0552318 3300038443 Bacteria 1167
266 Ga0395901_1156341 3300038443 Bacteria 742
267 Ga0436365_0285920 3300039437 Bacteria 2105
268 Ga0436365_0546011 3300039437 Bacteria 1630
269 Ga0436361_0340826 3300039447 Unclassified 1035
270 Ga0436361_0742128 3300039447 Unclassified 755
271 Ga0436363_1491478 3300039450 Unclassified 4701
272 Ga0436362_0379625 3300039453 Unclassified 1664
273 Ga0439441_089720 3300042001 Bacteria 678
274 Ga0439448_0071480 3300042005 Bacteria 1156
275 Ga0439460_0380949 3300042461 Unclassified 500
276 Ga0453684_0934156 3300044712 Bacteria 927
277 Ga0466957_0747524 3300044842 Bacteria 692
278 Ga0466960_0122207 3300044901 Bacteria 1365
279 Ga0451576_0015871 3300045051 Bacteria 8331
280 Ga0466958_0099254 3300045836 Unclassified 1809
281 Ga0466967_0229435 3300045976 Bacteria 1767
282 Ga0466967_2345814 3300045976 Bacteria 529
283 Ga0495592_0023211 3300046454 Bacteria 4719
284 Ga0495590_0218835 3300046457 Bacteria 703
285 Ga0495629_0551391 3300046459 Bacteria 774
286 Ga0495641_0020604 3300046461 Bacteria 3338
287 Ga0495651_0131419 3300046462 Bacteria 1827
288 Ga0495653_0207586 3300046463 Bacteria 1325
289 Ga0495650_0000063 3300046471 Bacteria 277841
290 Ga0495580_0217550 3300046472 Bacteria 1313
291 Ga0495585_0011766 3300046492 Bacteria 5170
292 Ga0495594_0003547 3300046499 Bacteria 8031
293 Ga0495596_0064057 3300046500 Bacteria 1430
294 Ga0495596_0119795 3300046500 Bacteria 1022
295 Ga0495608_0026439 3300046511 Bacteria 3957
296 Ga0495608_0118676 3300046511 Bacteria 1697
297 Ga0495618_0481827 3300046514 Bacteria 750
298 Ga0495628_0171672 3300046516 Bacteria 1644
299 Ga0495643_0337837 3300046522 Bacteria 677
300 Ga0495652_0054869 3300046529 Bacteria 3391
301 Ga0495587_0128608 3300046536 Bacteria 1448
302 Ga0495609_0018507 3300046538 Bacteria 3227
303 Ga0495621_0379335 3300046539 Bacteria 597
304 Ga0495667_0009597 3300046559 Bacteria 6561
305 Ga0495667_0328758 3300046559 Bacteria 967
306 Ga0495634_0350063 3300046642 Bacteria 885
307 Ga0495625_0006268 3300046660 Bacteria 10641
308 Ga0495669_0001127 3300046684 Bacteria 11073
309 Ga0495669_0432912 3300046684 Bacteria 638
310 Ga0495589_0178831 3300046794 Bacteria 1007
311 Ga0495589_0261849 3300046794 Bacteria 806
312 Ga0495600_0290262 3300046809 Bacteria 1034
313 Ga0495604_0152576 3300047317 Bacteria 1640
314 Ga0495604_0946186 3300047317 Bacteria 536
315 Ga0495636_0140807 3300047318 Bacteria 1077
316 Ga0495680_0089759 3300047322 Bacteria 2307
317 Ga0495683_0169320 3300047323 Bacteria 1005
318 Ga0495675_0209374 3300047444 Bacteria 1184
319 Ga0495686_0000011 3300047472 Bacteria 514750
320 Ga0495602_0235008 3300048088 Bacteria 1374
321 Ga0496100_0093867 3300048903 Unclassified 2054
322 Ga0496101_0131358 3300048904 Bacteria 1902
323 Ga0496101_0136916 3300048904 Bacteria 1864
324 Ga0496101_0254304 3300048904 Bacteria 1369
325 Ga0496101_0463609 3300048904 Bacteria 1000
326 Ga0496101_0500509 3300048904 Unclassified 960
327 Ga0496102_0040829 3300048905 Bacteria 4199
328 Ga0496102_0202110 3300048905 Bacteria 1873
329 Ga0496103_0240659 3300048906 Bacteria 1164
330 Ga0496104_0031419 3300048907 Bacteria 4938
331 Ga0496104_0337708 3300048907 Bacteria 1419
332 Ga0496104_0500904 3300048907 Bacteria 1126
333 Ga0496104_0802969 3300048907 Bacteria 847
334 Ga0496105_0058249 3300048908 Bacteria 3189
335 Ga0496105_0860303 3300048908 Unclassified 686
336 Ga0496106_0015405 3300048909 Bacteria 5659
337 Ga0496106_0021473 3300048909 Bacteria 4793
338 Ga0496107_0109206 3300048910 Bacteria 2032
339 Ga0496107_1351511 3300048910 Bacteria 508
340 Ga0496108_0191688 3300048911 Bacteria 1772
341 Ga0496108_0205231 3300048911 Bacteria 1710
342 Ga0496109_0008105 3300048912 Bacteria 8906
343 Ga0496109_0055688 3300048912 Bacteria 3607
344 Ga0496109_0159429 3300048912 Bacteria 2114
345 Ga0496109_0165566 3300048912 Bacteria 2072
346 Ga0496109_0206079 3300048912 Bacteria 1849
347 Ga0496110_0151586 3300048913 Bacteria 2099
348 Ga0496110_0429352 3300048913 Bacteria 1204
349 Ga0496110_0445658 3300048913 Bacteria 1180
350 Ga0496110_0732524 3300048913 Unclassified 891
351 Ga0496111_0110092 3300048914 Bacteria 2028
352 Ga0496112_0050739 3300048915 Bacteria 4069
353 Ga0496112_0197497 3300048915 Bacteria 1972
354 Ga0496112_0488449 3300048915 Bacteria 1167
355 Ga0496112_0936273 3300048915 Bacteria 788
356 Ga0496113_0010296 3300048916 Bacteria 6180
357 Ga0496113_0035760 3300048916 Bacteria 3635
358 Ga0496113_0055991 3300048916 Bacteria 2958
359 Ga0496113_0384996 3300048916 Bacteria 1126
360 Ga0496114_0065215 3300048917 Bacteria 3051
361 Ga0496115_0018210 3300048918 Bacteria 5388
362 Ga0496115_0022333 3300048918 Bacteria 4901
363 Ga0496115_0388673 3300048918 Bacteria 1133
364 Ga0496121_0002395 3300048924 Bacteria 28736
365 Ga0496126_0275950 3300048929 Bacteria 1394
366 Ga0501034_0016755 3300049571 Bacteria 7514
367 Ga0501042_0750826 3300049578 Bacteria 710
368 Ga0501207_045915 3300049654 Unclassified 770
369 nmdc:mga03683_148480_c1 3300050489 Bacteria 1057
370 nmdc:mga00v17_273356_c1 3300050491 Bacteria 1096
371 nmdc:mga0yw44_81203_c1 3300050492 Bacteria 2032
372 nmdc:mga0k408_276770_c1 3300050493 Bacteria 1002
373 nmdc:mga0k408_48164_c1 3300050493 Bacteria 2465
374 nmdc:mga06z11_192688_c1 3300050494 Bacteria 1181
375 nmdc:mga04h51_184863_c1 3300050495 Bacteria 813
376 nmdc:mga05p37_120873_c1 3300050507 Bacteria 3217
377 nmdc:mga05p37_339708_c1 3300050507 Bacteria 1771
378 nmdc:mga05p37_7678_c1 3300050507 Bacteria 12726
379 nmdc:mga05p37_864206_c1 3300050507 Bacteria 980
380 nmdc:mga09592_158201_c1 3300050508 Unclassified 1079
381 nmdc:mga09592_298342_c1 3300050508 Bacteria 1397
382 nmdc:mga0qj67_6235_c1 3300050509 Bacteria 8757
383 nmdc:mga06r32_116510_c1 3300050510 Bacteria 2632
384 nmdc:mga06r32_64171_c1 3300050510 Bacteria 3541
385 nmdc:mga08y16_4872_c1 3300050511 Bacteria 14018
386 nmdc:mga08y16_525347_c1 3300050511 Bacteria 1200
387 nmdc:mga0n895_444938_c1 3300050512 Bacteria 1309
388 nmdc:mga0n895_86895_c1 3300050512 Bacteria 3124
389 nmdc:mga0rr50_227692_c1 3300050513 Bacteria 1541
390 nmdc:mga08x19_159028_c1 3300050514 Bacteria 1534
391 nmdc:mga08x19_221443_c1 3300050514 Bacteria 1300
392 nmdc:mga0a205_17685_c1 3300050515 Bacteria 6691
393 nmdc:mga0a205_288743_c1 3300050515 Bacteria 1515
394 nmdc:mga0a205_675039_c1 3300050515 Unclassified 884
395 nmdc:mga0a205_98390_c1 3300050515 Bacteria 2824
396 Ga0495601_0434297 3300053077 Bacteria 850
397 Ga0495619_0043576 3300053085 Bacteria 2942
398 Ga0500645_000201 3300053730 Bacteria 46162
399 Ga0530510_0520722 3300061734 Bacteria 902
400 2585165628 2582581283 Bacteria 6030556
401 Ga0496103_0411752
402 JGI24743J22301_10071673
403 JGI24744J21845_10084527
404 JGI24751J29686_10109286
405 JGI25407J50210_10024930
406 Ga0065712_10283478
407 Ga0065712_10433923
408 Ga0065715_10159782
409 Ga0065715_10345721
410 Ga0070658_10948453
411 Ga0070676_10431480
412 Ga0070683_100447807
413 Ga0070670_100250905
414 Ga0070670_100684671
415 Ga0070666_10810662
416 Ga0070680_101555844
417 Ga0070682_100068966
418 Ga0068868_100022858
419 Ga0068868_100407969
420 Ga0068868_100519608
421 Ga0070660_100386912
422 Ga0070692_11225644
423 Ga0070668_100229878
424 Ga0070675_100221420
425 Ga0070675_100342886
426 Ga0070671_100168000
427 Ga0070671_100438251
428 Ga0070674_100746299
429 Ga0070673_101714934
430 Ga0070688_101318273
431 Ga0070659_100111685
432 Ga0070659_100877313
433 Ga0070667_100414764
434 Ga0070667_101028233
435 Ga0070709_10222780
436 Ga0070709_10339776
437 Ga0070714_100021451
438 Ga0070714_100269953
439 Ga0070713_100184186
440 Ga0070713_102269495
441 Ga0070710_10189996
442 Ga0070711_100063458
443 Ga0070711_100080726
444 Ga0070705_100272703
445 Ga0070705_100277851
446 Ga0070700_100004519
447 Ga0070700_100308493
448 Ga0070694_100024259
449 Ga0070694_100316523
450 Ga0070663_101050432
451 Ga0070678_100104014
452 Ga0070678_100649940
453 Ga0070662_100248052
454 Ga0070662_100628428
455 Ga0070681_10165661
456 Ga0068867_100857310
457 Ga0070685_10280146
458 Ga0070698_100008172
459 Ga0070699_100158837
460 Ga0070699_100376126
461 Ga0070699_101148445
462 Ga0070679_100328234
463 Ga0070684_100021431
464 Ga0070684_100499744
465 Ga0070697_100053421
466 Ga0070697_100137482
467 Ga0070697_100835638
468 Ga0070672_100049967
469 Ga0070695_100100726
470 Ga0070696_100188785
471 Ga0070696_100249133
472 Ga0070693_100019705
473 Ga0070704_100010027
474 Ga0070704_100043578
475 Ga0070704_101167726
476 Ga0068855_100127968
477 Ga0068855_100760361
478 Ga0070664_100023031
479 Ga0068857_100200974
480 Ga0068857_100418062
481 Ga0068854_101214576
482 Ga0068856_100338981
483 Ga0068852_101242689
484 Ga0068859_100187375
485 Ga0068864_100046225
486 Ga0068864_100799537
487 Ga0068866_10338396
488 Ga0068851_10102284
489 Ga0068870_10391577
490 Ga0068870_10652597
491 Ga0068863_101806534
492 Ga0068862_100534614
493 Ga0081455_10102177
494 Ga0081455_10124398
495 Ga0081538_10000753
496 Ga0081539_10003044
497 Ga0070717_10040200
498 Ga0070717_10065609
499 Ga0070717_10377814
500 Ga0070717_11432830
501 Ga0075365_10047548
502 Ga0075364_10252018
503 Ga0070712_100014247
504 Ga0070712_100016504
505 Ga0070712_100292496
506 Ga0075362_10197852
507 Ga0075366_10169314
508 Ga0068871_100216848
509 Ga0068871_101146135
510 Ga0068871_101695963
511 Ga0075428_100236200
512 Ga0075430_100001206
513 Ga0075430_101368841
514 Ga0075431_100059116
515 Ga0075431_101624089
516 Ga0075433_10076593
517 Ga0075433_10294189
518 Ga0075434_100032255
519 Ga0075434_100101050
520 Ga0075429_100500693
521 Ga0075429_100996511
522 Ga0068865_100255627
523 Ga0068865_101195602
524 Ga0075436_100010868
525 Ga0097620_100187378
526 Ga0075435_100288693
527 Ga0075435_100809155
528 Ga0099794_10496771
529 Ga0111539_10008532
530 Ga0111539_10900457
531 Ga0111539_12518019
532 Ga0105245_10027560
533 Ga0105245_10720392
534 Ga0105247_10221644
535 Ga0114129_10001824
536 Ga0114129_10088888
537 Ga0114129_10661794
538 Ga0114129_11108440
539 Ga0114129_12735731
540 Ga0105241_10169967
541 Ga0105248_10282021
542 Ga0105237_10873733
543 Ga0105238_11349562
544 Ga0105249_10077868
545 Ga0105239_10116229
546 Ga0105239_10981120
547 Ga0105239_11073421
548 Ga0105239_12831926
549 Ga0157369_10010641
550 Ga0157369_10738904
551 Ga0157374_10221648
552 Ga0157378_10343544
553 Ga0157378_11753104
554 Ga0163162_10088133
555 Ga0157375_10314854
556 Ga0157375_11222215
557 Ga0163163_10287748
558 Ga0157380_10795346
559 Ga0157379_10599442
560 Ga0157376_10021325
561 Ga0206353_10571991
562 Ga0213874_10201416
563 Ga0213876_10083530
564 Ga0213876_10338573
565 Ga0207697_10007029
566 Ga0207692_10939618
567 Ga0207710_10114120
568 Ga0207688_10002357
569 Ga0207688_10055316
570 Ga0207680_10701989
571 Ga0207680_10717322
572 Ga0207647_10003666
573 Ga0207685_10242020
574 Ga0207699_10065949
575 Ga0207699_10083077
576 Ga0207645_10395091
577 Ga0207643_10253135
578 Ga0207705_10775308
579 Ga0207684_10932939
580 Ga0207671_10721358
581 Ga0207693_10006469
582 Ga0207693_10074934
583 Ga0207693_10699530
584 Ga0207693_10895270
585 Ga0207663_10054978
586 Ga0207663_11597219
587 Ga0207660_11398775
588 Ga0207657_10380818
589 Ga0207646_10392749
590 Ga0207650_10357673
591 Ga0207650_10416340
592 Ga0207650_10569492
593 Ga0207659_10206358
594 Ga0207687_10063820
595 Ga0207700_10220977
596 Ga0207700_10424850
597 Ga0207644_10151139
598 Ga0207644_10406108
599 Ga0207690_10046315
600 Ga0207706_10082917
601 Ga0207706_10465120
602 Ga0207706_11162707
603 Ga0207669_10399609
604 Ga0207704_10087889
605 Ga0207704_10208966
606 Ga0207665_10694436
607 Ga0207691_10143232
608 Ga0207711_10373851
609 Ga0207711_10571234
610 Ga0207689_10299122
611 Ga0207661_10318172
612 Ga0207661_11621246
613 Ga0207651_10652298
614 Ga0207651_11996117
615 Ga0207668_10584698
616 Ga0207640_11212926
617 Ga0207677_10130854
618 Ga0207677_10311727
619 Ga0207678_10116955
620 Ga0207708_10023235
621 Ga0207708_10258900
622 Ga0207708_10316679
623 Ga0207702_10158597
624 Ga0207648_10006142
625 Ga0207648_10418973
626 Ga0207676_10755604
627 Ga0207674_10439883
628 Ga0207683_10689441
629 Ga0207698_10418282
630 Ga0207698_10665803
631 Ga0209179_1105872
632 Ga0209999_1048821
633 Ga0209983_1050236
634 Ga0209966_1032667
635 Ga0209998_10000544
636 Ga0207428_10007545
637 Ga0268266_10507926
638 Ga0268265_11263876
639 Ga0307409_101145999
640 Ga0307409_101696861
641 Ga0307510_10011358
642 Ga0373936_0043914
643 Ga0373945_0165783
644 Ga0373953_0276497
645 Ga0373943_0461642
646 Ga0373955_0391488
647 Ga0373924_0458523
648 Ga0373935_0694064
649 Ga0373935_0766100
650 Ga0373927_0011446
651 Ga0373947_0002204
652 Ga0373937_0264608
653 Ga0373937_2157198
654 Ga0373925_0000803
655 Ga0395900_0089317
656 Ga0395900_0343860
657 Ga0395898_0042170
658 Ga0395898_0398289
659 Ga0395898_0596793
660 Ga0395898_0737520
661 Ga0395905_0094501
662 Ga0436364_0120442
663 Ga0436364_1308992
664 Ga0395901_0015117
665 Ga0395901_0552318
666 Ga0395901_1156341
667 Ga0436365_0285920
668 Ga0436365_0546011
669 Ga0436361_0340826
670 Ga0436361_0742128
671 Ga0436363_1491478
672 Ga0436362_0379625
673 Ga0439441_089720
674 Ga0439448_0071480
675 Ga0439460_0380949
676 Ga0453684_0934156
677 Ga0466957_0747524
678 Ga0466960_0122207
679 Ga0451576_0015871
680 Ga0466958_0099254
681 Ga0466967_0229435
682 Ga0466967_2345814
683 Ga0495592_0023211
684 Ga0495590_0218835
685 Ga0495629_0551391
686 Ga0495641_0020604
687 Ga0495651_0131419
688 Ga0495653_0207586
689 Ga0495650_0000063
690 Ga0495580_0217550
691 Ga0495585_0011766
692 Ga0495594_0003547
693 Ga0495596_0064057
694 Ga0495596_0119795
695 Ga0495608_0026439
696 Ga0495608_0118676
697 Ga0495618_0481827
698 Ga0495628_0171672
699 Ga0495643_0337837
700 Ga0495652_0054869
701 Ga0495587_0128608
702 Ga0495609_0018507
703 Ga0495621_0379335
704 Ga0495667_0009597
705 Ga0495667_0328758
706 Ga0495634_0350063
707 Ga0495625_0006268
708 Ga0495669_0001127
709 Ga0495669_0432912
710 Ga0495589_0178831
711 Ga0495589_0261849
712 Ga0495600_0290262
713 Ga0495604_0152576
714 Ga0495604_0946186
715 Ga0495636_0140807
716 Ga0495680_0089759
717 Ga0495683_0169320
718 Ga0495675_0209374
719 Ga0495686_0000011
720 Ga0495602_0235008
721 Ga0496100_0093867
722 Ga0496101_0131358
723 Ga0496101_0136916
724 Ga0496101_0254304
725 Ga0496101_0463609
726 Ga0496101_0500509
727 Ga0496102_0040829
728 Ga0496102_0202110
729 Ga0496103_0240659
730 Ga0496104_0031419
731 Ga0496104_0337708
732 Ga0496104_0500904
733 Ga0496104_0802969
734 Ga0496105_0058249
735 Ga0496105_0860303
736 Ga0496106_0015405
737 Ga0496106_0021473
738 Ga0496107_0109206
739 Ga0496107_1351511
740 Ga0496108_0191688
741 Ga0496108_0205231
742 Ga0496109_0008105
743 Ga0496109_0055688
744 Ga0496109_0159429
745 Ga0496109_0165566
746 Ga0496109_0206079
747 Ga0496110_0151586
748 Ga0496110_0429352
749 Ga0496110_0445658
750 Ga0496110_0732524
751 Ga0496111_0110092
752 Ga0496112_0050739
753 Ga0496112_0197497
754 Ga0496112_0488449
755 Ga0496112_0936273
756 Ga0496113_0010296
757 Ga0496113_0035760
758 Ga0496113_0055991
759 Ga0496113_0384996
760 Ga0496114_0065215
761 Ga0496115_0018210
762 Ga0496115_0022333
763 Ga0496115_0388673
764 Ga0496121_0002395
765 Ga0496126_0275950
766 Ga0501034_0016755
767 Ga0501042_0750826
768 Ga0501207_045915
769 nmdc:mga03683_148480_c1
770 nmdc:mga00v17_273356_c1
771 nmdc:mga0yw44_81203_c1
772 nmdc:mga0k408_276770_c1
773 nmdc:mga0k408_48164_c1
774 nmdc:mga06z11_192688_c1
775 nmdc:mga04h51_184863_c1
776 nmdc:mga05p37_120873_c1
777 nmdc:mga05p37_339708_c1
778 nmdc:mga05p37_7678_c1
779 nmdc:mga05p37_864206_c1
780 nmdc:mga09592_158201_c1
781 nmdc:mga09592_298342_c1
782 nmdc:mga0qj67_6235_c1
783 nmdc:mga06r32_116510_c1
784 nmdc:mga06r32_64171_c1
785 nmdc:mga08y16_4872_c1
786 nmdc:mga08y16_525347_c1
787 nmdc:mga0n895_444938_c1
788 nmdc:mga0n895_86895_c1
789 nmdc:mga0rr50_227692_c1
790 nmdc:mga08x19_159028_c1
791 nmdc:mga08x19_221443_c1
792 nmdc:mga0a205_17685_c1
793 nmdc:mga0a205_288743_c1
794 nmdc:mga0a205_675039_c1
795 nmdc:mga0a205_98390_c1
796 Ga0495601_0434297
797 Ga0495619_0043576
798 Ga0500645_000201
799 Ga0530510_0520722
800 2585165628

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00376

MerR

MerR family regulatory protein

6

43

0.98

PF09278

MerR-DNA-bind

MerR, DNA binding

48

113

0.97

PF13411

MerR_1

MerR HTH family regulatory protein

5

74

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r24-assembly1.cif.gz_B complete dissection of b. subtilis nitrogen homeostatic circuitry 0.9403 2 72
7tea-assembly2.cif.gz_C crystal structure of s. aureus glnr-dna complex 0.9254 2 71
6v9p-assembly1.cif.gz_A crystal structure of the transposition protein tniq 0.9201 5 32
7tec-assembly1.cif.gz_A-2 structure of the listeria monocytogenes glnr-dna complex to 3.45 angstrom 0.9113 5 65
2dg6-assembly1.cif.gz_A-2 crystal structure of the putative transcriptional regulator sco5550 from streptomyces coelicolor a3(2) 0.9048 5 70
ID Description Score Start End Superfamily
4r22B00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9345 2 72 1.10.1660.10
af_O06302_4_79_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9126 2 66 1.10.1660.10
3hh0D01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9104 4 68 1.10.1660.10
3hh0C01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.908 4 73 1.10.1660.10
af_P33358_1_73_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9012 1 73 1.10.1660.10
ID Description Score Start End GO Terms
AF-A0A530M347-F1-model_v4 MerR family transcriptional regulator 1.003 4 70 GO:0003677
GO:0003700
AF-A0A141RI41-F1-model_v4 SoxR 0.9923 3 75 GO:0003677
GO:0003700
GO:0006979
GO:0051537
AF-A0A127SKU8-F1-model_v4 SoxR 0.9857 1 74 GO:0003677
GO:0003700
GO:0006979
GO:0051537
AF-A0A528CR43-F1-model_v4 Redox-sensitive transcriptional activator SoxR 0.9801 4 79 GO:0003677
GO:0003700
GO:0006979
GO:0051537
AF-A0A1U7P3C5-F1-model_v4 Redox-sensitive transcriptional activator SoxR 0.9591 2 109 GO:0003677
GO:0003700
GO:0006979
GO:0051537

Map