F434673
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 400 | 230 | 800 | 528 |
Family's Representative Sequence
| Representative Sequence | 3300048905|Ga0496102_0034380|Ga0496102_0034380_738_2426 |
| Length | 562 |
| Sequence | VTGDVRWATTGERRIDPPLAWAFSLRFRKENAMPAAPDFPAAPYRAPIRRALISVSDKTGLVEAAKALAAMGVELVSTGGTRKAIADAGLSVKDISDLTGFPEMMDGRVKTLHPVVHGGLLGVRDAPEHKAAMDAHGIGPIDLVYVNLYPFEATVASGADYATAVENIDIGGPAMIRSAAKNHGYVAVCTEIADLEEVLAELQADGTTSLDLRKRLAARAYGRTAAYDAAISGWFAKALGEEAPRRRAFAGELVQTMRYGENPHQQASFYRFAGPRTGVATAKQLQGKELSYNNINDTDAAYELIAEFDPAAAPACAIIKHANPCGLATGGSLLEAYERALACDPVSAFGGIVALNSRLDAATAAKVLETFTEVVIAPDADEDAVALFRKKKNVRLLTTGGLPDPNEPGDTFRSVAGGFLVQSRDTARLTAADLKVVTARAPTEAEIRDMLFAFTVAKHVKSNAIVYAKAGQTLGIGAGQMNRKDSARIAALRAADFGLDLTGSACASEAFFPFPDGLLQAADAGCTAVIQPGGSIGDEKVIEAANDRGLAMVFTGVRVFRH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 2 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 3 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 4 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 40 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 41 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 42 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 57 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 58 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 59 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 60 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 61 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 65 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 101 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 102 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 103 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 104 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 105 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 106 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 107 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 108 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 109 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 110 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 111 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 112 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 113 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 114 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 115 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 116 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 117 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 118 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 119 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 120 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 121 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 122 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 123 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 124 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 125 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 126 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 127 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 157 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 158 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 160 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 161 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 162 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 163 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 164 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 170 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 172 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 174 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 175 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 176 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 177 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 178 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 179 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 180 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 181 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 182 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 183 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 184 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 185 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 186 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 187 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 188 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 189 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 190 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 191 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 192 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 193 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 194 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 195 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 196 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 197 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 198 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 199 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 200 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 201 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 202 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 203 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 204 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 205 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 206 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 207 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 208 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 209 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 210 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 211 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 212 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 213 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 214 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 215 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 216 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 217 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 218 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 219 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 220 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 221 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 222 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 223 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 224 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 225 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 226 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 227 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 228 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 229 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 230 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.75 |
| Metatranscriptomes | 0 |
| Isolates | 8.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17 |
| Nodule | 0.25 |
| Rhizoplane | 2.75 |
| Rhizosphere | 69.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496102_0034380 | 3300048905 | Bacteria | 4558 |
| 2 | Ga0055536_1000369 | 3300003781 | Bacteria | 33441 |
| 3 | Ga0055536_1000494 | 3300003781 | Bacteria | 27289 |
| 4 | Ga0055530_10001413 | 3300003791 | Bacteria | 17642 |
| 5 | Ga0055530_10012881 | 3300003791 | Bacteria | 2889 |
| 6 | Ga0055531_10000751 | 3300003794 | Bacteria | 27289 |
| 7 | Ga0055531_10003526 | 3300003794 | Bacteria | 9948 |
| 8 | Ga0055531_10004053 | 3300003794 | Bacteria | 9080 |
| 9 | Ga0065165_1000517 | 3300005262 | Bacteria | 59268 |
| 10 | Ga0065165_1001142 | 3300005262 | Bacteria | 31092 |
| 11 | Ga0070658_10023589 | 3300005327 | Bacteria | 4937 |
| 12 | Ga0070658_10059561 | 3300005327 | Bacteria | 3109 |
| 13 | Ga0070658_10106962 | 3300005327 | Bacteria | 2314 |
| 14 | Ga0070658_10132288 | 3300005327 | Bacteria | 2079 |
| 15 | Ga0070683_100000011 | 3300005329 | Bacteria | 283682 |
| 16 | Ga0070670_100000004 | 3300005331 | Bacteria | 392110 |
| 17 | Ga0070670_100030892 | 3300005331 | Bacteria | 4613 |
| 18 | Ga0070670_100038267 | 3300005331 | Bacteria | 4125 |
| 19 | Ga0070670_100052073 | 3300005331 | Bacteria | 3516 |
| 20 | Ga0070666_10016751 | 3300005335 | Bacteria | 4692 |
| 21 | Ga0070691_10059790 | 3300005341 | Bacteria | 1832 |
| 22 | Ga0070668_100001643 | 3300005347 | Bacteria | 16208 |
| 23 | Ga0070668_100003294 | 3300005347 | Bacteria | 11919 |
| 24 | Ga0070668_100020129 | 3300005347 | Bacteria | 5031 |
| 25 | Ga0070668_100042047 | 3300005347 | Bacteria | 3502 |
| 26 | Ga0070669_100002041 | 3300005353 | Bacteria | 14610 |
| 27 | Ga0070669_100072936 | 3300005353 | Bacteria | 2543 |
| 28 | Ga0070671_100002143 | 3300005355 | Bacteria | 15242 |
| 29 | Ga0070671_100093133 | 3300005355 | Bacteria | 2525 |
| 30 | Ga0070673_100049236 | 3300005364 | Bacteria | 3290 |
| 31 | Ga0070659_100000194 | 3300005366 | Bacteria | 46646 |
| 32 | Ga0070659_100001256 | 3300005366 | Bacteria | 18409 |
| 33 | Ga0070659_100012303 | 3300005366 | Bacteria | 6344 |
| 34 | Ga0070667_100000105 | 3300005367 | Bacteria | 106633 |
| 35 | Ga0070667_100002569 | 3300005367 | Bacteria | 15778 |
| 36 | Ga0070709_10004365 | 3300005434 | Bacteria | 7623 |
| 37 | Ga0070713_100006911 | 3300005436 | Bacteria | 7920 |
| 38 | Ga0070713_100014122 | 3300005436 | Bacteria | 5917 |
| 39 | Ga0070713_100032659 | 3300005436 | Bacteria | 4160 |
| 40 | Ga0070713_100046891 | 3300005436 | Bacteria | 3548 |
| 41 | Ga0070678_100103370 | 3300005456 | Bacteria | 2213 |
| 42 | Ga0070662_100031038 | 3300005457 | Bacteria | 3746 |
| 43 | Ga0070681_10002130 | 3300005458 | Bacteria | 17987 |
| 44 | Ga0070681_10003526 | 3300005458 | Bacteria | 14658 |
| 45 | Ga0070681_10028150 | 3300005458 | Bacteria | 5650 |
| 46 | Ga0070681_10039760 | 3300005458 | Bacteria | 4715 |
| 47 | Ga0068867_100022158 | 3300005459 | Bacteria | 4539 |
| 48 | Ga0068867_100105489 | 3300005459 | Bacteria | 2158 |
| 49 | Ga0070698_100005047 | 3300005471 | Bacteria | 14468 |
| 50 | Ga0070679_100003845 | 3300005530 | Bacteria | 13794 |
| 51 | Ga0070679_100008098 | 3300005530 | Bacteria | 9875 |
| 52 | Ga0070679_100179564 | 3300005530 | Bacteria | 2089 |
| 53 | Ga0070684_100000001 | 3300005535 | Bacteria | 300240 |
| 54 | Ga0070697_100038304 | 3300005536 | Bacteria | 3873 |
| 55 | Ga0068853_100000181 | 3300005539 | Bacteria | 44176 |
| 56 | Ga0068853_100032230 | 3300005539 | Bacteria | 4438 |
| 57 | Ga0070695_100023951 | 3300005545 | Bacteria | 3758 |
| 58 | Ga0070665_100000198 | 3300005548 | Bacteria | 105999 |
| 59 | Ga0070665_100000945 | 3300005548 | Bacteria | 37054 |
| 60 | Ga0070665_100001194 | 3300005548 | Bacteria | 31673 |
| 61 | Ga0068855_100014921 | 3300005563 | Bacteria | 9361 |
| 62 | Ga0068855_100021851 | 3300005563 | Bacteria | 7672 |
| 63 | Ga0068855_100046675 | 3300005563 | Bacteria | 5120 |
| 64 | Ga0068855_100093270 | 3300005563 | Bacteria | 3472 |
| 65 | Ga0068859_100004686 | 3300005617 | Bacteria | 13922 |
| 66 | Ga0068859_100019578 | 3300005617 | Bacteria | 6799 |
| 67 | Ga0068859_100208555 | 3300005617 | Bacteria | 2040 |
| 68 | Ga0068864_100000106 | 3300005618 | Bacteria | 81202 |
| 69 | Ga0068864_100001229 | 3300005618 | Bacteria | 21305 |
| 70 | Ga0068863_100000079 | 3300005841 | Bacteria | 107383 |
| 71 | Ga0068863_100000560 | 3300005841 | Bacteria | 37696 |
| 72 | Ga0068863_100001315 | 3300005841 | Bacteria | 24750 |
| 73 | Ga0068863_100074002 | 3300005841 | Bacteria | 3222 |
| 74 | Ga0068858_100000006 | 3300005842 | Bacteria | 256011 |
| 75 | Ga0068858_100005137 | 3300005842 | Bacteria | 12825 |
| 76 | Ga0068858_100025372 | 3300005842 | Bacteria | 5515 |
| 77 | Ga0068860_100000077 | 3300005843 | Bacteria | 171297 |
| 78 | Ga0068860_100095460 | 3300005843 | Bacteria | 2834 |
| 79 | Ga0068862_100000457 | 3300005844 | Bacteria | 44218 |
| 80 | Ga0068862_100043503 | 3300005844 | Bacteria | 3830 |
| 81 | Ga0068862_100097040 | 3300005844 | Bacteria | 2573 |
| 82 | Ga0070717_10001590 | 3300006028 | Bacteria | 15704 |
| 83 | Ga0070717_10015966 | 3300006028 | Bacteria | 5813 |
| 84 | Ga0097621_100092515 | 3300006237 | Bacteria | 2533 |
| 85 | Ga0075370_10003673 | 3300006353 | Bacteria | 7344 |
| 86 | Ga0075370_10034037 | 3300006353 | Bacteria | 2855 |
| 87 | Ga0068865_100001549 | 3300006881 | Bacteria | 13417 |
| 88 | Ga0075436_100008736 | 3300006914 | Bacteria | 6928 |
| 89 | Ga0097620_100004686 | 3300006931 | Bacteria | 13922 |
| 90 | Ga0097620_100019577 | 3300006931 | Bacteria | 6799 |
| 91 | Ga0097620_100208585 | 3300006931 | Bacteria | 2040 |
| 92 | Ga0105240_10000428 | 3300009093 | Bacteria | 77995 |
| 93 | Ga0105240_10001788 | 3300009093 | Bacteria | 36269 |
| 94 | Ga0105240_10004170 | 3300009093 | Bacteria | 22153 |
| 95 | Ga0105240_10080198 | 3300009093 | Bacteria | 4015 |
| 96 | Ga0105240_10132283 | 3300009093 | Bacteria | 2991 |
| 97 | Ga0105240_10201240 | 3300009093 | Bacteria | 2334 |
| 98 | Ga0105247_10014901 | 3300009101 | Bacteria | 4661 |
| 99 | Ga0105241_10067261 | 3300009174 | Bacteria | 2773 |
| 100 | Ga0105248_10000789 | 3300009177 | Bacteria | 35531 |
| 101 | Ga0105248_10027317 | 3300009177 | Bacteria | 6352 |
| 102 | Ga0105248_10143558 | 3300009177 | Bacteria | 2693 |
| 103 | Ga0105248_10243525 | 3300009177 | Bacteria | 2024 |
| 104 | Ga0105237_10004992 | 3300009545 | Bacteria | 15119 |
| 105 | Ga0105238_10159484 | 3300009551 | Bacteria | 2231 |
| 106 | Ga0105249_10012483 | 3300009553 | Bacteria | 7489 |
| 107 | Ga0105249_10230308 | 3300009553 | Bacteria | 1827 |
| 108 | Ga0105246_10094383 | 3300011119 | Bacteria | 2164 |
| 109 | Ga0157373_10000445 | 3300013100 | Bacteria | 32823 |
| 110 | Ga0157373_10004662 | 3300013100 | Bacteria | 10320 |
| 111 | Ga0157370_10170004 | 3300013104 | Bacteria | 2026 |
| 112 | Ga0163162_10076950 | 3300013306 | Bacteria | 3399 |
| 113 | Ga0157372_10112071 | 3300013307 | Bacteria | 3126 |
| 114 | Ga0163163_10001844 | 3300014325 | Bacteria | 17889 |
| 115 | Ga0213876_10000236 | 3300021384 | Bacteria | 53620 |
| 116 | Ga0213876_10000241 | 3300021384 | Bacteria | 52167 |
| 117 | Ga0213875_10003047 | 3300021388 | Bacteria | 9697 |
| 118 | Ga0209026_1003417 | 3300025250 | Bacteria | 5219 |
| 119 | Ga0209565_1000513 | 3300025263 | Bacteria | 27885 |
| 120 | Ga0209673_1001161 | 3300025273 | Bacteria | 28708 |
| 121 | Ga0209676_1000376 | 3300025292 | Bacteria | 82203 |
| 122 | Ga0209676_1001218 | 3300025292 | Bacteria | 27313 |
| 123 | Ga0209758_1000238 | 3300025297 | Bacteria | 115807 |
| 124 | Ga0209758_1002064 | 3300025297 | Bacteria | 21447 |
| 125 | Ga0209758_1007210 | 3300025297 | Bacteria | 7654 |
| 126 | Ga0209050_1000073 | 3300025298 | Bacteria | 292046 |
| 127 | Ga0209050_1000705 | 3300025298 | Bacteria | 49555 |
| 128 | Ga0209050_1002131 | 3300025298 | Bacteria | 18032 |
| 129 | Ga0209256_1001100 | 3300025299 | Bacteria | 31096 |
| 130 | Ga0209051_1021018 | 3300025303 | Bacteria | 2792 |
| 131 | Ga0209257_1000036 | 3300025304 | Bacteria | 616006 |
| 132 | Ga0209257_1000282 | 3300025304 | Bacteria | 113789 |
| 133 | Ga0209257_1001052 | 3300025304 | Bacteria | 36631 |
| 134 | Ga0207705_10002222 | 3300025909 | Bacteria | 14985 |
| 135 | Ga0207707_10010946 | 3300025912 | Bacteria | 7889 |
| 136 | Ga0207707_10013221 | 3300025912 | Bacteria | 7193 |
| 137 | Ga0207707_10077724 | 3300025912 | Bacteria | 2897 |
| 138 | Ga0207695_10000269 | 3300025913 | Bacteria | 130183 |
| 139 | Ga0207695_10002257 | 3300025913 | Bacteria | 28858 |
| 140 | Ga0207695_10004248 | 3300025913 | Bacteria | 19681 |
| 141 | Ga0207695_10013630 | 3300025913 | Bacteria | 9681 |
| 142 | Ga0207695_10026957 | 3300025913 | Bacteria | 6405 |
| 143 | Ga0207693_10000447 | 3300025915 | Bacteria | 37791 |
| 144 | Ga0207693_10049093 | 3300025915 | Bacteria | 3314 |
| 145 | Ga0207693_10114789 | 3300025915 | Bacteria | 2114 |
| 146 | Ga0207660_10005931 | 3300025917 | Bacteria | 7933 |
| 147 | Ga0207657_10001390 | 3300025919 | Bacteria | 25814 |
| 148 | Ga0207657_10034990 | 3300025919 | Bacteria | 4508 |
| 149 | Ga0207652_10028995 | 3300025921 | Bacteria | 4622 |
| 150 | Ga0207681_10003653 | 3300025923 | Bacteria | 9568 |
| 151 | Ga0207694_10078425 | 3300025924 | Bacteria | 2589 |
| 152 | Ga0207694_10129795 | 3300025924 | Bacteria | 2019 |
| 153 | Ga0207650_10000033 | 3300025925 | Bacteria | 226809 |
| 154 | Ga0207650_10043419 | 3300025925 | Bacteria | 3300 |
| 155 | Ga0207700_10007668 | 3300025928 | Bacteria | 6625 |
| 156 | Ga0207700_10035558 | 3300025928 | Bacteria | 3589 |
| 157 | Ga0207664_10006141 | 3300025929 | Bacteria | 8234 |
| 158 | Ga0207664_10056825 | 3300025929 | Bacteria | 3109 |
| 159 | Ga0207664_10066044 | 3300025929 | Bacteria | 2898 |
| 160 | Ga0207644_10000907 | 3300025931 | Bacteria | 18778 |
| 161 | Ga0207690_10000031 | 3300025932 | Bacteria | 154724 |
| 162 | Ga0207704_10040215 | 3300025938 | Bacteria | 2730 |
| 163 | Ga0207711_10000368 | 3300025941 | Bacteria | 47898 |
| 164 | Ga0207711_10004051 | 3300025941 | Bacteria | 12576 |
| 165 | Ga0207711_10061561 | 3300025941 | Bacteria | 3237 |
| 166 | Ga0207711_10149094 | 3300025941 | Bacteria | 2109 |
| 167 | Ga0207661_10000016 | 3300025944 | Bacteria | 305159 |
| 168 | Ga0207679_10094195 | 3300025945 | Bacteria | 2325 |
| 169 | Ga0207667_10014012 | 3300025949 | Bacteria | 9153 |
| 170 | Ga0207667_10016074 | 3300025949 | Bacteria | 8471 |
| 171 | Ga0207667_10060297 | 3300025949 | Bacteria | 3971 |
| 172 | Ga0207667_10082841 | 3300025949 | Bacteria | 3322 |
| 173 | Ga0207667_10138566 | 3300025949 | Bacteria | 2505 |
| 174 | Ga0207712_10013541 | 3300025961 | Bacteria | 5229 |
| 175 | Ga0207712_10161413 | 3300025961 | Bacteria | 1742 |
| 176 | Ga0207668_10000004 | 3300025972 | Bacteria | 201204 |
| 177 | Ga0207668_10000426 | 3300025972 | Bacteria | 26589 |
| 178 | Ga0207668_10009650 | 3300025972 | Bacteria | 5794 |
| 179 | Ga0207668_10012917 | 3300025972 | Bacteria | 5128 |
| 180 | Ga0207668_10021418 | 3300025972 | Bacteria | 4122 |
| 181 | Ga0207658_10000628 | 3300025986 | Bacteria | 31184 |
| 182 | Ga0207658_10010586 | 3300025986 | Bacteria | 6267 |
| 183 | Ga0207703_10000027 | 3300026035 | Bacteria | 209608 |
| 184 | Ga0207703_10001739 | 3300026035 | Bacteria | 19550 |
| 185 | Ga0207703_10017915 | 3300026035 | Bacteria | 5531 |
| 186 | Ga0207703_10048621 | 3300026035 | Bacteria | 3425 |
| 187 | Ga0207639_10076932 | 3300026041 | Bacteria | 2629 |
| 188 | Ga0207708_10000475 | 3300026075 | Bacteria | 31007 |
| 189 | Ga0207702_10032916 | 3300026078 | Bacteria | 4327 |
| 190 | Ga0207641_10000003 | 3300026088 | Bacteria | 496984 |
| 191 | Ga0207641_10001887 | 3300026088 | Bacteria | 20119 |
| 192 | Ga0207641_10002493 | 3300026088 | Bacteria | 16988 |
| 193 | Ga0207641_10023252 | 3300026088 | Bacteria | 5107 |
| 194 | Ga0207641_10113636 | 3300026088 | Bacteria | 2405 |
| 195 | Ga0207676_10000068 | 3300026095 | Bacteria | 104705 |
| 196 | Ga0207676_10000084 | 3300026095 | Bacteria | 90543 |
| 197 | Ga0207676_10045933 | 3300026095 | Bacteria | 3377 |
| 198 | Ga0209981_1003047 | 3300027378 | Bacteria | 2160 |
| 199 | Ga0209983_1002527 | 3300027665 | Bacteria | 3989 |
| 200 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 201 | Ga0268266_10004139 | 3300028379 | Bacteria | 14009 |
| 202 | Ga0268265_10025653 | 3300028380 | Bacteria | 4187 |
| 203 | Ga0268264_10000032 | 3300028381 | Bacteria | 408337 |
| 204 | Ga0265334_10026571 | 3300028573 | Bacteria | 2336 |
| 205 | Ga0307517_10009099 | 3300028786 | Bacteria | 14145 |
| 206 | Ga0307517_10018952 | 3300028786 | Bacteria | 8861 |
| 207 | Ga0307515_10046891 | 3300028794 | Bacteria | 6590 |
| 208 | Ga0265338_10015423 | 3300028800 | Bacteria | 8395 |
| 209 | Ga0265338_10023661 | 3300028800 | Bacteria | 6303 |
| 210 | Ga0265338_10027332 | 3300028800 | Bacteria | 5727 |
| 211 | Ga0265327_10000548 | 3300031251 | Bacteria | 64199 |
| 212 | Ga0265327_10002880 | 3300031251 | Bacteria | 17304 |
| 213 | Ga0265327_10010897 | 3300031251 | Bacteria | 6327 |
| 214 | Ga0265327_10049924 | 3300031251 | Bacteria | 2192 |
| 215 | Ga0307513_10000127 | 3300031456 | Bacteria | 107100 |
| 216 | Ga0307513_10009020 | 3300031456 | Bacteria | 12650 |
| 217 | Ga0307513_10076485 | 3300031456 | Bacteria | 3471 |
| 218 | Ga0265314_10026063 | 3300031711 | Bacteria | 4399 |
| 219 | Ga0307516_10000144 | 3300031730 | Bacteria | 87138 |
| 220 | Ga0307406_10019302 | 3300031901 | Bacteria | 3999 |
| 221 | Ga0307414_10058914 | 3300032004 | Bacteria | 2708 |
| 222 | Ga0307414_10087110 | 3300032004 | Bacteria | 2306 |
| 223 | Ga0307510_10009443 | 3300033180 | Bacteria | 11617 |
| 224 | Ga0373936_0003063 | 3300035113 | Bacteria | 6252 |
| 225 | Ga0373954_0031128 | 3300035118 | Bacteria | 2462 |
| 226 | Ga0373927_0000111 | 3300035695 | Bacteria | 62031 |
| 227 | Ga0373927_0006077 | 3300035695 | Bacteria | 8264 |
| 228 | Ga0373937_0053903 | 3300036401 | Bacteria | 3689 |
| 229 | Ga0316584_0020954 | 3300036712 | Bacteria | 4747 |
| 230 | Ga0373925_0000209 | 3300037068 | Bacteria | 64086 |
| 231 | Ga0373925_0081936 | 3300037068 | Bacteria | 2455 |
| 232 | Ga0395899_0000003 | 3300037312 | Bacteria | 1232684 |
| 233 | Ga0395899_0100007 | 3300037312 | Bacteria | 2094 |
| 234 | Ga0395900_0000002 | 3300037418 | Bacteria | 671103 |
| 235 | Ga0395898_0022055 | 3300037466 | Bacteria | 6451 |
| 236 | Ga0395898_0023296 | 3300037466 | Bacteria | 6257 |
| 237 | Ga0395898_0177425 | 3300037466 | Bacteria | 2036 |
| 238 | Ga0395905_0000232 | 3300037471 | Bacteria | 84233 |
| 239 | Ga0395905_0016988 | 3300037471 | Bacteria | 6909 |
| 240 | Ga0395905_0058984 | 3300037471 | Bacteria | 3588 |
| 241 | Ga0436364_0267724 | 3300037853 | Bacteria | 14845 |
| 242 | Ga0395901_0000021 | 3300038443 | Bacteria | 307734 |
| 243 | Ga0395901_0055052 | 3300038443 | Bacteria | 4136 |
| 244 | Ga0436365_0845597 | 3300039437 | Bacteria | 47720 |
| 245 | Ga0436365_1125551 | 3300039437 | Bacteria | 52249 |
| 246 | Ga0436361_0310294 | 3300039447 | Bacteria | 2030 |
| 247 | Ga0439446_0002973 | 3300042156 | Bacteria | 4147 |
| 248 | Ga0466959_0062278 | 3300045049 | Bacteria | 2711 |
| 249 | Ga0495627_000377 | 3300046453 | Bacteria | 41082 |
| 250 | Ga0495590_0000984 | 3300046457 | Bacteria | 12545 |
| 251 | Ga0495638_0000442 | 3300046460 | Bacteria | 49958 |
| 252 | Ga0495638_0000681 | 3300046460 | Bacteria | 36921 |
| 253 | Ga0495638_0000835 | 3300046460 | Bacteria | 32328 |
| 254 | Ga0495638_0002360 | 3300046460 | Bacteria | 15468 |
| 255 | Ga0495650_0000046 | 3300046471 | Bacteria | 342987 |
| 256 | Ga0495650_0028582 | 3300046471 | Bacteria | 2557 |
| 257 | Ga0495580_0012560 | 3300046472 | Bacteria | 6490 |
| 258 | Ga0495580_0032060 | 3300046472 | Bacteria | 3794 |
| 259 | Ga0495580_0139620 | 3300046472 | Bacteria | 1680 |
| 260 | Ga0495583_0000003 | 3300046506 | Bacteria | 709273 |
| 261 | Ga0495583_0022660 | 3300046506 | Bacteria | 3198 |
| 262 | Ga0495606_0004507 | 3300046507 | Bacteria | 13870 |
| 263 | Ga0495610_0003082 | 3300046512 | Bacteria | 13311 |
| 264 | Ga0495610_0022843 | 3300046512 | Bacteria | 3411 |
| 265 | Ga0495610_0033924 | 3300046512 | Bacteria | 2633 |
| 266 | Ga0495616_0000383 | 3300046513 | Bacteria | 34656 |
| 267 | Ga0495620_0024553 | 3300046515 | Bacteria | 2865 |
| 268 | Ga0495632_0002889 | 3300046519 | Bacteria | 12633 |
| 269 | Ga0495637_0003649 | 3300046520 | Bacteria | 8152 |
| 270 | Ga0495648_0000880 | 3300046524 | Bacteria | 31622 |
| 271 | Ga0495654_0000039 | 3300046530 | Bacteria | 185363 |
| 272 | Ga0495654_0030608 | 3300046530 | Bacteria | 2737 |
| 273 | Ga0495654_0037024 | 3300046530 | Bacteria | 2450 |
| 274 | Ga0495645_0018803 | 3300046543 | Bacteria | 4970 |
| 275 | Ga0495622_0001495 | 3300046557 | Bacteria | 11700 |
| 276 | Ga0495668_0000040 | 3300046616 | Bacteria | 230681 |
| 277 | Ga0495668_0004897 | 3300046616 | Bacteria | 9293 |
| 278 | Ga0495668_0017021 | 3300046616 | Bacteria | 4222 |
| 279 | Ga0495668_0036261 | 3300046616 | Bacteria | 2763 |
| 280 | Ga0495625_0000069 | 3300046660 | Bacteria | 168800 |
| 281 | Ga0495625_0001580 | 3300046660 | Bacteria | 27097 |
| 282 | Ga0495625_0011242 | 3300046660 | Bacteria | 7320 |
| 283 | Ga0495625_0013083 | 3300046660 | Bacteria | 6685 |
| 284 | Ga0495625_0035047 | 3300046660 | Bacteria | 3701 |
| 285 | Ga0495669_0000006 | 3300046684 | Bacteria | 190838 |
| 286 | Ga0495669_0000216 | 3300046684 | Bacteria | 34639 |
| 287 | Ga0495613_0003263 | 3300046689 | Bacteria | 12124 |
| 288 | Ga0495589_0000891 | 3300046794 | Bacteria | 18525 |
| 289 | Ga0495660_0004934 | 3300046810 | Bacteria | 8037 |
| 290 | Ga0495581_0055935 | 3300047315 | Bacteria | 2277 |
| 291 | Ga0495636_0039174 | 3300047318 | Bacteria | 1962 |
| 292 | Ga0495672_0004217 | 3300047320 | Bacteria | 11890 |
| 293 | Ga0495679_008229 | 3300047446 | Bacteria | 4258 |
| 294 | Ga0495673_0000255 | 3300047469 | Bacteria | 74313 |
| 295 | Ga0495673_0000746 | 3300047469 | Bacteria | 30976 |
| 296 | Ga0495673_0001307 | 3300047469 | Bacteria | 20282 |
| 297 | Ga0495686_0002003 | 3300047472 | Bacteria | 20179 |
| 298 | Ga0495686_0007008 | 3300047472 | Bacteria | 8517 |
| 299 | Ga0495686_0028620 | 3300047472 | Bacteria | 3628 |
| 300 | Ga0495593_0059535 | 3300047673 | Bacteria | 2001 |
| 301 | Ga0496102_0016106 | 3300048905 | Bacteria | 6529 |
| 302 | Ga0496102_0156754 | 3300048905 | Bacteria | 2140 |
| 303 | Ga0496104_0064224 | 3300048907 | Bacteria | 3483 |
| 304 | Ga0496107_0000055 | 3300048910 | Bacteria | 60517 |
| 305 | Ga0496109_0009463 | 3300048912 | Bacteria | 8307 |
| 306 | Ga0496112_0018943 | 3300048915 | Bacteria | 6487 |
| 307 | Ga0496112_0146487 | 3300048915 | Bacteria | 2330 |
| 308 | Ga0496115_0000886 | 3300048918 | Bacteria | 21772 |
| 309 | Ga0496115_0002945 | 3300048918 | Bacteria | 12268 |
| 310 | Ga0496115_0026006 | 3300048918 | Bacteria | 4563 |
| 311 | Ga0496118_0010610 | 3300048921 | Bacteria | 9098 |
| 312 | Ga0496121_0000042 | 3300048924 | Bacteria | 342304 |
| 313 | Ga0496121_0040154 | 3300048924 | Bacteria | 4109 |
| 314 | Ga0496124_0011224 | 3300048927 | Bacteria | 8979 |
| 315 | Ga0495678_001143 | 3300049459 | Bacteria | 22053 |
| 316 | Ga0501043_0076584 | 3300049579 | Bacteria | 2628 |
| 317 | Ga0501043_0106347 | 3300049579 | Bacteria | 2204 |
| 318 | Ga0501047_0004716 | 3300049581 | Bacteria | 12823 |
| 319 | Ga0501047_0058745 | 3300049581 | Bacteria | 3715 |
| 320 | Ga0501070_0061311 | 3300049586 | Bacteria | 3116 |
| 321 | Ga0501073_0074885 | 3300049589 | Bacteria | 2357 |
| 322 | Ga0501238_002211 | 3300049671 | Bacteria | 2306 |
| 323 | Ga0501044_0000280 | 3300049823 | Bacteria | 64928 |
| 324 | Ga0501044_0047147 | 3300049823 | Bacteria | 4458 |
| 325 | nmdc:mga07m45_12653_c1 | 3300050496 | Bacteria | 4463 |
| 326 | nmdc:mga07m45_42114_c1 | 3300050496 | Bacteria | 2559 |
| 327 | nmdc:mga08x19_914_c1 | 3300050514 | Bacteria | 18665 |
| 328 | Ga0500635_0000051 | 3300053080 | Bacteria | 76510 |
| 329 | Ga0500578_0001762 | 3300053086 | Bacteria | 20419 |
| 330 | Ga0500578_0114787 | 3300053086 | Bacteria | 1696 |
| 331 | Ga0500643_000265 | 3300053087 | Bacteria | 46271 |
| 332 | Ga0500643_004863 | 3300053087 | Bacteria | 5930 |
| 333 | Ga0500643_014183 | 3300053087 | Bacteria | 2781 |
| 334 | Ga0500643_020302 | 3300053087 | Bacteria | 2175 |
| 335 | Ga0500644_0000356 | 3300053088 | Bacteria | 22556 |
| 336 | Ga0500644_0011657 | 3300053088 | Bacteria | 2409 |
| 337 | Ga0500651_0030878 | 3300053093 | Bacteria | 3373 |
| 338 | Ga0500641_0016256 | 3300053096 | Bacteria | 2769 |
| 339 | Ga0500556_0000618 | 3300053104 | Bacteria | 22559 |
| 340 | Ga0500562_000595 | 3300053108 | Bacteria | 8683 |
| 341 | Ga0500562_001635 | 3300053108 | Bacteria | 5577 |
| 342 | Ga0500594_0000316 | 3300053118 | Bacteria | 10801 |
| 343 | Ga0500595_006047 | 3300053119 | Bacteria | 5196 |
| 344 | Ga0500595_011527 | 3300053119 | Bacteria | 3458 |
| 345 | Ga0500607_015182 | 3300053121 | Bacteria | 4446 |
| 346 | Ga0500608_000193 | 3300053122 | Bacteria | 24487 |
| 347 | Ga0500608_000739 | 3300053122 | Bacteria | 11934 |
| 348 | Ga0500614_006134 | 3300053123 | Bacteria | 2526 |
| 349 | Ga0500618_000014 | 3300053125 | Bacteria | 177186 |
| 350 | Ga0500658_0000901 | 3300053134 | Bacteria | 12178 |
| 351 | Ga0500559_0000016 | 3300053136 | Bacteria | 151244 |
| 352 | Ga0500559_0000090 | 3300053136 | Bacteria | 72588 |
| 353 | Ga0500559_0010520 | 3300053136 | Bacteria | 3970 |
| 354 | Ga0500559_0013035 | 3300053136 | Bacteria | 3525 |
| 355 | Ga0500559_0048296 | 3300053136 | Bacteria | 1871 |
| 356 | Ga0500564_001778 | 3300053138 | Bacteria | 7626 |
| 357 | Ga0500568_0000276 | 3300053139 | Bacteria | 43235 |
| 358 | Ga0500590_010264 | 3300053148 | Bacteria | 4727 |
| 359 | Ga0500622_0003560 | 3300053156 | Bacteria | 10290 |
| 360 | Ga0500622_0016141 | 3300053156 | Bacteria | 3994 |
| 361 | Ga0500624_000026 | 3300053157 | Bacteria | 109681 |
| 362 | Ga0500637_0015382 | 3300053178 | Bacteria | 4054 |
| 363 | Ga0500611_003325 | 3300053727 | Bacteria | 2048 |
| 364 | Ga0500645_000354 | 3300053730 | Bacteria | 32612 |
| 365 | Ga0500645_002910 | 3300053730 | Bacteria | 7298 |
| 366 | Ga0500609_000067 | 3300053731 | Bacteria | 13670 |
| 367 | Ga0500596_003403 | 3300053735 | Bacteria | 3029 |
| 368 | 2511124440 | 2510917020 | Bacteria | 5657507 |
| 369 | 2524612279 | 2524023250 | Bacteria | 5457705 |
| 370 | 2585150339 | 2582581279 | Bacteria | 4980720 |
| 371 | 2585153447 | 2582581280 | Bacteria | 5994497 |
| 372 | 2585196820 | 2582581293 | Bacteria | 5907401 |
| 373 | 2587919859 | 2585428106 | Bacteria | 5179711 |
| 374 | 2643748870 | 2643221545 | Bacteria | 5083237 |
| 375 | 2643783085 | 2643221552 | Bacteria | 5708754 |
| 376 | 2643884560 | 2643221574 | Bacteria | 2789653 |
| 377 | 2643922641 | 2643221583 | Bacteria | 5218014 |
| 378 | 2643930316 | 2643221584 | Bacteria | 5511711 |
| 379 | 2644001133 | 2643221598 | Bacteria | 4578346 |
| 380 | 2644087542 | 2643221614 | Bacteria | 4260023 |
| 381 | 2644223512 | 2643221640 | Bacteria | 5258820 |
| 382 | 2644237254 | 2643221642 | Bacteria | 5357871 |
| 383 | 2644344414 | 2643221661 | Bacteria | 4267604 |
| 384 | 2644366902 | 2643221666 | Bacteria | 4265935 |
| 385 | 2644509370 | 2643221691 | Bacteria | 5093099 |
| 386 | 2644549056 | 2643221699 | Bacteria | 5731501 |
| 387 | 2644553214 | 2643221699 | Bacteria | 5731501 |
| 388 | 2792458555 | 2791355048 | Bacteria | 5832535 |
| 389 | 2819537705 | 2818991435 | Bacteria | 5433759 |
| 390 | 2819647482 | 2818991454 | Bacteria | 5563326 |
| 391 | 2842335499 | 2842333319 | Bacteria | 8899485 |
| 392 | 2843745770 | 2843744320 | Bacteria | 5659202 |
| 393 | 2849562314 | 2849560528 | Bacteria | 5393480 |
| 394 | 2849577236 | 2849573788 | Bacteria | 5421256 |
| 395 | 2851153222 | 2851153111 | Bacteria | 5542585 |
| 396 | 2857505892 | 2857504554 | Bacteria | 5369913 |
| 397 | 2884963748 | 2884960567 | Bacteria | 5437054 |
| 398 | 2895881131 | 2895880812 | Bacteria | 11255272 |
| 399 | 2898332134 | 2898329390 | Bacteria | 5168154 |
| 400 | 2928532005 | 2928531327 | Bacteria | 5101314 |
| 401 | Ga0496102_0034380 | |||
| 402 | Ga0055536_1000369 | |||
| 403 | Ga0055536_1000494 | |||
| 404 | Ga0055530_10001413 | |||
| 405 | Ga0055530_10012881 | |||
| 406 | Ga0055531_10000751 | |||
| 407 | Ga0055531_10003526 | |||
| 408 | Ga0055531_10004053 | |||
| 409 | Ga0065165_1000517 | |||
| 410 | Ga0065165_1001142 | |||
| 411 | Ga0070658_10023589 | |||
| 412 | Ga0070658_10059561 | |||
| 413 | Ga0070658_10106962 | |||
| 414 | Ga0070658_10132288 | |||
| 415 | Ga0070683_100000011 | |||
| 416 | Ga0070670_100000004 | |||
| 417 | Ga0070670_100030892 | |||
| 418 | Ga0070670_100038267 | |||
| 419 | Ga0070670_100052073 | |||
| 420 | Ga0070666_10016751 | |||
| 421 | Ga0070691_10059790 | |||
| 422 | Ga0070668_100001643 | |||
| 423 | Ga0070668_100003294 | |||
| 424 | Ga0070668_100020129 | |||
| 425 | Ga0070668_100042047 | |||
| 426 | Ga0070669_100002041 | |||
| 427 | Ga0070669_100072936 | |||
| 428 | Ga0070671_100002143 | |||
| 429 | Ga0070671_100093133 | |||
| 430 | Ga0070673_100049236 | |||
| 431 | Ga0070659_100000194 | |||
| 432 | Ga0070659_100001256 | |||
| 433 | Ga0070659_100012303 | |||
| 434 | Ga0070667_100000105 | |||
| 435 | Ga0070667_100002569 | |||
| 436 | Ga0070709_10004365 | |||
| 437 | Ga0070713_100006911 | |||
| 438 | Ga0070713_100014122 | |||
| 439 | Ga0070713_100032659 | |||
| 440 | Ga0070713_100046891 | |||
| 441 | Ga0070678_100103370 | |||
| 442 | Ga0070662_100031038 | |||
| 443 | Ga0070681_10002130 | |||
| 444 | Ga0070681_10003526 | |||
| 445 | Ga0070681_10028150 | |||
| 446 | Ga0070681_10039760 | |||
| 447 | Ga0068867_100022158 | |||
| 448 | Ga0068867_100105489 | |||
| 449 | Ga0070698_100005047 | |||
| 450 | Ga0070679_100003845 | |||
| 451 | Ga0070679_100008098 | |||
| 452 | Ga0070679_100179564 | |||
| 453 | Ga0070684_100000001 | |||
| 454 | Ga0070697_100038304 | |||
| 455 | Ga0068853_100000181 | |||
| 456 | Ga0068853_100032230 | |||
| 457 | Ga0070695_100023951 | |||
| 458 | Ga0070665_100000198 | |||
| 459 | Ga0070665_100000945 | |||
| 460 | Ga0070665_100001194 | |||
| 461 | Ga0068855_100014921 | |||
| 462 | Ga0068855_100021851 | |||
| 463 | Ga0068855_100046675 | |||
| 464 | Ga0068855_100093270 | |||
| 465 | Ga0068859_100004686 | |||
| 466 | Ga0068859_100019578 | |||
| 467 | Ga0068859_100208555 | |||
| 468 | Ga0068864_100000106 | |||
| 469 | Ga0068864_100001229 | |||
| 470 | Ga0068863_100000079 | |||
| 471 | Ga0068863_100000560 | |||
| 472 | Ga0068863_100001315 | |||
| 473 | Ga0068863_100074002 | |||
| 474 | Ga0068858_100000006 | |||
| 475 | Ga0068858_100005137 | |||
| 476 | Ga0068858_100025372 | |||
| 477 | Ga0068860_100000077 | |||
| 478 | Ga0068860_100095460 | |||
| 479 | Ga0068862_100000457 | |||
| 480 | Ga0068862_100043503 | |||
| 481 | Ga0068862_100097040 | |||
| 482 | Ga0070717_10001590 | |||
| 483 | Ga0070717_10015966 | |||
| 484 | Ga0097621_100092515 | |||
| 485 | Ga0075370_10003673 | |||
| 486 | Ga0075370_10034037 | |||
| 487 | Ga0068865_100001549 | |||
| 488 | Ga0075436_100008736 | |||
| 489 | Ga0097620_100004686 | |||
| 490 | Ga0097620_100019577 | |||
| 491 | Ga0097620_100208585 | |||
| 492 | Ga0105240_10000428 | |||
| 493 | Ga0105240_10001788 | |||
| 494 | Ga0105240_10004170 | |||
| 495 | Ga0105240_10080198 | |||
| 496 | Ga0105240_10132283 | |||
| 497 | Ga0105240_10201240 | |||
| 498 | Ga0105247_10014901 | |||
| 499 | Ga0105241_10067261 | |||
| 500 | Ga0105248_10000789 | |||
| 501 | Ga0105248_10027317 | |||
| 502 | Ga0105248_10143558 | |||
| 503 | Ga0105248_10243525 | |||
| 504 | Ga0105237_10004992 | |||
| 505 | Ga0105238_10159484 | |||
| 506 | Ga0105249_10012483 | |||
| 507 | Ga0105249_10230308 | |||
| 508 | Ga0105246_10094383 | |||
| 509 | Ga0157373_10000445 | |||
| 510 | Ga0157373_10004662 | |||
| 511 | Ga0157370_10170004 | |||
| 512 | Ga0163162_10076950 | |||
| 513 | Ga0157372_10112071 | |||
| 514 | Ga0163163_10001844 | |||
| 515 | Ga0213876_10000236 | |||
| 516 | Ga0213876_10000241 | |||
| 517 | Ga0213875_10003047 | |||
| 518 | Ga0209026_1003417 | |||
| 519 | Ga0209565_1000513 | |||
| 520 | Ga0209673_1001161 | |||
| 521 | Ga0209676_1000376 | |||
| 522 | Ga0209676_1001218 | |||
| 523 | Ga0209758_1000238 | |||
| 524 | Ga0209758_1002064 | |||
| 525 | Ga0209758_1007210 | |||
| 526 | Ga0209050_1000073 | |||
| 527 | Ga0209050_1000705 | |||
| 528 | Ga0209050_1002131 | |||
| 529 | Ga0209256_1001100 | |||
| 530 | Ga0209051_1021018 | |||
| 531 | Ga0209257_1000036 | |||
| 532 | Ga0209257_1000282 | |||
| 533 | Ga0209257_1001052 | |||
| 534 | Ga0207705_10002222 | |||
| 535 | Ga0207707_10010946 | |||
| 536 | Ga0207707_10013221 | |||
| 537 | Ga0207707_10077724 | |||
| 538 | Ga0207695_10000269 | |||
| 539 | Ga0207695_10002257 | |||
| 540 | Ga0207695_10004248 | |||
| 541 | Ga0207695_10013630 | |||
| 542 | Ga0207695_10026957 | |||
| 543 | Ga0207693_10000447 | |||
| 544 | Ga0207693_10049093 | |||
| 545 | Ga0207693_10114789 | |||
| 546 | Ga0207660_10005931 | |||
| 547 | Ga0207657_10001390 | |||
| 548 | Ga0207657_10034990 | |||
| 549 | Ga0207652_10028995 | |||
| 550 | Ga0207681_10003653 | |||
| 551 | Ga0207694_10078425 | |||
| 552 | Ga0207694_10129795 | |||
| 553 | Ga0207650_10000033 | |||
| 554 | Ga0207650_10043419 | |||
| 555 | Ga0207700_10007668 | |||
| 556 | Ga0207700_10035558 | |||
| 557 | Ga0207664_10006141 | |||
| 558 | Ga0207664_10056825 | |||
| 559 | Ga0207664_10066044 | |||
| 560 | Ga0207644_10000907 | |||
| 561 | Ga0207690_10000031 | |||
| 562 | Ga0207704_10040215 | |||
| 563 | Ga0207711_10000368 | |||
| 564 | Ga0207711_10004051 | |||
| 565 | Ga0207711_10061561 | |||
| 566 | Ga0207711_10149094 | |||
| 567 | Ga0207661_10000016 | |||
| 568 | Ga0207679_10094195 | |||
| 569 | Ga0207667_10014012 | |||
| 570 | Ga0207667_10016074 | |||
| 571 | Ga0207667_10060297 | |||
| 572 | Ga0207667_10082841 | |||
| 573 | Ga0207667_10138566 | |||
| 574 | Ga0207712_10013541 | |||
| 575 | Ga0207712_10161413 | |||
| 576 | Ga0207668_10000004 | |||
| 577 | Ga0207668_10000426 | |||
| 578 | Ga0207668_10009650 | |||
| 579 | Ga0207668_10012917 | |||
| 580 | Ga0207668_10021418 | |||
| 581 | Ga0207658_10000628 | |||
| 582 | Ga0207658_10010586 | |||
| 583 | Ga0207703_10000027 | |||
| 584 | Ga0207703_10001739 | |||
| 585 | Ga0207703_10017915 | |||
| 586 | Ga0207703_10048621 | |||
| 587 | Ga0207639_10076932 | |||
| 588 | Ga0207708_10000475 | |||
| 589 | Ga0207702_10032916 | |||
| 590 | Ga0207641_10000003 | |||
| 591 | Ga0207641_10001887 | |||
| 592 | Ga0207641_10002493 | |||
| 593 | Ga0207641_10023252 | |||
| 594 | Ga0207641_10113636 | |||
| 595 | Ga0207676_10000068 | |||
| 596 | Ga0207676_10000084 | |||
| 597 | Ga0207676_10045933 | |||
| 598 | Ga0209981_1003047 | |||
| 599 | Ga0209983_1002527 | |||
| 600 | Ga0268266_10000003 | |||
| 601 | Ga0268266_10004139 | |||
| 602 | Ga0268265_10025653 | |||
| 603 | Ga0268264_10000032 | |||
| 604 | Ga0265334_10026571 | |||
| 605 | Ga0307517_10009099 | |||
| 606 | Ga0307517_10018952 | |||
| 607 | Ga0307515_10046891 | |||
| 608 | Ga0265338_10015423 | |||
| 609 | Ga0265338_10023661 | |||
| 610 | Ga0265338_10027332 | |||
| 611 | Ga0265327_10000548 | |||
| 612 | Ga0265327_10002880 | |||
| 613 | Ga0265327_10010897 | |||
| 614 | Ga0265327_10049924 | |||
| 615 | Ga0307513_10000127 | |||
| 616 | Ga0307513_10009020 | |||
| 617 | Ga0307513_10076485 | |||
| 618 | Ga0265314_10026063 | |||
| 619 | Ga0307516_10000144 | |||
| 620 | Ga0307406_10019302 | |||
| 621 | Ga0307414_10058914 | |||
| 622 | Ga0307414_10087110 | |||
| 623 | Ga0307510_10009443 | |||
| 624 | Ga0373936_0003063 | |||
| 625 | Ga0373954_0031128 | |||
| 626 | Ga0373927_0000111 | |||
| 627 | Ga0373927_0006077 | |||
| 628 | Ga0373937_0053903 | |||
| 629 | Ga0316584_0020954 | |||
| 630 | Ga0373925_0000209 | |||
| 631 | Ga0373925_0081936 | |||
| 632 | Ga0395899_0000003 | |||
| 633 | Ga0395899_0100007 | |||
| 634 | Ga0395900_0000002 | |||
| 635 | Ga0395898_0022055 | |||
| 636 | Ga0395898_0023296 | |||
| 637 | Ga0395898_0177425 | |||
| 638 | Ga0395905_0000232 | |||
| 639 | Ga0395905_0016988 | |||
| 640 | Ga0395905_0058984 | |||
| 641 | Ga0436364_0267724 | |||
| 642 | Ga0395901_0000021 | |||
| 643 | Ga0395901_0055052 | |||
| 644 | Ga0436365_0845597 | |||
| 645 | Ga0436365_1125551 | |||
| 646 | Ga0436361_0310294 | |||
| 647 | Ga0439446_0002973 | |||
| 648 | Ga0466959_0062278 | |||
| 649 | Ga0495627_000377 | |||
| 650 | Ga0495590_0000984 | |||
| 651 | Ga0495638_0000442 | |||
| 652 | Ga0495638_0000681 | |||
| 653 | Ga0495638_0000835 | |||
| 654 | Ga0495638_0002360 | |||
| 655 | Ga0495650_0000046 | |||
| 656 | Ga0495650_0028582 | |||
| 657 | Ga0495580_0012560 | |||
| 658 | Ga0495580_0032060 | |||
| 659 | Ga0495580_0139620 | |||
| 660 | Ga0495583_0000003 | |||
| 661 | Ga0495583_0022660 | |||
| 662 | Ga0495606_0004507 | |||
| 663 | Ga0495610_0003082 | |||
| 664 | Ga0495610_0022843 | |||
| 665 | Ga0495610_0033924 | |||
| 666 | Ga0495616_0000383 | |||
| 667 | Ga0495620_0024553 | |||
| 668 | Ga0495632_0002889 | |||
| 669 | Ga0495637_0003649 | |||
| 670 | Ga0495648_0000880 | |||
| 671 | Ga0495654_0000039 | |||
| 672 | Ga0495654_0030608 | |||
| 673 | Ga0495654_0037024 | |||
| 674 | Ga0495645_0018803 | |||
| 675 | Ga0495622_0001495 | |||
| 676 | Ga0495668_0000040 | |||
| 677 | Ga0495668_0004897 | |||
| 678 | Ga0495668_0017021 | |||
| 679 | Ga0495668_0036261 | |||
| 680 | Ga0495625_0000069 | |||
| 681 | Ga0495625_0001580 | |||
| 682 | Ga0495625_0011242 | |||
| 683 | Ga0495625_0013083 | |||
| 684 | Ga0495625_0035047 | |||
| 685 | Ga0495669_0000006 | |||
| 686 | Ga0495669_0000216 | |||
| 687 | Ga0495613_0003263 | |||
| 688 | Ga0495589_0000891 | |||
| 689 | Ga0495660_0004934 | |||
| 690 | Ga0495581_0055935 | |||
| 691 | Ga0495636_0039174 | |||
| 692 | Ga0495672_0004217 | |||
| 693 | Ga0495679_008229 | |||
| 694 | Ga0495673_0000255 | |||
| 695 | Ga0495673_0000746 | |||
| 696 | Ga0495673_0001307 | |||
| 697 | Ga0495686_0002003 | |||
| 698 | Ga0495686_0007008 | |||
| 699 | Ga0495686_0028620 | |||
| 700 | Ga0495593_0059535 | |||
| 701 | Ga0496102_0016106 | |||
| 702 | Ga0496102_0156754 | |||
| 703 | Ga0496104_0064224 | |||
| 704 | Ga0496107_0000055 | |||
| 705 | Ga0496109_0009463 | |||
| 706 | Ga0496112_0018943 | |||
| 707 | Ga0496112_0146487 | |||
| 708 | Ga0496115_0000886 | |||
| 709 | Ga0496115_0002945 | |||
| 710 | Ga0496115_0026006 | |||
| 711 | Ga0496118_0010610 | |||
| 712 | Ga0496121_0000042 | |||
| 713 | Ga0496121_0040154 | |||
| 714 | Ga0496124_0011224 | |||
| 715 | Ga0495678_001143 | |||
| 716 | Ga0501043_0076584 | |||
| 717 | Ga0501043_0106347 | |||
| 718 | Ga0501047_0004716 | |||
| 719 | Ga0501047_0058745 | |||
| 720 | Ga0501070_0061311 | |||
| 721 | Ga0501073_0074885 | |||
| 722 | Ga0501238_002211 | |||
| 723 | Ga0501044_0000280 | |||
| 724 | Ga0501044_0047147 | |||
| 725 | nmdc:mga07m45_12653_c1 | |||
| 726 | nmdc:mga07m45_42114_c1 | |||
| 727 | nmdc:mga08x19_914_c1 | |||
| 728 | Ga0500635_0000051 | |||
| 729 | Ga0500578_0001762 | |||
| 730 | Ga0500578_0114787 | |||
| 731 | Ga0500643_000265 | |||
| 732 | Ga0500643_004863 | |||
| 733 | Ga0500643_014183 | |||
| 734 | Ga0500643_020302 | |||
| 735 | Ga0500644_0000356 | |||
| 736 | Ga0500644_0011657 | |||
| 737 | Ga0500651_0030878 | |||
| 738 | Ga0500641_0016256 | |||
| 739 | Ga0500556_0000618 | |||
| 740 | Ga0500562_000595 | |||
| 741 | Ga0500562_001635 | |||
| 742 | Ga0500594_0000316 | |||
| 743 | Ga0500595_006047 | |||
| 744 | Ga0500595_011527 | |||
| 745 | Ga0500607_015182 | |||
| 746 | Ga0500608_000193 | |||
| 747 | Ga0500608_000739 | |||
| 748 | Ga0500614_006134 | |||
| 749 | Ga0500618_000014 | |||
| 750 | Ga0500658_0000901 | |||
| 751 | Ga0500559_0000016 | |||
| 752 | Ga0500559_0000090 | |||
| 753 | Ga0500559_0010520 | |||
| 754 | Ga0500559_0013035 | |||
| 755 | Ga0500559_0048296 | |||
| 756 | Ga0500564_001778 | |||
| 757 | Ga0500568_0000276 | |||
| 758 | Ga0500590_010264 | |||
| 759 | Ga0500622_0003560 | |||
| 760 | Ga0500622_0016141 | |||
| 761 | Ga0500624_000026 | |||
| 762 | Ga0500637_0015382 | |||
| 763 | Ga0500611_003325 | |||
| 764 | Ga0500645_000354 | |||
| 765 | Ga0500645_002910 | |||
| 766 | Ga0500609_000067 | |||
| 767 | Ga0500596_003403 | |||
| 768 | 2511124440 | |||
| 769 | 2524612279 | |||
| 770 | 2585150339 | |||
| 771 | 2585153447 | |||
| 772 | 2585196820 | |||
| 773 | 2587919859 | |||
| 774 | 2643748870 | |||
| 775 | 2643783085 | |||
| 776 | 2643884560 | |||
| 777 | 2643922641 | |||
| 778 | 2643930316 | |||
| 779 | 2644001133 | |||
| 780 | 2644087542 | |||
| 781 | 2644223512 | |||
| 782 | 2644237254 | |||
| 783 | 2644344414 | |||
| 784 | 2644366902 | |||
| 785 | 2644509370 | |||
| 786 | 2644549056 | |||
| 787 | 2644553214 | |||
| 788 | 2792458555 | |||
| 789 | 2819537705 | |||
| 790 | 2819647482 | |||
| 791 | 2842335499 | |||
| 792 | 2843745770 | |||
| 793 | 2849562314 | |||
| 794 | 2849577236 | |||
| 795 | 2851153222 | |||
| 796 | 2857505892 | |||
| 797 | 2884963748 | |||
| 798 | 2895881131 | |||
| 799 | 2898332134 | |||
| 800 | 2928532005 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3zzm-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis purh with a novel bound nucleotide cfair, at 2.2 a resolution. | 0.9203 | 12 | 529 |
| 1zcz-assembly1.cif.gz_A | crystal structure of phosphoribosylaminoimidazolecarboxamide formyltransferase / imp cyclohydrolase (tm1249) from thermotoga maritima at 1.88 a resolution | 0.9153 | 17 | 529 |
| 3zzm-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis purh with a novel bound nucleotide cfair, at 2.2 a resolution. | 0.9152 | 12 | 529 |
| 1zcz-assembly1.cif.gz_A | crystal structure of phosphoribosylaminoimidazolecarboxamide formyltransferase / imp cyclohydrolase (tm1249) from thermotoga maritima at 1.88 a resolution | 0.9115 | 17 | 529 |
| 4a1o-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis purh complexed with aicar and a novel nucleotide cfair, at 2.48 a resolution. | 0.9062 | 11 | 529 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P15639_394_529_3.40.140.20 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;AICAR transformylase, duplication domain | 0.9882 | 394 | 529 | 3.40.140.20 |
| af_P15639_394_529_3.40.140.20 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;AICAR transformylase, duplication domain | 0.981 | 394 | 529 | 3.40.140.20 |
| af_O35567_1_197_3.40.50.1380 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylglyoxal synthase-like domain | 0.9705 | 16 | 205 | 3.40.50.1380 |
| af_Q86L14_1_198_3.40.50.1380 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylglyoxal synthase-like domain | 0.9669 | 18 | 204 | 3.40.50.1380 |
| 4a1oB02 | Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;AICAR transformylase, duplication domain | 0.9621 | 249 | 371 | 3.40.140.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257PG57-F1-model_v4 | Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase | 0.9929 | 250 | 529 |
GO:0003937
GO:0004643 GO:0005829 GO:0006189 |
| AF-A0A259IFG2-F1-model_v4 | deleted | 0.9923 | 21 | 529 |
|
| AF-A0A258KKE2-F1-model_v4 | Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase | 0.992 | 218 | 529 |
GO:0003937
GO:0004643 GO:0005829 GO:0006189 |
| AF-A0A259CZA0-F1-model_v4 | Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/inosine monophosphate cyclohydrolase | 0.9904 | 401 | 529 |
GO:0003937
GO:0004643 GO:0005829 GO:0006189 |
| AF-A0A5C7KWU3-F1-model_v4 | deleted | 0.9898 | 409 | 529 |
|