F434673

General Info

Members Datasets Scaffolds Average Seq Length
400 230 800 528

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0034380|Ga0496102_0034380_738_2426
Length 562
Sequence VTGDVRWATTGERRIDPPLAWAFSLRFRKENAMPAAPDFPAAPYRAPIRRALISVSDKTGLVEAAKALAAMGVELVSTGGTRKAIADAGLSVKDISDLTGFPEMMDGRVKTLHPVVHGGLLGVRDAPEHKAAMDAHGIGPIDLVYVNLYPFEATVASGADYATAVENIDIGGPAMIRSAAKNHGYVAVCTEIADLEEVLAELQADGTTSLDLRKRLAARAYGRTAAYDAAISGWFAKALGEEAPRRRAFAGELVQTMRYGENPHQQASFYRFAGPRTGVATAKQLQGKELSYNNINDTDAAYELIAEFDPAAAPACAIIKHANPCGLATGGSLLEAYERALACDPVSAFGGIVALNSRLDAATAAKVLETFTEVVIAPDADEDAVALFRKKKNVRLLTTGGLPDPNEPGDTFRSVAGGFLVQSRDTARLTAADLKVVTARAPTEAEIRDMLFAFTVAKHVKSNAIVYAKAGQTLGIGAGQMNRKDSARIAALRAADFGLDLTGSACASEAFFPFPDGLLQAADAGCTAVIQPGGSIGDEKVIEAANDRGLAMVFTGVRVFRH

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
101 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
125 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
128 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
135 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
136 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
137 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
138 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
139 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
140 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
148 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
149 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
150 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
151 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
152 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
153 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
162 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
163 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
164 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
169 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
174 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
175 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
176 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
177 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
178 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
179 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
180 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
181 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
182 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
183 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
184 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
185 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
186 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
187 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
188 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
189 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
190 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
191 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
192 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
193 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
194 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
195 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
196 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
197 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
198 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
199 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
200 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
201 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
202 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
203 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
204 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
205 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
206 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
207 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
208 2643221583 Caulobacter sp. Root655 Isolate Unclassified
209 2643221584 Caulobacter sp. Root656 Isolate Unclassified
210 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
211 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
212 2643221640 Caulobacter sp. Root342 Isolate Unclassified
213 2643221642 Caulobacter sp. Root343 Isolate Unclassified
214 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
215 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
216 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
217 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
218 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
219 2818991435 Caulobacter henricii 536 Isolate Unclassified
220 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
221 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
222 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
223 2849560528 Caulobacter zeae 410 Isolate Unclassified
224 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
225 2851153111 Caulobacter radicis 736 Isolate Unclassified
226 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
227 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
228 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
229 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
230 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.75
Metatranscriptomes 0
Isolates 8.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17
Nodule 0.25
Rhizoplane 2.75
Rhizosphere 69.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0034380 3300048905 Bacteria 4558
2 Ga0055536_1000369 3300003781 Bacteria 33441
3 Ga0055536_1000494 3300003781 Bacteria 27289
4 Ga0055530_10001413 3300003791 Bacteria 17642
5 Ga0055530_10012881 3300003791 Bacteria 2889
6 Ga0055531_10000751 3300003794 Bacteria 27289
7 Ga0055531_10003526 3300003794 Bacteria 9948
8 Ga0055531_10004053 3300003794 Bacteria 9080
9 Ga0065165_1000517 3300005262 Bacteria 59268
10 Ga0065165_1001142 3300005262 Bacteria 31092
11 Ga0070658_10023589 3300005327 Bacteria 4937
12 Ga0070658_10059561 3300005327 Bacteria 3109
13 Ga0070658_10106962 3300005327 Bacteria 2314
14 Ga0070658_10132288 3300005327 Bacteria 2079
15 Ga0070683_100000011 3300005329 Bacteria 283682
16 Ga0070670_100000004 3300005331 Bacteria 392110
17 Ga0070670_100030892 3300005331 Bacteria 4613
18 Ga0070670_100038267 3300005331 Bacteria 4125
19 Ga0070670_100052073 3300005331 Bacteria 3516
20 Ga0070666_10016751 3300005335 Bacteria 4692
21 Ga0070691_10059790 3300005341 Bacteria 1832
22 Ga0070668_100001643 3300005347 Bacteria 16208
23 Ga0070668_100003294 3300005347 Bacteria 11919
24 Ga0070668_100020129 3300005347 Bacteria 5031
25 Ga0070668_100042047 3300005347 Bacteria 3502
26 Ga0070669_100002041 3300005353 Bacteria 14610
27 Ga0070669_100072936 3300005353 Bacteria 2543
28 Ga0070671_100002143 3300005355 Bacteria 15242
29 Ga0070671_100093133 3300005355 Bacteria 2525
30 Ga0070673_100049236 3300005364 Bacteria 3290
31 Ga0070659_100000194 3300005366 Bacteria 46646
32 Ga0070659_100001256 3300005366 Bacteria 18409
33 Ga0070659_100012303 3300005366 Bacteria 6344
34 Ga0070667_100000105 3300005367 Bacteria 106633
35 Ga0070667_100002569 3300005367 Bacteria 15778
36 Ga0070709_10004365 3300005434 Bacteria 7623
37 Ga0070713_100006911 3300005436 Bacteria 7920
38 Ga0070713_100014122 3300005436 Bacteria 5917
39 Ga0070713_100032659 3300005436 Bacteria 4160
40 Ga0070713_100046891 3300005436 Bacteria 3548
41 Ga0070678_100103370 3300005456 Bacteria 2213
42 Ga0070662_100031038 3300005457 Bacteria 3746
43 Ga0070681_10002130 3300005458 Bacteria 17987
44 Ga0070681_10003526 3300005458 Bacteria 14658
45 Ga0070681_10028150 3300005458 Bacteria 5650
46 Ga0070681_10039760 3300005458 Bacteria 4715
47 Ga0068867_100022158 3300005459 Bacteria 4539
48 Ga0068867_100105489 3300005459 Bacteria 2158
49 Ga0070698_100005047 3300005471 Bacteria 14468
50 Ga0070679_100003845 3300005530 Bacteria 13794
51 Ga0070679_100008098 3300005530 Bacteria 9875
52 Ga0070679_100179564 3300005530 Bacteria 2089
53 Ga0070684_100000001 3300005535 Bacteria 300240
54 Ga0070697_100038304 3300005536 Bacteria 3873
55 Ga0068853_100000181 3300005539 Bacteria 44176
56 Ga0068853_100032230 3300005539 Bacteria 4438
57 Ga0070695_100023951 3300005545 Bacteria 3758
58 Ga0070665_100000198 3300005548 Bacteria 105999
59 Ga0070665_100000945 3300005548 Bacteria 37054
60 Ga0070665_100001194 3300005548 Bacteria 31673
61 Ga0068855_100014921 3300005563 Bacteria 9361
62 Ga0068855_100021851 3300005563 Bacteria 7672
63 Ga0068855_100046675 3300005563 Bacteria 5120
64 Ga0068855_100093270 3300005563 Bacteria 3472
65 Ga0068859_100004686 3300005617 Bacteria 13922
66 Ga0068859_100019578 3300005617 Bacteria 6799
67 Ga0068859_100208555 3300005617 Bacteria 2040
68 Ga0068864_100000106 3300005618 Bacteria 81202
69 Ga0068864_100001229 3300005618 Bacteria 21305
70 Ga0068863_100000079 3300005841 Bacteria 107383
71 Ga0068863_100000560 3300005841 Bacteria 37696
72 Ga0068863_100001315 3300005841 Bacteria 24750
73 Ga0068863_100074002 3300005841 Bacteria 3222
74 Ga0068858_100000006 3300005842 Bacteria 256011
75 Ga0068858_100005137 3300005842 Bacteria 12825
76 Ga0068858_100025372 3300005842 Bacteria 5515
77 Ga0068860_100000077 3300005843 Bacteria 171297
78 Ga0068860_100095460 3300005843 Bacteria 2834
79 Ga0068862_100000457 3300005844 Bacteria 44218
80 Ga0068862_100043503 3300005844 Bacteria 3830
81 Ga0068862_100097040 3300005844 Bacteria 2573
82 Ga0070717_10001590 3300006028 Bacteria 15704
83 Ga0070717_10015966 3300006028 Bacteria 5813
84 Ga0097621_100092515 3300006237 Bacteria 2533
85 Ga0075370_10003673 3300006353 Bacteria 7344
86 Ga0075370_10034037 3300006353 Bacteria 2855
87 Ga0068865_100001549 3300006881 Bacteria 13417
88 Ga0075436_100008736 3300006914 Bacteria 6928
89 Ga0097620_100004686 3300006931 Bacteria 13922
90 Ga0097620_100019577 3300006931 Bacteria 6799
91 Ga0097620_100208585 3300006931 Bacteria 2040
92 Ga0105240_10000428 3300009093 Bacteria 77995
93 Ga0105240_10001788 3300009093 Bacteria 36269
94 Ga0105240_10004170 3300009093 Bacteria 22153
95 Ga0105240_10080198 3300009093 Bacteria 4015
96 Ga0105240_10132283 3300009093 Bacteria 2991
97 Ga0105240_10201240 3300009093 Bacteria 2334
98 Ga0105247_10014901 3300009101 Bacteria 4661
99 Ga0105241_10067261 3300009174 Bacteria 2773
100 Ga0105248_10000789 3300009177 Bacteria 35531
101 Ga0105248_10027317 3300009177 Bacteria 6352
102 Ga0105248_10143558 3300009177 Bacteria 2693
103 Ga0105248_10243525 3300009177 Bacteria 2024
104 Ga0105237_10004992 3300009545 Bacteria 15119
105 Ga0105238_10159484 3300009551 Bacteria 2231
106 Ga0105249_10012483 3300009553 Bacteria 7489
107 Ga0105249_10230308 3300009553 Bacteria 1827
108 Ga0105246_10094383 3300011119 Bacteria 2164
109 Ga0157373_10000445 3300013100 Bacteria 32823
110 Ga0157373_10004662 3300013100 Bacteria 10320
111 Ga0157370_10170004 3300013104 Bacteria 2026
112 Ga0163162_10076950 3300013306 Bacteria 3399
113 Ga0157372_10112071 3300013307 Bacteria 3126
114 Ga0163163_10001844 3300014325 Bacteria 17889
115 Ga0213876_10000236 3300021384 Bacteria 53620
116 Ga0213876_10000241 3300021384 Bacteria 52167
117 Ga0213875_10003047 3300021388 Bacteria 9697
118 Ga0209026_1003417 3300025250 Bacteria 5219
119 Ga0209565_1000513 3300025263 Bacteria 27885
120 Ga0209673_1001161 3300025273 Bacteria 28708
121 Ga0209676_1000376 3300025292 Bacteria 82203
122 Ga0209676_1001218 3300025292 Bacteria 27313
123 Ga0209758_1000238 3300025297 Bacteria 115807
124 Ga0209758_1002064 3300025297 Bacteria 21447
125 Ga0209758_1007210 3300025297 Bacteria 7654
126 Ga0209050_1000073 3300025298 Bacteria 292046
127 Ga0209050_1000705 3300025298 Bacteria 49555
128 Ga0209050_1002131 3300025298 Bacteria 18032
129 Ga0209256_1001100 3300025299 Bacteria 31096
130 Ga0209051_1021018 3300025303 Bacteria 2792
131 Ga0209257_1000036 3300025304 Bacteria 616006
132 Ga0209257_1000282 3300025304 Bacteria 113789
133 Ga0209257_1001052 3300025304 Bacteria 36631
134 Ga0207705_10002222 3300025909 Bacteria 14985
135 Ga0207707_10010946 3300025912 Bacteria 7889
136 Ga0207707_10013221 3300025912 Bacteria 7193
137 Ga0207707_10077724 3300025912 Bacteria 2897
138 Ga0207695_10000269 3300025913 Bacteria 130183
139 Ga0207695_10002257 3300025913 Bacteria 28858
140 Ga0207695_10004248 3300025913 Bacteria 19681
141 Ga0207695_10013630 3300025913 Bacteria 9681
142 Ga0207695_10026957 3300025913 Bacteria 6405
143 Ga0207693_10000447 3300025915 Bacteria 37791
144 Ga0207693_10049093 3300025915 Bacteria 3314
145 Ga0207693_10114789 3300025915 Bacteria 2114
146 Ga0207660_10005931 3300025917 Bacteria 7933
147 Ga0207657_10001390 3300025919 Bacteria 25814
148 Ga0207657_10034990 3300025919 Bacteria 4508
149 Ga0207652_10028995 3300025921 Bacteria 4622
150 Ga0207681_10003653 3300025923 Bacteria 9568
151 Ga0207694_10078425 3300025924 Bacteria 2589
152 Ga0207694_10129795 3300025924 Bacteria 2019
153 Ga0207650_10000033 3300025925 Bacteria 226809
154 Ga0207650_10043419 3300025925 Bacteria 3300
155 Ga0207700_10007668 3300025928 Bacteria 6625
156 Ga0207700_10035558 3300025928 Bacteria 3589
157 Ga0207664_10006141 3300025929 Bacteria 8234
158 Ga0207664_10056825 3300025929 Bacteria 3109
159 Ga0207664_10066044 3300025929 Bacteria 2898
160 Ga0207644_10000907 3300025931 Bacteria 18778
161 Ga0207690_10000031 3300025932 Bacteria 154724
162 Ga0207704_10040215 3300025938 Bacteria 2730
163 Ga0207711_10000368 3300025941 Bacteria 47898
164 Ga0207711_10004051 3300025941 Bacteria 12576
165 Ga0207711_10061561 3300025941 Bacteria 3237
166 Ga0207711_10149094 3300025941 Bacteria 2109
167 Ga0207661_10000016 3300025944 Bacteria 305159
168 Ga0207679_10094195 3300025945 Bacteria 2325
169 Ga0207667_10014012 3300025949 Bacteria 9153
170 Ga0207667_10016074 3300025949 Bacteria 8471
171 Ga0207667_10060297 3300025949 Bacteria 3971
172 Ga0207667_10082841 3300025949 Bacteria 3322
173 Ga0207667_10138566 3300025949 Bacteria 2505
174 Ga0207712_10013541 3300025961 Bacteria 5229
175 Ga0207712_10161413 3300025961 Bacteria 1742
176 Ga0207668_10000004 3300025972 Bacteria 201204
177 Ga0207668_10000426 3300025972 Bacteria 26589
178 Ga0207668_10009650 3300025972 Bacteria 5794
179 Ga0207668_10012917 3300025972 Bacteria 5128
180 Ga0207668_10021418 3300025972 Bacteria 4122
181 Ga0207658_10000628 3300025986 Bacteria 31184
182 Ga0207658_10010586 3300025986 Bacteria 6267
183 Ga0207703_10000027 3300026035 Bacteria 209608
184 Ga0207703_10001739 3300026035 Bacteria 19550
185 Ga0207703_10017915 3300026035 Bacteria 5531
186 Ga0207703_10048621 3300026035 Bacteria 3425
187 Ga0207639_10076932 3300026041 Bacteria 2629
188 Ga0207708_10000475 3300026075 Bacteria 31007
189 Ga0207702_10032916 3300026078 Bacteria 4327
190 Ga0207641_10000003 3300026088 Bacteria 496984
191 Ga0207641_10001887 3300026088 Bacteria 20119
192 Ga0207641_10002493 3300026088 Bacteria 16988
193 Ga0207641_10023252 3300026088 Bacteria 5107
194 Ga0207641_10113636 3300026088 Bacteria 2405
195 Ga0207676_10000068 3300026095 Bacteria 104705
196 Ga0207676_10000084 3300026095 Bacteria 90543
197 Ga0207676_10045933 3300026095 Bacteria 3377
198 Ga0209981_1003047 3300027378 Bacteria 2160
199 Ga0209983_1002527 3300027665 Bacteria 3989
200 Ga0268266_10000003 3300028379 Bacteria 1701703
201 Ga0268266_10004139 3300028379 Bacteria 14009
202 Ga0268265_10025653 3300028380 Bacteria 4187
203 Ga0268264_10000032 3300028381 Bacteria 408337
204 Ga0265334_10026571 3300028573 Bacteria 2336
205 Ga0307517_10009099 3300028786 Bacteria 14145
206 Ga0307517_10018952 3300028786 Bacteria 8861
207 Ga0307515_10046891 3300028794 Bacteria 6590
208 Ga0265338_10015423 3300028800 Bacteria 8395
209 Ga0265338_10023661 3300028800 Bacteria 6303
210 Ga0265338_10027332 3300028800 Bacteria 5727
211 Ga0265327_10000548 3300031251 Bacteria 64199
212 Ga0265327_10002880 3300031251 Bacteria 17304
213 Ga0265327_10010897 3300031251 Bacteria 6327
214 Ga0265327_10049924 3300031251 Bacteria 2192
215 Ga0307513_10000127 3300031456 Bacteria 107100
216 Ga0307513_10009020 3300031456 Bacteria 12650
217 Ga0307513_10076485 3300031456 Bacteria 3471
218 Ga0265314_10026063 3300031711 Bacteria 4399
219 Ga0307516_10000144 3300031730 Bacteria 87138
220 Ga0307406_10019302 3300031901 Bacteria 3999
221 Ga0307414_10058914 3300032004 Bacteria 2708
222 Ga0307414_10087110 3300032004 Bacteria 2306
223 Ga0307510_10009443 3300033180 Bacteria 11617
224 Ga0373936_0003063 3300035113 Bacteria 6252
225 Ga0373954_0031128 3300035118 Bacteria 2462
226 Ga0373927_0000111 3300035695 Bacteria 62031
227 Ga0373927_0006077 3300035695 Bacteria 8264
228 Ga0373937_0053903 3300036401 Bacteria 3689
229 Ga0316584_0020954 3300036712 Bacteria 4747
230 Ga0373925_0000209 3300037068 Bacteria 64086
231 Ga0373925_0081936 3300037068 Bacteria 2455
232 Ga0395899_0000003 3300037312 Bacteria 1232684
233 Ga0395899_0100007 3300037312 Bacteria 2094
234 Ga0395900_0000002 3300037418 Bacteria 671103
235 Ga0395898_0022055 3300037466 Bacteria 6451
236 Ga0395898_0023296 3300037466 Bacteria 6257
237 Ga0395898_0177425 3300037466 Bacteria 2036
238 Ga0395905_0000232 3300037471 Bacteria 84233
239 Ga0395905_0016988 3300037471 Bacteria 6909
240 Ga0395905_0058984 3300037471 Bacteria 3588
241 Ga0436364_0267724 3300037853 Bacteria 14845
242 Ga0395901_0000021 3300038443 Bacteria 307734
243 Ga0395901_0055052 3300038443 Bacteria 4136
244 Ga0436365_0845597 3300039437 Bacteria 47720
245 Ga0436365_1125551 3300039437 Bacteria 52249
246 Ga0436361_0310294 3300039447 Bacteria 2030
247 Ga0439446_0002973 3300042156 Bacteria 4147
248 Ga0466959_0062278 3300045049 Bacteria 2711
249 Ga0495627_000377 3300046453 Bacteria 41082
250 Ga0495590_0000984 3300046457 Bacteria 12545
251 Ga0495638_0000442 3300046460 Bacteria 49958
252 Ga0495638_0000681 3300046460 Bacteria 36921
253 Ga0495638_0000835 3300046460 Bacteria 32328
254 Ga0495638_0002360 3300046460 Bacteria 15468
255 Ga0495650_0000046 3300046471 Bacteria 342987
256 Ga0495650_0028582 3300046471 Bacteria 2557
257 Ga0495580_0012560 3300046472 Bacteria 6490
258 Ga0495580_0032060 3300046472 Bacteria 3794
259 Ga0495580_0139620 3300046472 Bacteria 1680
260 Ga0495583_0000003 3300046506 Bacteria 709273
261 Ga0495583_0022660 3300046506 Bacteria 3198
262 Ga0495606_0004507 3300046507 Bacteria 13870
263 Ga0495610_0003082 3300046512 Bacteria 13311
264 Ga0495610_0022843 3300046512 Bacteria 3411
265 Ga0495610_0033924 3300046512 Bacteria 2633
266 Ga0495616_0000383 3300046513 Bacteria 34656
267 Ga0495620_0024553 3300046515 Bacteria 2865
268 Ga0495632_0002889 3300046519 Bacteria 12633
269 Ga0495637_0003649 3300046520 Bacteria 8152
270 Ga0495648_0000880 3300046524 Bacteria 31622
271 Ga0495654_0000039 3300046530 Bacteria 185363
272 Ga0495654_0030608 3300046530 Bacteria 2737
273 Ga0495654_0037024 3300046530 Bacteria 2450
274 Ga0495645_0018803 3300046543 Bacteria 4970
275 Ga0495622_0001495 3300046557 Bacteria 11700
276 Ga0495668_0000040 3300046616 Bacteria 230681
277 Ga0495668_0004897 3300046616 Bacteria 9293
278 Ga0495668_0017021 3300046616 Bacteria 4222
279 Ga0495668_0036261 3300046616 Bacteria 2763
280 Ga0495625_0000069 3300046660 Bacteria 168800
281 Ga0495625_0001580 3300046660 Bacteria 27097
282 Ga0495625_0011242 3300046660 Bacteria 7320
283 Ga0495625_0013083 3300046660 Bacteria 6685
284 Ga0495625_0035047 3300046660 Bacteria 3701
285 Ga0495669_0000006 3300046684 Bacteria 190838
286 Ga0495669_0000216 3300046684 Bacteria 34639
287 Ga0495613_0003263 3300046689 Bacteria 12124
288 Ga0495589_0000891 3300046794 Bacteria 18525
289 Ga0495660_0004934 3300046810 Bacteria 8037
290 Ga0495581_0055935 3300047315 Bacteria 2277
291 Ga0495636_0039174 3300047318 Bacteria 1962
292 Ga0495672_0004217 3300047320 Bacteria 11890
293 Ga0495679_008229 3300047446 Bacteria 4258
294 Ga0495673_0000255 3300047469 Bacteria 74313
295 Ga0495673_0000746 3300047469 Bacteria 30976
296 Ga0495673_0001307 3300047469 Bacteria 20282
297 Ga0495686_0002003 3300047472 Bacteria 20179
298 Ga0495686_0007008 3300047472 Bacteria 8517
299 Ga0495686_0028620 3300047472 Bacteria 3628
300 Ga0495593_0059535 3300047673 Bacteria 2001
301 Ga0496102_0016106 3300048905 Bacteria 6529
302 Ga0496102_0156754 3300048905 Bacteria 2140
303 Ga0496104_0064224 3300048907 Bacteria 3483
304 Ga0496107_0000055 3300048910 Bacteria 60517
305 Ga0496109_0009463 3300048912 Bacteria 8307
306 Ga0496112_0018943 3300048915 Bacteria 6487
307 Ga0496112_0146487 3300048915 Bacteria 2330
308 Ga0496115_0000886 3300048918 Bacteria 21772
309 Ga0496115_0002945 3300048918 Bacteria 12268
310 Ga0496115_0026006 3300048918 Bacteria 4563
311 Ga0496118_0010610 3300048921 Bacteria 9098
312 Ga0496121_0000042 3300048924 Bacteria 342304
313 Ga0496121_0040154 3300048924 Bacteria 4109
314 Ga0496124_0011224 3300048927 Bacteria 8979
315 Ga0495678_001143 3300049459 Bacteria 22053
316 Ga0501043_0076584 3300049579 Bacteria 2628
317 Ga0501043_0106347 3300049579 Bacteria 2204
318 Ga0501047_0004716 3300049581 Bacteria 12823
319 Ga0501047_0058745 3300049581 Bacteria 3715
320 Ga0501070_0061311 3300049586 Bacteria 3116
321 Ga0501073_0074885 3300049589 Bacteria 2357
322 Ga0501238_002211 3300049671 Bacteria 2306
323 Ga0501044_0000280 3300049823 Bacteria 64928
324 Ga0501044_0047147 3300049823 Bacteria 4458
325 nmdc:mga07m45_12653_c1 3300050496 Bacteria 4463
326 nmdc:mga07m45_42114_c1 3300050496 Bacteria 2559
327 nmdc:mga08x19_914_c1 3300050514 Bacteria 18665
328 Ga0500635_0000051 3300053080 Bacteria 76510
329 Ga0500578_0001762 3300053086 Bacteria 20419
330 Ga0500578_0114787 3300053086 Bacteria 1696
331 Ga0500643_000265 3300053087 Bacteria 46271
332 Ga0500643_004863 3300053087 Bacteria 5930
333 Ga0500643_014183 3300053087 Bacteria 2781
334 Ga0500643_020302 3300053087 Bacteria 2175
335 Ga0500644_0000356 3300053088 Bacteria 22556
336 Ga0500644_0011657 3300053088 Bacteria 2409
337 Ga0500651_0030878 3300053093 Bacteria 3373
338 Ga0500641_0016256 3300053096 Bacteria 2769
339 Ga0500556_0000618 3300053104 Bacteria 22559
340 Ga0500562_000595 3300053108 Bacteria 8683
341 Ga0500562_001635 3300053108 Bacteria 5577
342 Ga0500594_0000316 3300053118 Bacteria 10801
343 Ga0500595_006047 3300053119 Bacteria 5196
344 Ga0500595_011527 3300053119 Bacteria 3458
345 Ga0500607_015182 3300053121 Bacteria 4446
346 Ga0500608_000193 3300053122 Bacteria 24487
347 Ga0500608_000739 3300053122 Bacteria 11934
348 Ga0500614_006134 3300053123 Bacteria 2526
349 Ga0500618_000014 3300053125 Bacteria 177186
350 Ga0500658_0000901 3300053134 Bacteria 12178
351 Ga0500559_0000016 3300053136 Bacteria 151244
352 Ga0500559_0000090 3300053136 Bacteria 72588
353 Ga0500559_0010520 3300053136 Bacteria 3970
354 Ga0500559_0013035 3300053136 Bacteria 3525
355 Ga0500559_0048296 3300053136 Bacteria 1871
356 Ga0500564_001778 3300053138 Bacteria 7626
357 Ga0500568_0000276 3300053139 Bacteria 43235
358 Ga0500590_010264 3300053148 Bacteria 4727
359 Ga0500622_0003560 3300053156 Bacteria 10290
360 Ga0500622_0016141 3300053156 Bacteria 3994
361 Ga0500624_000026 3300053157 Bacteria 109681
362 Ga0500637_0015382 3300053178 Bacteria 4054
363 Ga0500611_003325 3300053727 Bacteria 2048
364 Ga0500645_000354 3300053730 Bacteria 32612
365 Ga0500645_002910 3300053730 Bacteria 7298
366 Ga0500609_000067 3300053731 Bacteria 13670
367 Ga0500596_003403 3300053735 Bacteria 3029
368 2511124440 2510917020 Bacteria 5657507
369 2524612279 2524023250 Bacteria 5457705
370 2585150339 2582581279 Bacteria 4980720
371 2585153447 2582581280 Bacteria 5994497
372 2585196820 2582581293 Bacteria 5907401
373 2587919859 2585428106 Bacteria 5179711
374 2643748870 2643221545 Bacteria 5083237
375 2643783085 2643221552 Bacteria 5708754
376 2643884560 2643221574 Bacteria 2789653
377 2643922641 2643221583 Bacteria 5218014
378 2643930316 2643221584 Bacteria 5511711
379 2644001133 2643221598 Bacteria 4578346
380 2644087542 2643221614 Bacteria 4260023
381 2644223512 2643221640 Bacteria 5258820
382 2644237254 2643221642 Bacteria 5357871
383 2644344414 2643221661 Bacteria 4267604
384 2644366902 2643221666 Bacteria 4265935
385 2644509370 2643221691 Bacteria 5093099
386 2644549056 2643221699 Bacteria 5731501
387 2644553214 2643221699 Bacteria 5731501
388 2792458555 2791355048 Bacteria 5832535
389 2819537705 2818991435 Bacteria 5433759
390 2819647482 2818991454 Bacteria 5563326
391 2842335499 2842333319 Bacteria 8899485
392 2843745770 2843744320 Bacteria 5659202
393 2849562314 2849560528 Bacteria 5393480
394 2849577236 2849573788 Bacteria 5421256
395 2851153222 2851153111 Bacteria 5542585
396 2857505892 2857504554 Bacteria 5369913
397 2884963748 2884960567 Bacteria 5437054
398 2895881131 2895880812 Bacteria 11255272
399 2898332134 2898329390 Bacteria 5168154
400 2928532005 2928531327 Bacteria 5101314
401 Ga0496102_0034380
402 Ga0055536_1000369
403 Ga0055536_1000494
404 Ga0055530_10001413
405 Ga0055530_10012881
406 Ga0055531_10000751
407 Ga0055531_10003526
408 Ga0055531_10004053
409 Ga0065165_1000517
410 Ga0065165_1001142
411 Ga0070658_10023589
412 Ga0070658_10059561
413 Ga0070658_10106962
414 Ga0070658_10132288
415 Ga0070683_100000011
416 Ga0070670_100000004
417 Ga0070670_100030892
418 Ga0070670_100038267
419 Ga0070670_100052073
420 Ga0070666_10016751
421 Ga0070691_10059790
422 Ga0070668_100001643
423 Ga0070668_100003294
424 Ga0070668_100020129
425 Ga0070668_100042047
426 Ga0070669_100002041
427 Ga0070669_100072936
428 Ga0070671_100002143
429 Ga0070671_100093133
430 Ga0070673_100049236
431 Ga0070659_100000194
432 Ga0070659_100001256
433 Ga0070659_100012303
434 Ga0070667_100000105
435 Ga0070667_100002569
436 Ga0070709_10004365
437 Ga0070713_100006911
438 Ga0070713_100014122
439 Ga0070713_100032659
440 Ga0070713_100046891
441 Ga0070678_100103370
442 Ga0070662_100031038
443 Ga0070681_10002130
444 Ga0070681_10003526
445 Ga0070681_10028150
446 Ga0070681_10039760
447 Ga0068867_100022158
448 Ga0068867_100105489
449 Ga0070698_100005047
450 Ga0070679_100003845
451 Ga0070679_100008098
452 Ga0070679_100179564
453 Ga0070684_100000001
454 Ga0070697_100038304
455 Ga0068853_100000181
456 Ga0068853_100032230
457 Ga0070695_100023951
458 Ga0070665_100000198
459 Ga0070665_100000945
460 Ga0070665_100001194
461 Ga0068855_100014921
462 Ga0068855_100021851
463 Ga0068855_100046675
464 Ga0068855_100093270
465 Ga0068859_100004686
466 Ga0068859_100019578
467 Ga0068859_100208555
468 Ga0068864_100000106
469 Ga0068864_100001229
470 Ga0068863_100000079
471 Ga0068863_100000560
472 Ga0068863_100001315
473 Ga0068863_100074002
474 Ga0068858_100000006
475 Ga0068858_100005137
476 Ga0068858_100025372
477 Ga0068860_100000077
478 Ga0068860_100095460
479 Ga0068862_100000457
480 Ga0068862_100043503
481 Ga0068862_100097040
482 Ga0070717_10001590
483 Ga0070717_10015966
484 Ga0097621_100092515
485 Ga0075370_10003673
486 Ga0075370_10034037
487 Ga0068865_100001549
488 Ga0075436_100008736
489 Ga0097620_100004686
490 Ga0097620_100019577
491 Ga0097620_100208585
492 Ga0105240_10000428
493 Ga0105240_10001788
494 Ga0105240_10004170
495 Ga0105240_10080198
496 Ga0105240_10132283
497 Ga0105240_10201240
498 Ga0105247_10014901
499 Ga0105241_10067261
500 Ga0105248_10000789
501 Ga0105248_10027317
502 Ga0105248_10143558
503 Ga0105248_10243525
504 Ga0105237_10004992
505 Ga0105238_10159484
506 Ga0105249_10012483
507 Ga0105249_10230308
508 Ga0105246_10094383
509 Ga0157373_10000445
510 Ga0157373_10004662
511 Ga0157370_10170004
512 Ga0163162_10076950
513 Ga0157372_10112071
514 Ga0163163_10001844
515 Ga0213876_10000236
516 Ga0213876_10000241
517 Ga0213875_10003047
518 Ga0209026_1003417
519 Ga0209565_1000513
520 Ga0209673_1001161
521 Ga0209676_1000376
522 Ga0209676_1001218
523 Ga0209758_1000238
524 Ga0209758_1002064
525 Ga0209758_1007210
526 Ga0209050_1000073
527 Ga0209050_1000705
528 Ga0209050_1002131
529 Ga0209256_1001100
530 Ga0209051_1021018
531 Ga0209257_1000036
532 Ga0209257_1000282
533 Ga0209257_1001052
534 Ga0207705_10002222
535 Ga0207707_10010946
536 Ga0207707_10013221
537 Ga0207707_10077724
538 Ga0207695_10000269
539 Ga0207695_10002257
540 Ga0207695_10004248
541 Ga0207695_10013630
542 Ga0207695_10026957
543 Ga0207693_10000447
544 Ga0207693_10049093
545 Ga0207693_10114789
546 Ga0207660_10005931
547 Ga0207657_10001390
548 Ga0207657_10034990
549 Ga0207652_10028995
550 Ga0207681_10003653
551 Ga0207694_10078425
552 Ga0207694_10129795
553 Ga0207650_10000033
554 Ga0207650_10043419
555 Ga0207700_10007668
556 Ga0207700_10035558
557 Ga0207664_10006141
558 Ga0207664_10056825
559 Ga0207664_10066044
560 Ga0207644_10000907
561 Ga0207690_10000031
562 Ga0207704_10040215
563 Ga0207711_10000368
564 Ga0207711_10004051
565 Ga0207711_10061561
566 Ga0207711_10149094
567 Ga0207661_10000016
568 Ga0207679_10094195
569 Ga0207667_10014012
570 Ga0207667_10016074
571 Ga0207667_10060297
572 Ga0207667_10082841
573 Ga0207667_10138566
574 Ga0207712_10013541
575 Ga0207712_10161413
576 Ga0207668_10000004
577 Ga0207668_10000426
578 Ga0207668_10009650
579 Ga0207668_10012917
580 Ga0207668_10021418
581 Ga0207658_10000628
582 Ga0207658_10010586
583 Ga0207703_10000027
584 Ga0207703_10001739
585 Ga0207703_10017915
586 Ga0207703_10048621
587 Ga0207639_10076932
588 Ga0207708_10000475
589 Ga0207702_10032916
590 Ga0207641_10000003
591 Ga0207641_10001887
592 Ga0207641_10002493
593 Ga0207641_10023252
594 Ga0207641_10113636
595 Ga0207676_10000068
596 Ga0207676_10000084
597 Ga0207676_10045933
598 Ga0209981_1003047
599 Ga0209983_1002527
600 Ga0268266_10000003
601 Ga0268266_10004139
602 Ga0268265_10025653
603 Ga0268264_10000032
604 Ga0265334_10026571
605 Ga0307517_10009099
606 Ga0307517_10018952
607 Ga0307515_10046891
608 Ga0265338_10015423
609 Ga0265338_10023661
610 Ga0265338_10027332
611 Ga0265327_10000548
612 Ga0265327_10002880
613 Ga0265327_10010897
614 Ga0265327_10049924
615 Ga0307513_10000127
616 Ga0307513_10009020
617 Ga0307513_10076485
618 Ga0265314_10026063
619 Ga0307516_10000144
620 Ga0307406_10019302
621 Ga0307414_10058914
622 Ga0307414_10087110
623 Ga0307510_10009443
624 Ga0373936_0003063
625 Ga0373954_0031128
626 Ga0373927_0000111
627 Ga0373927_0006077
628 Ga0373937_0053903
629 Ga0316584_0020954
630 Ga0373925_0000209
631 Ga0373925_0081936
632 Ga0395899_0000003
633 Ga0395899_0100007
634 Ga0395900_0000002
635 Ga0395898_0022055
636 Ga0395898_0023296
637 Ga0395898_0177425
638 Ga0395905_0000232
639 Ga0395905_0016988
640 Ga0395905_0058984
641 Ga0436364_0267724
642 Ga0395901_0000021
643 Ga0395901_0055052
644 Ga0436365_0845597
645 Ga0436365_1125551
646 Ga0436361_0310294
647 Ga0439446_0002973
648 Ga0466959_0062278
649 Ga0495627_000377
650 Ga0495590_0000984
651 Ga0495638_0000442
652 Ga0495638_0000681
653 Ga0495638_0000835
654 Ga0495638_0002360
655 Ga0495650_0000046
656 Ga0495650_0028582
657 Ga0495580_0012560
658 Ga0495580_0032060
659 Ga0495580_0139620
660 Ga0495583_0000003
661 Ga0495583_0022660
662 Ga0495606_0004507
663 Ga0495610_0003082
664 Ga0495610_0022843
665 Ga0495610_0033924
666 Ga0495616_0000383
667 Ga0495620_0024553
668 Ga0495632_0002889
669 Ga0495637_0003649
670 Ga0495648_0000880
671 Ga0495654_0000039
672 Ga0495654_0030608
673 Ga0495654_0037024
674 Ga0495645_0018803
675 Ga0495622_0001495
676 Ga0495668_0000040
677 Ga0495668_0004897
678 Ga0495668_0017021
679 Ga0495668_0036261
680 Ga0495625_0000069
681 Ga0495625_0001580
682 Ga0495625_0011242
683 Ga0495625_0013083
684 Ga0495625_0035047
685 Ga0495669_0000006
686 Ga0495669_0000216
687 Ga0495613_0003263
688 Ga0495589_0000891
689 Ga0495660_0004934
690 Ga0495581_0055935
691 Ga0495636_0039174
692 Ga0495672_0004217
693 Ga0495679_008229
694 Ga0495673_0000255
695 Ga0495673_0000746
696 Ga0495673_0001307
697 Ga0495686_0002003
698 Ga0495686_0007008
699 Ga0495686_0028620
700 Ga0495593_0059535
701 Ga0496102_0016106
702 Ga0496102_0156754
703 Ga0496104_0064224
704 Ga0496107_0000055
705 Ga0496109_0009463
706 Ga0496112_0018943
707 Ga0496112_0146487
708 Ga0496115_0000886
709 Ga0496115_0002945
710 Ga0496115_0026006
711 Ga0496118_0010610
712 Ga0496121_0000042
713 Ga0496121_0040154
714 Ga0496124_0011224
715 Ga0495678_001143
716 Ga0501043_0076584
717 Ga0501043_0106347
718 Ga0501047_0004716
719 Ga0501047_0058745
720 Ga0501070_0061311
721 Ga0501073_0074885
722 Ga0501238_002211
723 Ga0501044_0000280
724 Ga0501044_0047147
725 nmdc:mga07m45_12653_c1
726 nmdc:mga07m45_42114_c1
727 nmdc:mga08x19_914_c1
728 Ga0500635_0000051
729 Ga0500578_0001762
730 Ga0500578_0114787
731 Ga0500643_000265
732 Ga0500643_004863
733 Ga0500643_014183
734 Ga0500643_020302
735 Ga0500644_0000356
736 Ga0500644_0011657
737 Ga0500651_0030878
738 Ga0500641_0016256
739 Ga0500556_0000618
740 Ga0500562_000595
741 Ga0500562_001635
742 Ga0500594_0000316
743 Ga0500595_006047
744 Ga0500595_011527
745 Ga0500607_015182
746 Ga0500608_000193
747 Ga0500608_000739
748 Ga0500614_006134
749 Ga0500618_000014
750 Ga0500658_0000901
751 Ga0500559_0000016
752 Ga0500559_0000090
753 Ga0500559_0010520
754 Ga0500559_0013035
755 Ga0500559_0048296
756 Ga0500564_001778
757 Ga0500568_0000276
758 Ga0500590_010264
759 Ga0500622_0003560
760 Ga0500622_0016141
761 Ga0500624_000026
762 Ga0500637_0015382
763 Ga0500611_003325
764 Ga0500645_000354
765 Ga0500645_002910
766 Ga0500609_000067
767 Ga0500596_003403
768 2511124440
769 2524612279
770 2585150339
771 2585153447
772 2585196820
773 2587919859
774 2643748870
775 2643783085
776 2643884560
777 2643922641
778 2643930316
779 2644001133
780 2644087542
781 2644223512
782 2644237254
783 2644344414
784 2644366902
785 2644509370
786 2644549056
787 2644553214
788 2792458555
789 2819537705
790 2819647482
791 2842335499
792 2843745770
793 2849562314
794 2849577236
795 2851153222
796 2857505892
797 2884963748
798 2895881131
799 2898332134
800 2928532005

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01808

AICARFT_IMPCHas

AICARFT/IMPCHase bienzyme

179

493

0.97

PF02142

MGS

MGS-like domain

60

174

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zzm-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis purh with a novel bound nucleotide cfair, at 2.2 a resolution. 0.9203 12 529
1zcz-assembly1.cif.gz_A crystal structure of phosphoribosylaminoimidazolecarboxamide formyltransferase / imp cyclohydrolase (tm1249) from thermotoga maritima at 1.88 a resolution 0.9153 17 529
3zzm-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis purh with a novel bound nucleotide cfair, at 2.2 a resolution. 0.9152 12 529
1zcz-assembly1.cif.gz_A crystal structure of phosphoribosylaminoimidazolecarboxamide formyltransferase / imp cyclohydrolase (tm1249) from thermotoga maritima at 1.88 a resolution 0.9115 17 529
4a1o-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis purh complexed with aicar and a novel nucleotide cfair, at 2.48 a resolution. 0.9062 11 529
ID Description Score Start End Superfamily
af_P15639_394_529_3.40.140.20 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;AICAR transformylase, duplication domain 0.9882 394 529 3.40.140.20
af_P15639_394_529_3.40.140.20 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;AICAR transformylase, duplication domain 0.981 394 529 3.40.140.20
af_O35567_1_197_3.40.50.1380 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylglyoxal synthase-like domain 0.9705 16 205 3.40.50.1380
af_Q86L14_1_198_3.40.50.1380 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylglyoxal synthase-like domain 0.9669 18 204 3.40.50.1380
4a1oB02 Alpha Beta;3-Layer(aba) Sandwich;Cytidine Deaminase; domain 2;AICAR transformylase, duplication domain 0.9621 249 371 3.40.140.20
ID Description Score Start End GO Terms
AF-A0A257PG57-F1-model_v4 Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase 0.9929 250 529 GO:0003937
GO:0004643
GO:0005829
GO:0006189
AF-A0A259IFG2-F1-model_v4 deleted 0.9923 21 529
AF-A0A258KKE2-F1-model_v4 Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase 0.992 218 529 GO:0003937
GO:0004643
GO:0005829
GO:0006189
AF-A0A259CZA0-F1-model_v4 Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/inosine monophosphate cyclohydrolase 0.9904 401 529 GO:0003937
GO:0004643
GO:0005829
GO:0006189
AF-A0A5C7KWU3-F1-model_v4 deleted 0.9898 409 529

Map