metagRoot

F434642

General Info

Members	Datasets	Scaffolds	Average Seq Length
400	250	387	212

Family's Representative Sequence

Representative Sequence	3300044693\|Ga0466961_0030204\|Ga0466961_0030204_1142_1819
Length	225
Sequence	VAARDYGQYCGVTRALELVGERWALLIVRDLLVGPRRYGELAAGLPRIPSNILAARLKELQAAGVIRRLPRSRVVVYELTPYGRELEPVVLALGAWGFKAMGEPREEQVITPDAMTIALRTAFRPQVAAALPATAYGARLGPAELLVRVDGARLEVTRGEGPVDLAFAAGPGIRRLISGELAPDRAIATGVVEVLRGPGALLDRFASTFHLAARPGRARPPTVGR

Samples

	Sample ID	Description	Type	Environment
1	2643221616	Leifsonia sp. Root227	Isolate	Unclassified
2	2643221632	Leifsonia sp. Root112D2	Isolate	Unclassified
3	2643221690	Cellulomonas sp. Root485	Isolate	Unclassified
4	2643221694	Cellulomonas sp. Root137	Isolate	Unclassified
5	2643221722	Cellulomonas sp. Root930	Isolate	Unclassified
6	2731639228	Motilibacter peucedani DSM 45328	Isolate	Rhizosphere
7	2799112218	Motilibacter rhizosphaerae DSM 45622	Isolate	Rhizosphere
8	2852643534	Leifsonia sp. AK011	Isolate	Rhizosphere
9	2857733635	Salinibacterium sp. R-73062	Isolate	Unclassified
10	2857737099	Lysinimonas sp. R-73066	Isolate	Unclassified
11	2884763398	Leifsonia sp. PS1209	Isolate	Stem Tuber
12	2884994152	Cellulomonas sp. H30R-01	Isolate	Rhizosphere
13	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
14	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
15	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
16	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
17	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
18	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
19	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
20	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
21	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
22	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
23	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
24	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
25	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
26	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
27	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
28	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
29	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
30	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
31	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
32	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
33	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
34	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
35	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
36	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
37	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
38	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
39	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
40	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
41	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
42	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
43	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
44	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
45	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
46	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
47	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
48	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
49	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
50	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
51	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
52	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
53	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
54	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
55	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
56	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
57	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
58	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
59	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
60	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
61	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
62	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
63	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
64	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
65	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
66	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
67	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
68	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
69	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
70	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
71	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
72	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
73	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
74	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
75	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
76	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
77	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
78	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
79	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
80	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
81	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
82	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
83	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
84	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
85	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
86	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
87	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
88	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
89	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
90	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
91	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
92	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
93	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
94	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
95	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
96	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
97	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
98	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
99	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
140	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
143	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
144	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
145	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
146	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
147	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
148	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
149	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
150	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
151	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
152	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
153	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
154	3300041462	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG	Metagenome	Rhizoplane
155	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
156	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
157	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
158	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
159	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
160	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
161	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
162	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
163	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
164	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
165	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
166	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
167	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
168	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
169	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
170	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
171	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
172	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
173	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
174	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
175	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
176	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
177	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
178	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
179	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
180	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
181	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
182	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
183	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
184	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
185	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
186	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
187	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
188	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
189	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
190	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
191	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
192	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
193	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
194	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
195	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
196	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
197	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
198	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
199	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
200	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
201	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
202	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
203	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
204	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
205	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
206	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
207	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
208	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
209	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
210	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
211	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
212	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
213	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
214	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
215	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
216	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
217	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
218	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
219	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
220	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
221	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
222	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
223	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
224	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
225	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
226	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
227	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
228	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
229	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
230	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
231	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
232	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
233	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
234	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
235	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
236	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
237	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
238	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
239	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
240	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
241	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
242	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
243	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
244	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
245	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
246	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
247	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
248	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
249	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
250	8057345674	Herbiconiux aconitum CPCC 205763	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	96.75
Metatranscriptomes	0
Isolates	3.25

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	9
Nodule	0
Rhizoplane	11
Rhizosphere	72
Stem	0
Stem Tuber	0.25
Unclassified	7.75

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25165J46597_1000125	3300003214	Bacteria	131155
2	rootH1_10119943	3300003316	Bacteria	1728
3	Ga0055527_1000003	3300003760	Bacteria	705001
4	Ga0055542_1000005	3300003762	Bacteria	550280
5	Ga0055529_1000046	3300003763	Bacteria	209430
6	Ga0070658_10000034	3300005327	Bacteria	146880
7	Ga0070658_10032561	3300005327	Bacteria	4191
8	Ga0070658_10058223	3300005327	Bacteria	3144
9	Ga0070658_10072415	3300005327	Bacteria	2824
10	Ga0070683_100004032	3300005329	Bacteria	12022
11	Ga0070683_100091942	3300005329	Bacteria	2850
12	Ga0068869_100240591	3300005334	Bacteria	1442
13	Ga0070682_100206779	3300005337	Bacteria	1388
14	Ga0070682_100330382	3300005337	Bacteria	1130
15	Ga0068868_100038641	3300005338	Bacteria	3705
16	Ga0068868_100239641	3300005338	Bacteria	1523
17	Ga0070661_100120678	3300005344	Bacteria	1963
18	Ga0070668_100164008	3300005347	Bacteria	1805
19	Ga0070675_100097517	3300005354	Bacteria	2472
20	Ga0070673_100573517	3300005364	Bacteria	1027
21	Ga0070659_100000749	3300005366	Bacteria	23637
22	Ga0070659_100121766	3300005366	Bacteria	2114
23	Ga0070659_100531584	3300005366	Bacteria	1005
24	Ga0070667_100025125	3300005367	Bacteria	4952
25	Ga0070667_101200889	3300005367	Bacteria	710
26	Ga0070709_10046326	3300005434	Bacteria	2703
27	Ga0070714_100566489	3300005435	Bacteria	1089
28	Ga0070710_10168786	3300005437	Bacteria	1362
29	Ga0070678_100055474	3300005456	Bacteria	2893
30	Ga0070662_100207151	3300005457	Bacteria	1559
31	Ga0070685_10023708	3300005466	Bacteria	3363
32	Ga0070684_100009574	3300005535	Bacteria	7634
33	Ga0070684_100730338	3300005535	Bacteria	924
34	Ga0068853_100001645	3300005539	Bacteria	16333
35	Ga0068853_100098926	3300005539	Bacteria	2576
36	Ga0068853_100334594	3300005539	Bacteria	1406
37	Ga0070665_100186061	3300005548	Bacteria	2078
38	Ga0068855_100003924	3300005563	Bacteria	18149
39	Ga0068855_100009335	3300005563	Bacteria	11847
40	Ga0068855_100237478	3300005563	Bacteria	2038
41	Ga0070664_100008041	3300005564	Bacteria	8522
42	Ga0068857_100001028	3300005577	Bacteria	21558
43	Ga0068857_100017779	3300005577	Bacteria	6233
44	Ga0068856_100027232	3300005614	Bacteria	5576
45	Ga0068856_100080073	3300005614	Bacteria	3240
46	Ga0068856_100104794	3300005614	Bacteria	2822
47	Ga0068856_100593718	3300005614	Bacteria	1128
48	Ga0068856_100716712	3300005614	Bacteria	1021
49	Ga0068852_100000501	3300005616	Bacteria	25721
50	Ga0068852_100181706	3300005616	Bacteria	1978
51	Ga0068852_100338518	3300005616	Bacteria	1466
52	Ga0068852_100377020	3300005616	Bacteria	1391
53	Ga0068859_100107171	3300005617	Bacteria	2854
54	Ga0068864_100004094	3300005618	Bacteria	11973
55	Ga0068861_100080880	3300005719	Bacteria	2542
56	Ga0068861_100533148	3300005719	Bacteria	1067
57	Ga0068851_10000008	3300005834	Bacteria	231006
58	Ga0068870_10067544	3300005840	Bacteria	1940
59	Ga0068863_100020054	3300005841	Bacteria	6395
60	Ga0068858_100000096	3300005842	Bacteria	91762
61	Ga0081540_1001036	3300005983	Bacteria	24897
62	Ga0081540_1024040	3300005983	Bacteria	3545
63	Ga0075365_10056423	3300006038	Bacteria	2611
64	Ga0075364_10002073	3300006051	Bacteria	11194
65	Ga0075432_10009906	3300006058	Bacteria	3240
66	Ga0070712_100115874	3300006175	Bacteria	2009
67	Ga0075369_10002965	3300006186	Bacteria	6131
68	Ga0075428_100023362	3300006844	Bacteria	6840
69	Ga0075428_100139296	3300006844	Bacteria	2637
70	Ga0075430_100125237	3300006846	Bacteria	2141
71	Ga0075431_100010278	3300006847	Bacteria	9404
72	Ga0075433_10027089	3300006852	Bacteria	4859
73	Ga0075434_100158210	3300006871	Bacteria	2285
74	Ga0075429_100321819	3300006880	Bacteria	1353
75	Ga0068865_100040815	3300006881	Bacteria	3155
76	Ga0075436_100502815	3300006914	Bacteria	887
77	Ga0097620_100107172	3300006931	Bacteria	2854
78	Ga0075435_100205163	3300007076	Bacteria	1671
79	Ga0105240_10012630	3300009093	Bacteria	11644
80	Ga0105240_10096652	3300009093	Bacteria	3599
81	Ga0111539_10027872	3300009094	Bacteria	6897
82	Ga0105245_10054689	3300009098	Bacteria	3585
83	Ga0105245_10058830	3300009098	Bacteria	3459
84	Ga0105245_10095309	3300009098	Bacteria	2745
85	Ga0105245_10192726	3300009098	Bacteria	1953
86	Ga0105245_10427515	3300009098	Bacteria	1329
87	Ga0114129_10010064	3300009147	Bacteria	13477
88	Ga0105243_10096661	3300009148	Bacteria	2444
89	Ga0105243_10281410	3300009148	Bacteria	1498
90	Ga0105243_10374605	3300009148	Bacteria	1315
91	Ga0105241_10015162	3300009174	Bacteria	5644
92	Ga0105242_10048970	3300009176	Bacteria	3437
93	Ga0105248_10061203	3300009177	Bacteria	4226
94	Ga0105248_10397362	3300009177	Bacteria	1552
95	Ga0105237_10000688	3300009545	Bacteria	46838
96	Ga0105238_10107965	3300009551	Bacteria	2764
97	Ga0105238_10364173	3300009551	Bacteria	1435
98	Ga0105238_10746314	3300009551	Bacteria	992
99	Ga0105249_10875207	3300009553	Bacteria	965
100	Ga0105239_10167613	3300010375	Bacteria	2456
101	Ga0105239_10200131	3300010375	Bacteria	2237
102	Ga0105246_10071938	3300011119	Bacteria	2436
103	Ga0157370_10081233	3300013104	Bacteria	3050
104	Ga0157370_10855968	3300013104	Bacteria	826
105	Ga0157369_10156600	3300013105	Bacteria	2406
106	Ga0157369_10481998	3300013105	Bacteria	1284
107	Ga0163162_10185640	3300013306	Bacteria	2206
108	Ga0163162_10241297	3300013306	Bacteria	1938
109	Ga0163162_10260650	3300013306	Bacteria	1865
110	Ga0163162_10680764	3300013306	Bacteria	1151
111	Ga0163162_10760427	3300013306	Bacteria	1088
112	Ga0157372_10790465	3300013307	Bacteria	1103
113	Ga0157372_10857512	3300013307	Bacteria	1054
114	Ga0157375_10651678	3300013308	Bacteria	1209
115	Ga0163163_10098487	3300014325	Bacteria	2945
116	Ga0157380_10019622	3300014326	Bacteria	5040
117	Ga0157380_11020353	3300014326	Bacteria	862
118	Ga0157377_10213627	3300014745	Bacteria	1231
119	Ga0157379_10005881	3300014968	Bacteria	10552
120	Ga0157376_10121326	3300014969	Bacteria	2317
121	Ga0157376_11111379	3300014969	Bacteria	816
122	Ga0163161_10239934	3300017792	Bacteria	1409
123	Ga0213875_10046937	3300021388	Bacteria	2027
124	Ga0209672_100003	3300025228	Bacteria	1560476
125	Ga0209147_100646	3300025229	Bacteria	18280
126	Ga0207427_100039	3300025231	Bacteria	291576
127	Ga0209437_100922	3300025233	Bacteria	11217
128	Ga0209258_106238	3300025242	Bacteria	1895
129	Ga0209148_1000004	3300025254	Bacteria	1844481
130	Ga0209148_1001379	3300025254	Bacteria	12636
131	Ga0209233_1000014	3300025261	Bacteria	996641
132	Ga0209455_1000080	3300025272	Bacteria	266151
133	Ga0207656_10000005	3300025321	Bacteria	490514
134	Ga0207656_10200984	3300025321	Bacteria	963
135	Ga0207692_10384577	3300025898	Bacteria	872
136	Ga0207710_10029692	3300025900	Bacteria	2381
137	Ga0207688_10019216	3300025901	Bacteria	3720
138	Ga0207647_10028416	3300025904	Bacteria	3633
139	Ga0207699_10041240	3300025906	Bacteria	2665
140	Ga0207643_10170265	3300025908	Bacteria	1314
141	Ga0207705_10000001	3300025909	Bacteria	2061880
142	Ga0207705_10019591	3300025909	Bacteria	4837
143	Ga0207705_10194495	3300025909	Bacteria	1535
144	Ga0207654_10000001	3300025911	Bacteria	1816198
145	Ga0207695_10005054	3300025913	Bacteria	17692
146	Ga0207695_10007931	3300025913	Bacteria	13399
147	Ga0207671_10000016	3300025914	Bacteria	435413
148	Ga0207693_10715304	3300025915	Bacteria	775
149	Ga0207657_10013644	3300025919	Bacteria	7965
150	Ga0207657_10108402	3300025919	Bacteria	2296
151	Ga0207694_10000019	3300025924	Bacteria	312382
152	Ga0207694_10284630	3300025924	Bacteria	1358
153	Ga0207687_10570831	3300025927	Bacteria	951
154	Ga0207664_10459851	3300025929	Bacteria	1136
155	Ga0207690_10007267	3300025932	Bacteria	6580
156	Ga0207706_10370798	3300025933	Bacteria	1243
157	Ga0207709_10332467	3300025935	Bacteria	1141
158	Ga0207669_10027377	3300025937	Bacteria	3120
159	Ga0207704_10928304	3300025938	Bacteria	733
160	Ga0207691_10043148	3300025940	Bacteria	4157
161	Ga0207711_10026964	3300025941	Bacteria	4823
162	Ga0207711_10034020	3300025941	Bacteria	4315
163	Ga0207661_10005545	3300025944	Bacteria	8905
164	Ga0207661_10231328	3300025944	Bacteria	1637
165	Ga0207679_10020782	3300025945	Bacteria	4437
166	Ga0207667_10000437	3300025949	Bacteria	55848
167	Ga0207667_10001482	3300025949	Bacteria	29458
168	Ga0207667_10008673	3300025949	Bacteria	12051
169	Ga0207667_10076993	3300025949	Bacteria	3460
170	Ga0207667_10391990	3300025949	Bacteria	1414
171	Ga0207667_10545204	3300025949	Bacteria	1173
172	Ga0207651_10556905	3300025960	Bacteria	998
173	Ga0207658_10102844	3300025986	Bacteria	2241
174	Ga0207677_10057617	3300026023	Bacteria	2669
175	Ga0207677_10575425	3300026023	Bacteria	985
176	Ga0207703_10001625	3300026035	Bacteria	20245
177	Ga0207703_10166040	3300026035	Bacteria	1937
178	Ga0207639_10024131	3300026041	Bacteria	4397
179	Ga0207678_10091926	3300026067	Bacteria	2594
180	Ga0207708_10129010	3300026075	Bacteria	1976
181	Ga0207708_10501263	3300026075	Bacteria	1018
182	Ga0207702_10091237	3300026078	Bacteria	2667
183	Ga0207702_10092921	3300026078	Bacteria	2645
184	Ga0207702_10203978	3300026078	Bacteria	1834
185	Ga0207702_10646039	3300026078	Bacteria	1040
186	Ga0207641_10469785	3300026088	Bacteria	1218
187	Ga0207641_10501271	3300026088	Bacteria	1179
188	Ga0207648_10235201	3300026089	Bacteria	1630
189	Ga0207674_10000405	3300026116	Bacteria	55884
190	Ga0207674_10026086	3300026116	Bacteria	6216
191	Ga0207674_11209790	3300026116	Bacteria	725
192	Ga0207675_100040787	3300026118	Bacteria	4335
193	Ga0207675_100495430	3300026118	Bacteria	1216
194	Ga0207683_10122690	3300026121	Bacteria	2333
195	Ga0207683_10268032	3300026121	Bacteria	1560
196	Ga0207698_10000078	3300026142	Bacteria	65050
197	Ga0207698_10002109	3300026142	Bacteria	11726
198	Ga0207698_10440356	3300026142	Bacteria	1255
199	Ga0207428_10003440	3300027907	Bacteria	15375
200	Ga0268266_10401542	3300028379	Bacteria	1296
201	Ga0268264_10323309	3300028381	Bacteria	1459
202	Ga0307515_10073451	3300028794	Bacteria	4597
203	Ga0307513_10218990	3300031456	Bacteria	1727
204	Ga0307410_10913830	3300031852	Bacteria	753
205	Ga0373923_0106421	3300035111	Bacteria	1242
206	Ga0373937_0936206	3300036401	Bacteria	815
207	Ga0373925_0549576	3300037068	Bacteria	950
208	Ga0395900_0061609	3300037418	Bacteria	3857
209	Ga0395898_0000647	3300037466	Bacteria	63277
210	Ga0395901_0347797	3300038443	Bacteria	1530
211	Ga0451791_1284457	3300041451	Bacteria	1595
212	Ga0451793_1009035	3300041452	Bacteria	1286
213	Ga0451793_1150781	3300041452	Bacteria	1201
214	Ga0451793_1155980	3300041452	Bacteria	1691
215	Ga0451793_1595714	3300041452	Bacteria	787
216	Ga0451797_0863885	3300041453	Bacteria	1202
217	Ga0451797_1184574	3300041453	Bacteria	1783
218	Ga0451806_713397	3300041462	Bacteria	1191
219	Ga0451841_0963914	3300041498	Bacteria	950
220	Ga0451849_0003252	3300041505	Bacteria	881
221	Ga0451855_0700972	3300041511	Bacteria	1166
222	Ga0451853_2495528	3300041512	Bacteria	2709
223	Ga0439444_0083674	3300042437	Bacteria	702
224	Ga0439460_0061907	3300042461	Bacteria	1144
225	Ga0439440_0046488	3300042993	Bacteria	1073
226	Ga0466965_0000003	3300044683	Bacteria	265985
227	Ga0466965_0146027	3300044683	Bacteria	1234
228	Ga0466965_0173132	3300044683	Bacteria	1136
229	Ga0466961_0030204	3300044693	Bacteria	3483
230	Ga0466961_0091196	3300044693	Bacteria	1924
231	Ga0466963_0026613	3300044694	Bacteria	3700
232	Ga0466964_0098291	3300044706	Bacteria	1286
233	Ga0466970_0024861	3300044765	Bacteria	3133
234	Ga0466970_0092065	3300044765	Bacteria	1646
235	Ga0466970_0378817	3300044765	Bacteria	805
236	Ga0466960_0102700	3300044901	Bacteria	1475
237	Ga0466960_0246585	3300044901	Bacteria	991
238	Ga0466959_0044445	3300045049	Bacteria	3273
239	Ga0466959_0448164	3300045049	Bacteria	875
240	Ga0466958_0168912	3300045836	Bacteria	1385
241	Ga0466967_0007038	3300045976	Bacteria	8056
242	Ga0466967_0384641	3300045976	Bacteria	1363
243	Ga0495603_0139591	3300046455	Bacteria	1410
244	Ga0495653_0128393	3300046463	Bacteria	1798
245	Ga0495608_0135684	3300046511	Bacteria	1573
246	Ga0495628_0301068	3300046516	Bacteria	1187
247	Ga0495644_0170115	3300046523	Bacteria	837
248	Ga0495587_0239102	3300046536	Bacteria	1022
249	Ga0495645_0219173	3300046543	Bacteria	1281
250	Ga0495656_0043983	3300046615	Bacteria	1878
251	Ga0495588_0270313	3300046674	Bacteria	896
252	Ga0495657_0162568	3300046675	Bacteria	1381
253	Ga0495658_0216956	3300046683	Bacteria	1197
254	Ga0495658_0250045	3300046683	Bacteria	1115
255	Ga0495672_0032849	3300047320	Bacteria	3221
256	Ga0495686_0182422	3300047472	Bacteria	1215
257	Ga0496100_0140163	3300048903	Bacteria	1713
258	Ga0496100_0321462	3300048903	Bacteria	1162
259	Ga0496101_0174653	3300048904	Bacteria	1652
260	Ga0496101_0879023	3300048904	Bacteria	706
261	Ga0496102_0050844	3300048905	Bacteria	3775
262	Ga0496102_0063643	3300048905	Bacteria	3378
263	Ga0496102_0371458	3300048905	Bacteria	1346
264	Ga0496103_0153212	3300048906	Bacteria	1477
265	Ga0496104_0084600	3300048907	Bacteria	3027
266	Ga0496104_0099620	3300048907	Bacteria	2782
267	Ga0496104_0109494	3300048907	Bacteria	2647
268	Ga0496104_0206264	3300048907	Bacteria	1877
269	Ga0496105_0001766	3300048908	Bacteria	15463
270	Ga0496105_0035365	3300048908	Bacteria	4111
271	Ga0496107_0365913	3300048910	Bacteria	1073
272	Ga0496108_0002520	3300048911	Bacteria	14655
273	Ga0496109_0025465	3300048912	Bacteria	5273
274	Ga0496109_0191774	3300048912	Bacteria	1920
275	Ga0496109_0504251	3300048912	Bacteria	1142
276	Ga0496110_0006460	3300048913	Bacteria	9289
277	Ga0496111_0055784	3300048914	Bacteria	2857
278	Ga0496111_0593104	3300048914	Bacteria	811
279	Ga0496112_0298476	3300048915	Bacteria	1557
280	Ga0496113_0029739	3300048916	Bacteria	3949
281	Ga0496113_0035406	3300048916	Bacteria	3650
282	Ga0496114_0009643	3300048917	Bacteria	7668
283	Ga0496114_0010999	3300048917	Bacteria	7215
284	Ga0496114_0034996	3300048917	Bacteria	4147
285	Ga0496114_0116862	3300048917	Bacteria	2290
286	Ga0496114_0151915	3300048917	Bacteria	2009
287	Ga0496114_0250841	3300048917	Bacteria	1557
288	Ga0496114_0409221	3300048917	Bacteria	1201
289	Ga0496114_0597386	3300048917	Bacteria	973
290	Ga0496115_0178569	3300048918	Bacteria	1755
291	Ga0496115_0370597	3300048918	Bacteria	1166
292	Ga0496115_0518904	3300048918	Bacteria	956
293	Ga0496117_0017549	3300048920	Bacteria	5972
294	Ga0496117_0029324	3300048920	Bacteria	4244
295	Ga0496118_0007953	3300048921	Bacteria	11092
296	Ga0496119_0007381	3300048922	Bacteria	9924
297	Ga0496119_0232267	3300048922	Bacteria	938
298	Ga0496120_0000929	3300048923	Bacteria	40563
299	Ga0496120_0002952	3300048923	Bacteria	16205
300	Ga0496121_0111778	3300048924	Bacteria	2082
301	Ga0496122_0008917	3300048925	Bacteria	10674
302	Ga0496123_0014939	3300048926	Bacteria	6400
303	Ga0496123_0019383	3300048926	Bacteria	5363
304	Ga0496124_0163173	3300048927	Bacteria	1735
305	Ga0496126_0030706	3300048929	Bacteria	5088
306	Ga0496126_0183094	3300048929	Bacteria	1778
307	Ga0496126_0336944	3300048929	Bacteria	1236
308	Ga0496126_0530056	3300048929	Bacteria	937
309	Ga0501032_0056123	3300049569	Bacteria	2648
310	Ga0501032_0102928	3300049569	Bacteria	1892
311	Ga0501032_0172085	3300049569	Bacteria	1420
312	Ga0501033_0008112	3300049570	Bacteria	8136
313	Ga0501033_0090898	3300049570	Bacteria	2233
314	Ga0501034_0011748	3300049571	Bacteria	9060
315	Ga0501034_0011946	3300049571	Bacteria	8975
316	Ga0501034_0018385	3300049571	Bacteria	7168
317	Ga0501034_0018651	3300049571	Bacteria	7111
318	Ga0501034_0021808	3300049571	Bacteria	6525
319	Ga0501034_0045602	3300049571	Bacteria	4429
320	Ga0501034_0053735	3300049571	Bacteria	4055
321	Ga0501034_0075882	3300049571	Bacteria	3368
322	Ga0501034_0169790	3300049571	Bacteria	2149
323	Ga0501034_0189349	3300049571	Bacteria	2020
324	Ga0501034_0259332	3300049571	Bacteria	1681
325	Ga0501036_0336495	3300049572	Bacteria	1261
326	Ga0501037_0158543	3300049573	Bacteria	1614
327	Ga0501037_0334053	3300049573	Bacteria	1047
328	Ga0501038_0001205	3300049574	Bacteria	23470
329	Ga0501039_0683309	3300049575	Bacteria	803
330	Ga0501043_0008333	3300049579	Bacteria	8160
331	Ga0501043_0640962	3300049579	Bacteria	781
332	Ga0501046_0024588	3300049580	Bacteria	4939
333	Ga0501047_0007594	3300049581	Bacteria	10203
334	Ga0501047_0012282	3300049581	Bacteria	8106
335	Ga0501047_0059386	3300049581	Bacteria	3692
336	Ga0501047_0487178	3300049581	Bacteria	1060
337	Ga0501048_0064286	3300049582	Bacteria	2595
338	Ga0501067_0069991	3300049583	Bacteria	1943
339	Ga0501069_0004194	3300049585	Bacteria	7449
340	Ga0501070_0000565	3300049586	Bacteria	33728
341	Ga0501070_0000938	3300049586	Bacteria	26321
342	Ga0501070_0004390	3300049586	Bacteria	12114
343	Ga0501070_0012534	3300049586	Bacteria	7151
344	Ga0501071_0000118	3300049587	Bacteria	31358
345	Ga0501072_0028572	3300049588	Bacteria	4354
346	Ga0501073_0000022	3300049589	Bacteria	130383
347	Ga0501073_0062100	3300049589	Bacteria	2606
348	Ga0501079_0102610	3300049741	Bacteria	2218
349	Ga0501080_0000833	3300049742	Bacteria	25169
350	Ga0501080_0454341	3300049742	Bacteria	1148
351	Ga0501080_0480385	3300049742	Bacteria	1112
352	Ga0501080_0614521	3300049742	Bacteria	964
353	Ga0501083_0021234	3300049744	Bacteria	4513
354	Ga0501083_0022438	3300049744	Bacteria	4381
355	Ga0501035_0009512	3300049822	Bacteria	9038
356	Ga0501044_0015089	3300049823	Bacteria	8324
357	Ga0501044_0076196	3300049823	Bacteria	3405
358	nmdc:mga00v17_11189_c1	3300050491	Bacteria	4928
359	nmdc:mga0yw44_102091_c1	3300050492	Bacteria	1828
360	nmdc:mga0yw44_40328_c1	3300050492	Bacteria	2773
361	nmdc:mga0yw44_8188_c2	3300050492	Bacteria	3111
362	nmdc:mga06z11_456851_c1	3300050494	Bacteria	772
363	nmdc:mga05p37_21304_c1	3300050507	Bacteria	7848
364	nmdc:mga09592_296152_c1	3300050508	Bacteria	1403
365	nmdc:mga0qj67_104811_c1	3300050509	Bacteria	2281
366	nmdc:mga08y16_144973_c1	3300050511	Bacteria	2469
367	nmdc:mga0n895_3892_c1	3300050512	Bacteria	12134
368	nmdc:mga0rr50_34119_c1	3300050513	Bacteria	3642
369	nmdc:mga0a205_6069_c1	3300050515	Bacteria	10896
370	nmdc:mga0sz30_3108_c2	3300050516	Bacteria	3868
371	Ga0500635_0000097	3300053080	Bacteria	52649
372	Ga0500643_001400	3300053087	Bacteria	13926
373	Ga0500643_007548	3300053087	Bacteria	4366
374	Ga0500556_0000145	3300053104	Bacteria	59342
375	Ga0500562_000291	3300053108	Bacteria	12248
376	Ga0500559_0000567	3300053136	Bacteria	25600
377	Ga0500568_0021831	3300053139	Bacteria	2749
378	Ga0500568_0078582	3300053139	Bacteria	1255
379	Ga0500573_0000024	3300053140	Bacteria	151713
380	Ga0500573_0002953	3300053140	Bacteria	8673
381	Ga0500573_0083436	3300053140	Bacteria	1814
382	Ga0500616_0000088	3300053153	Bacteria	191662
383	Ga0500616_0000495	3300053153	Bacteria	50619
384	Ga0500616_0098946	3300053153	Bacteria	1429
385	Ga0501084_0092716	3300054114	Bacteria	2536
386	Ga0501084_0106868	3300054114	Bacteria	2351
387	Ga0501084_0125586	3300054114	Bacteria	2159

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300026075	Ga0207708_10129010	Ga0207708_101290102	165
2	3300005327	Ga0070658_10058223	Ga0070658_100582232	183
3	3300036401	Ga0373937_0936206	Ga0373937_0936206_25_612	183
4	3300046455	Ga0495603_0139591	Ga0495603_0139591_586_1140	184
5	3300046674	Ga0495588_0270313	Ga0495588_0270313_173_727	184
6	3300046683	Ga0495658_0216956	Ga0495658_0216956_427_981	184
7	3300048903	Ga0496100_0140163	Ga0496100_0140163_547_1101	184
8	3300048905	Ga0496102_0063643	Ga0496102_0063643_1784_2338	184
9	3300048907	Ga0496104_0084600	Ga0496104_0084600_1453_2007	184
10	3300048908	Ga0496105_0001766	Ga0496105_0001766_1409_1963	184
11	3300048911	Ga0496108_0002520	Ga0496108_0002520_12132_12686	184
12	3300048912	Ga0496109_0191774	Ga0496109_0191774_144_698	184
13	3300048913	Ga0496110_0006460	Ga0496110_0006460_6811_7365	184
14	3300048914	Ga0496111_0055784	Ga0496111_0055784_1459_2013	184
15	3300048915	Ga0496112_0298476	Ga0496112_0298476_574_1128	184
16	3300048917	Ga0496114_0009643	Ga0496114_0009643_5564_6118	184
17	3300053087	Ga0500643_001400	Ga0500643_001400_10074_10715	186
18	3300025908	Ga0207643_10170265	Ga0207643_101702652	188
19	3300041452	Ga0451793_1595714	Ga0451793_1595714_203_772	189
20	3300042993	Ga0439440_0046488	Ga0439440_0046488_17_586	189
21	3300050494	nmdc:mga06z11_456851_c1	nmdc:mga06z11_456851_c1_44_685	190
22	3300046523	Ga0495644_0170115	Ga0495644_0170115_41_682	191
23	3300046615	Ga0495656_0043983	Ga0495656_0043983_460_1101	191
24	3300021388	Ga0213875_10046937	Ga0213875_100469372	192
25	3300013307	Ga0157372_10857512	Ga0157372_108575123	195
26	3300045976	Ga0466967_0384641	Ga0466967_0384641_366_953	195
27	3300048904	Ga0496101_0879023	Ga0496101_0879023_82_669	195
28	3300048918	Ga0496115_0518904	Ga0496115_0518904_71_658	195
29	3300053153	Ga0500616_0000088	Ga0500616_0000088_145193_145795	198
30	3300037068	Ga0373925_0549576	Ga0373925_0549576_180_821	201
31	3300046536	Ga0495587_0239102	Ga0495587_0239102_108_749	201
32	3300049571	Ga0501034_0021808	Ga0501034_0021808_3065_3682	205
33	3300048917	Ga0496114_0597386	Ga0496114_0597386_41_682	208
34	3300049569	Ga0501032_0172085	Ga0501032_0172085_599_1261	209
35	3300049570	Ga0501033_0090898	Ga0501033_0090898_900_1562	209
36	3300049571	Ga0501034_0018385	Ga0501034_0018385_1343_2005	209
37	3300049580	Ga0501046_0024588	Ga0501046_0024588_2004_2666	209
38	3300049581	Ga0501047_0007594	Ga0501047_0007594_741_1403	209
39	3300049823	Ga0501044_0076196	Ga0501044_0076196_1835_2497	209
40	iso_pu_bacteria	2643221616	2644096260	209
41	iso_pu_bacteria	2643221632	2644182128	209
42	iso_pu_bacteria	2643221690	2644504938	209
43	iso_pu_bacteria	2643221694	2644524569	209
44	iso_pu_bacteria	2643221722	2644668667	209
45	iso_pu_bacteria	2731639228	2731907612	209
46	iso_pu_bacteria	2799112218	2799184128	209
47	iso_pu_bacteria	2852643534	2852643711	209
48	iso_pu_bacteria	2857733635	2857736422	209
49	iso_pu_bacteria	2857737099	2857739283	209
50	iso_pu_bacteria	2884763398	2884764154	209
51	iso_pu_bacteria	2884994152	2884997882	209
52	iso_pu_bacteria	8057345674	8057349011	209
53	3300003214	JGI25165J46597_1000125	JGI25165J46597_100012584	213
54	3300003316	rootH1_10119943	rootH1_101199431	213
55	3300003760	Ga0055527_1000003	Ga0055527_1000003596	213
56	3300003762	Ga0055542_1000005	Ga0055542_1000005460	213
57	3300003763	Ga0055529_1000046	Ga0055529_1000046119	213
58	3300005327	Ga0070658_10000034	Ga0070658_1000003454	213
59	3300005327	Ga0070658_10032561	Ga0070658_100325613	213
60	3300005327	Ga0070658_10072415	Ga0070658_100724153	213
61	3300005329	Ga0070683_100004032	Ga0070683_1000040328	213
62	3300005329	Ga0070683_100091942	Ga0070683_1000919423	213
63	3300005334	Ga0068869_100240591	Ga0068869_1002405912	213
64	3300005337	Ga0070682_100206779	Ga0070682_1002067792	213
65	3300005337	Ga0070682_100330382	Ga0070682_1003303822	213
66	3300005338	Ga0068868_100038641	Ga0068868_1000386412	213
67	3300005338	Ga0068868_100239641	Ga0068868_1002396412	213
68	3300005344	Ga0070661_100120678	Ga0070661_1001206783	213
69	3300005347	Ga0070668_100164008	Ga0070668_1001640082	213
70	3300005354	Ga0070675_100097517	Ga0070675_1000975173	213
71	3300005364	Ga0070673_100573517	Ga0070673_1005735171	213
72	3300005366	Ga0070659_100000749	Ga0070659_10000074923	213
73	3300005366	Ga0070659_100121766	Ga0070659_1001217664	213
74	3300005366	Ga0070659_100531584	Ga0070659_1005315841	213
75	3300005367	Ga0070667_100025125	Ga0070667_1000251257	213
76	3300005367	Ga0070667_101200889	Ga0070667_1012008891	213
77	3300005434	Ga0070709_10046326	Ga0070709_100463262	213
78	3300005435	Ga0070714_100566489	Ga0070714_1005664891	213
79	3300005437	Ga0070710_10168786	Ga0070710_101687863	213
80	3300005456	Ga0070678_100055474	Ga0070678_1000554743	213
81	3300005457	Ga0070662_100207151	Ga0070662_1002071512	213
82	3300005466	Ga0070685_10023708	Ga0070685_100237083	213
83	3300005535	Ga0070684_100009574	Ga0070684_1000095744	213
84	3300005535	Ga0070684_100730338	Ga0070684_1007303381	213
85	3300005539	Ga0068853_100001645	Ga0068853_1000016452	213
86	3300005539	Ga0068853_100098926	Ga0068853_1000989262	213
87	3300005539	Ga0068853_100334594	Ga0068853_1003345943	213
88	3300005548	Ga0070665_100186061	Ga0070665_1001860613	213
89	3300005563	Ga0068855_100003924	Ga0068855_10000392414	213
90	3300005563	Ga0068855_100009335	Ga0068855_1000093356	213
91	3300005563	Ga0068855_100237478	Ga0068855_1002374782	213
92	3300005564	Ga0070664_100008041	Ga0070664_1000080417	213
93	3300005577	Ga0068857_100001028	Ga0068857_10000102818	213
94	3300005577	Ga0068857_100017779	Ga0068857_1000177794	213
95	3300005614	Ga0068856_100027232	Ga0068856_1000272327	213
96	3300005614	Ga0068856_100080073	Ga0068856_1000800732	213
97	3300005614	Ga0068856_100104794	Ga0068856_1001047943	213
98	3300005614	Ga0068856_100593718	Ga0068856_1005937181	213
99	3300005614	Ga0068856_100716712	Ga0068856_1007167122	213
100	3300005616	Ga0068852_100000501	Ga0068852_10000050116	213
101	3300005616	Ga0068852_100181706	Ga0068852_1001817063	213
102	3300005616	Ga0068852_100338518	Ga0068852_1003385181	213
103	3300005616	Ga0068852_100377020	Ga0068852_1003770202	213
104	3300005617	Ga0068859_100107171	Ga0068859_1001071714	213
105	3300005618	Ga0068864_100004094	Ga0068864_1000040941	213
106	3300005719	Ga0068861_100080880	Ga0068861_1000808801	213
107	3300005719	Ga0068861_100533148	Ga0068861_1005331482	213
108	3300005834	Ga0068851_10000008	Ga0068851_10000008159	213
109	3300005840	Ga0068870_10067544	Ga0068870_100675443	213
110	3300005841	Ga0068863_100020054	Ga0068863_1000200544	213
111	3300005842	Ga0068858_100000096	Ga0068858_10000009611	213
112	3300005983	Ga0081540_1001036	Ga0081540_100103623	213
113	3300005983	Ga0081540_1024040	Ga0081540_10240404	213
114	3300006038	Ga0075365_10056423	Ga0075365_100564232	213
115	3300006051	Ga0075364_10002073	Ga0075364_100020735	213
116	3300006058	Ga0075432_10009906	Ga0075432_100099064	213
117	3300006175	Ga0070712_100115874	Ga0070712_1001158742	213
118	3300006186	Ga0075369_10002965	Ga0075369_100029652	213
119	3300006844	Ga0075428_100023362	Ga0075428_1000233627	213
120	3300006844	Ga0075428_100139296	Ga0075428_1001392963	213
121	3300006846	Ga0075430_100125237	Ga0075430_1001252373	213
122	3300006847	Ga0075431_100010278	Ga0075431_1000102784	213
123	3300006852	Ga0075433_10027089	Ga0075433_100270898	213
124	3300006871	Ga0075434_100158210	Ga0075434_1001582103	213
125	3300006880	Ga0075429_100321819	Ga0075429_1003218192	213
126	3300006881	Ga0068865_100040815	Ga0068865_1000408153	213
127	3300006914	Ga0075436_100502815	Ga0075436_1005028151	213
128	3300006931	Ga0097620_100107172	Ga0097620_1001071723	213
129	3300007076	Ga0075435_100205163	Ga0075435_1002051633	213
130	3300009093	Ga0105240_10012630	Ga0105240_100126304	213
131	3300009093	Ga0105240_10096652	Ga0105240_100966524	213
132	3300009094	Ga0111539_10027872	Ga0111539_100278724	213
133	3300009098	Ga0105245_10054689	Ga0105245_100546894	213
134	3300009098	Ga0105245_10058830	Ga0105245_100588305	213
135	3300009098	Ga0105245_10095309	Ga0105245_100953092	213
136	3300009098	Ga0105245_10192726	Ga0105245_101927263	213
137	3300009098	Ga0105245_10427515	Ga0105245_104275152	213
138	3300009147	Ga0114129_10010064	Ga0114129_1001006416	213
139	3300009148	Ga0105243_10096661	Ga0105243_100966613	213
140	3300009148	Ga0105243_10281410	Ga0105243_102814103	213
141	3300009148	Ga0105243_10374605	Ga0105243_103746051	213
142	3300009174	Ga0105241_10015162	Ga0105241_100151624	213
143	3300009176	Ga0105242_10048970	Ga0105242_100489704	213
144	3300009177	Ga0105248_10061203	Ga0105248_100612036	213
145	3300009177	Ga0105248_10397362	Ga0105248_103973621	213
146	3300009545	Ga0105237_10000688	Ga0105237_1000068815	213
147	3300009551	Ga0105238_10107965	Ga0105238_101079652	213
148	3300009551	Ga0105238_10364173	Ga0105238_103641731	213
149	3300009551	Ga0105238_10746314	Ga0105238_107463142	213
150	3300009553	Ga0105249_10875207	Ga0105249_108752072	213
151	3300010375	Ga0105239_10167613	Ga0105239_101676134	213
152	3300010375	Ga0105239_10200131	Ga0105239_102001313	213
153	3300011119	Ga0105246_10071938	Ga0105246_100719384	213
154	3300013104	Ga0157370_10081233	Ga0157370_100812333	213
155	3300013104	Ga0157370_10855968	Ga0157370_108559681	213
156	3300013105	Ga0157369_10156600	Ga0157369_101566002	213
157	3300013105	Ga0157369_10481998	Ga0157369_104819982	213
158	3300013306	Ga0163162_10185640	Ga0163162_101856402	213
159	3300013306	Ga0163162_10241297	Ga0163162_102412972	213
160	3300013306	Ga0163162_10260650	Ga0163162_102606503	213
161	3300013306	Ga0163162_10680764	Ga0163162_106807642	213
162	3300013306	Ga0163162_10760427	Ga0163162_107604272	213
163	3300013307	Ga0157372_10790465	Ga0157372_107904652	213
164	3300013308	Ga0157375_10651678	Ga0157375_106516782	213
165	3300014325	Ga0163163_10098487	Ga0163163_100984872	213
166	3300014326	Ga0157380_10019622	Ga0157380_100196223	213
167	3300014326	Ga0157380_11020353	Ga0157380_110203532	213
168	3300014745	Ga0157377_10213627	Ga0157377_102136272	213
169	3300014968	Ga0157379_10005881	Ga0157379_100058813	213
170	3300014969	Ga0157376_10121326	Ga0157376_101213263	213
171	3300014969	Ga0157376_11111379	Ga0157376_111113791	213
172	3300017792	Ga0163161_10239934	Ga0163161_102399341	213
173	3300025228	Ga0209672_100003	Ga0209672_1000031434	213
174	3300025229	Ga0209147_100646	Ga0209147_1006465	213
175	3300025231	Ga0207427_100039	Ga0207427_100039131	213
176	3300025233	Ga0209437_100922	Ga0209437_1009227	213
177	3300025242	Ga0209258_106238	Ga0209258_1062382	213
178	3300025254	Ga0209148_1000004	Ga0209148_10000041729	213
179	3300025254	Ga0209148_1001379	Ga0209148_100137911	213
180	3300025261	Ga0209233_1000014	Ga0209233_1000014387	213
181	3300025272	Ga0209455_1000080	Ga0209455_1000080185	213
182	3300025321	Ga0207656_10000005	Ga0207656_10000005160	213
183	3300025321	Ga0207656_10200984	Ga0207656_102009841	213
184	3300025898	Ga0207692_10384577	Ga0207692_103845771	213
185	3300025900	Ga0207710_10029692	Ga0207710_100296924	213
186	3300025901	Ga0207688_10019216	Ga0207688_100192162	213
187	3300025904	Ga0207647_10028416	Ga0207647_100284165	213
188	3300025906	Ga0207699_10041240	Ga0207699_100412404	213
189	3300025909	Ga0207705_10000001	Ga0207705_10000001271	213
190	3300025909	Ga0207705_10019591	Ga0207705_100195917	213
191	3300025909	Ga0207705_10194495	Ga0207705_101944954	213
192	3300025911	Ga0207654_10000001	Ga0207654_10000001703	213
193	3300025913	Ga0207695_10005054	Ga0207695_1000505412	213
194	3300025913	Ga0207695_10007931	Ga0207695_1000793113	213
195	3300025914	Ga0207671_10000016	Ga0207671_10000016300	213
196	3300025915	Ga0207693_10715304	Ga0207693_107153042	213
197	3300025919	Ga0207657_10013644	Ga0207657_100136444	213
198	3300025919	Ga0207657_10108402	Ga0207657_101084022	213
199	3300025924	Ga0207694_10000019	Ga0207694_10000019330	213
200	3300025924	Ga0207694_10284630	Ga0207694_102846302	213
201	3300025927	Ga0207687_10570831	Ga0207687_105708312	213
202	3300025929	Ga0207664_10459851	Ga0207664_104598512	213
203	3300025932	Ga0207690_10007267	Ga0207690_100072674	213
204	3300025933	Ga0207706_10370798	Ga0207706_103707982	213
205	3300025935	Ga0207709_10332467	Ga0207709_103324672	213
206	3300025937	Ga0207669_10027377	Ga0207669_100273773	213
207	3300025938	Ga0207704_10928304	Ga0207704_109283041	213
208	3300025940	Ga0207691_10043148	Ga0207691_100431483	213
209	3300025941	Ga0207711_10026964	Ga0207711_100269645	213
210	3300025941	Ga0207711_10034020	Ga0207711_100340206	213
211	3300025944	Ga0207661_10005545	Ga0207661_100055454	213
212	3300025944	Ga0207661_10231328	Ga0207661_102313283	213
213	3300025945	Ga0207679_10020782	Ga0207679_100207822	213
214	3300025949	Ga0207667_10000437	Ga0207667_1000043742	213
215	3300025949	Ga0207667_10001482	Ga0207667_100014828	213
216	3300025949	Ga0207667_10008673	Ga0207667_1000867310	213
217	3300025949	Ga0207667_10076993	Ga0207667_100769932	213
218	3300025949	Ga0207667_10391990	Ga0207667_103919902	213
219	3300025949	Ga0207667_10545204	Ga0207667_105452042	213
220	3300025960	Ga0207651_10556905	Ga0207651_105569052	213
221	3300025986	Ga0207658_10102844	Ga0207658_101028443	213
222	3300026023	Ga0207677_10057617	Ga0207677_100576172	213
223	3300026023	Ga0207677_10575425	Ga0207677_105754251	213
224	3300026035	Ga0207703_10001625	Ga0207703_1000162511	213
225	3300026035	Ga0207703_10166040	Ga0207703_101660403	213
226	3300026041	Ga0207639_10024131	Ga0207639_100241311	213
227	3300026067	Ga0207678_10091926	Ga0207678_100919263	213
228	3300026075	Ga0207708_10501263	Ga0207708_105012631	213
229	3300026078	Ga0207702_10091237	Ga0207702_100912373	213
230	3300026078	Ga0207702_10092921	Ga0207702_100929211	213
231	3300026078	Ga0207702_10203978	Ga0207702_102039782	213
232	3300026078	Ga0207702_10646039	Ga0207702_106460391	213
233	3300026088	Ga0207641_10469785	Ga0207641_104697852	213
234	3300026088	Ga0207641_10501271	Ga0207641_105012712	213
235	3300026089	Ga0207648_10235201	Ga0207648_102352013	213
236	3300026116	Ga0207674_10000405	Ga0207674_1000040523	213
237	3300026116	Ga0207674_10026086	Ga0207674_100260865	213
238	3300026116	Ga0207674_11209790	Ga0207674_112097901	213
239	3300026118	Ga0207675_100040787	Ga0207675_1000407875	213
240	3300026118	Ga0207675_100495430	Ga0207675_1004954302	213
241	3300026121	Ga0207683_10122690	Ga0207683_101226902	213
242	3300026121	Ga0207683_10268032	Ga0207683_102680322	213
243	3300026142	Ga0207698_10000078	Ga0207698_1000007837	213
244	3300026142	Ga0207698_10002109	Ga0207698_1000210914	213
245	3300026142	Ga0207698_10440356	Ga0207698_104403562	213
246	3300027907	Ga0207428_10003440	Ga0207428_1000344010	213
247	3300028379	Ga0268266_10401542	Ga0268266_104015421	213
248	3300028381	Ga0268264_10323309	Ga0268264_103233093	213
249	3300028794	Ga0307515_10073451	Ga0307515_100734514	213
250	3300031456	Ga0307513_10218990	Ga0307513_102189901	213
251	3300031852	Ga0307410_10913830	Ga0307410_109138301	213
252	3300035111	Ga0373923_0106421	Ga0373923_0106421_133_774	213
253	3300037418	Ga0395900_0061609	Ga0395900_0061609_691_1332	213
254	3300037466	Ga0395898_0000647	Ga0395898_0000647_58675_59316	213
255	3300038443	Ga0395901_0347797	Ga0395901_0347797_378_1019	213
256	3300041451	Ga0451791_1284457	Ga0451791_1284457_621_1262	213
257	3300041452	Ga0451793_1009035	Ga0451793_1009035_51_692	213
258	3300041452	Ga0451793_1150781	Ga0451793_1150781_221_862	213
259	3300041452	Ga0451793_1155980	Ga0451793_1155980_555_1196	213
260	3300041453	Ga0451797_0863885	Ga0451797_0863885_354_995	213
261	3300041453	Ga0451797_1184574	Ga0451797_1184574_1115_1756	213
262	3300041462	Ga0451806_713397	Ga0451806_713397_455_1096	213
263	3300041498	Ga0451841_0963914	Ga0451841_0963914_268_909	213
264	3300041505	Ga0451849_0003252	Ga0451849_0003252_122_763	213
265	3300041511	Ga0451855_0700972	Ga0451855_0700972_318_959	213
266	3300041512	Ga0451853_2495528	Ga0451853_2495528_600_1241	213
267	3300042437	Ga0439444_0083674	Ga0439444_0083674_27_668	213
268	3300042461	Ga0439460_0061907	Ga0439460_0061907_432_1073	213
269	3300044683	Ga0466965_0000003	Ga0466965_0000003_95822_96463	213
270	3300044683	Ga0466965_0146027	Ga0466965_0146027_64_705	213
271	3300044683	Ga0466965_0173132	Ga0466965_0173132_162_803	213
272	3300044693	Ga0466961_0030204	Ga0466961_0030204_1142_1819	213
273	3300044693	Ga0466961_0091196	Ga0466961_0091196_97_738	213
274	3300044694	Ga0466963_0026613	Ga0466963_0026613_2875_3516	213
275	3300044706	Ga0466964_0098291	Ga0466964_0098291_63_704	213
276	3300044765	Ga0466970_0024861	Ga0466970_0024861_1527_2204	213
277	3300044765	Ga0466970_0092065	Ga0466970_0092065_165_806	213
278	3300044765	Ga0466970_0378817	Ga0466970_0378817_142_783	213
279	3300044901	Ga0466960_0102700	Ga0466960_0102700_478_1119	213
280	3300044901	Ga0466960_0246585	Ga0466960_0246585_158_799	213
281	3300045049	Ga0466959_0044445	Ga0466959_0044445_2445_3122	213
282	3300045049	Ga0466959_0448164	Ga0466959_0448164_163_804	213
283	3300045836	Ga0466958_0168912	Ga0466958_0168912_688_1329	213
284	3300045976	Ga0466967_0007038	Ga0466967_0007038_87_728	213
285	3300046463	Ga0495653_0128393	Ga0495653_0128393_364_1005	213
286	3300046511	Ga0495608_0135684	Ga0495608_0135684_399_1040	213
287	3300046516	Ga0495628_0301068	Ga0495628_0301068_504_1145	213
288	3300046543	Ga0495645_0219173	Ga0495645_0219173_56_697	213
289	3300046675	Ga0495657_0162568	Ga0495657_0162568_172_813	213
290	3300046683	Ga0495658_0250045	Ga0495658_0250045_421_1062	213
291	3300047320	Ga0495672_0032849	Ga0495672_0032849_326_967	213
292	3300047472	Ga0495686_0182422	Ga0495686_0182422_477_1118	213
293	3300048903	Ga0496100_0321462	Ga0496100_0321462_244_885	213
294	3300048904	Ga0496101_0174653	Ga0496101_0174653_323_964	213
295	3300048905	Ga0496102_0050844	Ga0496102_0050844_1808_2449	213
296	3300048905	Ga0496102_0371458	Ga0496102_0371458_408_1049	213
297	3300048906	Ga0496103_0153212	Ga0496103_0153212_799_1440	213
298	3300048907	Ga0496104_0099620	Ga0496104_0099620_433_1074	213
299	3300048907	Ga0496104_0109494	Ga0496104_0109494_570_1211	213
300	3300048907	Ga0496104_0206264	Ga0496104_0206264_130_771	213
301	3300048908	Ga0496105_0035365	Ga0496105_0035365_2418_3059	213
302	3300048910	Ga0496107_0365913	Ga0496107_0365913_271_912	213
303	3300048912	Ga0496109_0025465	Ga0496109_0025465_1350_1991	213
304	3300048912	Ga0496109_0504251	Ga0496109_0504251_489_1130	213
305	3300048914	Ga0496111_0593104	Ga0496111_0593104_87_728	213
306	3300048916	Ga0496113_0029739	Ga0496113_0029739_1716_2357	213
307	3300048916	Ga0496113_0035406	Ga0496113_0035406_2000_2641	213
308	3300048917	Ga0496114_0010999	Ga0496114_0010999_5973_6614	213
309	3300048917	Ga0496114_0034996	Ga0496114_0034996_2378_3019	213
310	3300048917	Ga0496114_0116862	Ga0496114_0116862_1241_1882	213
311	3300048917	Ga0496114_0151915	Ga0496114_0151915_41_682	213
312	3300048917	Ga0496114_0250841	Ga0496114_0250841_509_1150	213
313	3300048917	Ga0496114_0409221	Ga0496114_0409221_414_1055	213
314	3300048918	Ga0496115_0178569	Ga0496115_0178569_889_1530	213
315	3300048918	Ga0496115_0370597	Ga0496115_0370597_181_822	213
316	3300048920	Ga0496117_0017549	Ga0496117_0017549_3283_3924	213
317	3300048920	Ga0496117_0029324	Ga0496117_0029324_1903_2556	213
318	3300048921	Ga0496118_0007953	Ga0496118_0007953_8278_8919	213
319	3300048922	Ga0496119_0007381	Ga0496119_0007381_3981_4634	213
320	3300048922	Ga0496119_0232267	Ga0496119_0232267_89_730	213
321	3300048923	Ga0496120_0000929	Ga0496120_0000929_34616_35269	213
322	3300048923	Ga0496120_0002952	Ga0496120_0002952_11049_11726	213
323	3300048924	Ga0496121_0111778	Ga0496121_0111778_999_1640	213
324	3300048925	Ga0496122_0008917	Ga0496122_0008917_4010_4651	213
325	3300048926	Ga0496123_0014939	Ga0496123_0014939_2131_2772	213
326	3300048926	Ga0496123_0019383	Ga0496123_0019383_3502_4158	213
327	3300048927	Ga0496124_0163173	Ga0496124_0163173_248_889	213
328	3300048929	Ga0496126_0030706	Ga0496126_0030706_3993_4634	213
329	3300048929	Ga0496126_0183094	Ga0496126_0183094_654_1295	213
330	3300048929	Ga0496126_0336944	Ga0496126_0336944_508_1149	213
331	3300048929	Ga0496126_0530056	Ga0496126_0530056_147_788	213
332	3300049569	Ga0501032_0056123	Ga0501032_0056123_221_862	213
333	3300049569	Ga0501032_0102928	Ga0501032_0102928_338_979	213
334	3300049570	Ga0501033_0008112	Ga0501033_0008112_4460_5101	213
335	3300049571	Ga0501034_0011748	Ga0501034_0011748_2634_3293	213
336	3300049571	Ga0501034_0011946	Ga0501034_0011946_5644_6285	213
337	3300049571	Ga0501034_0018651	Ga0501034_0018651_312_953	213
338	3300049571	Ga0501034_0045602	Ga0501034_0045602_1908_2549	213
339	3300049571	Ga0501034_0053735	Ga0501034_0053735_2803_3444	213
340	3300049571	Ga0501034_0075882	Ga0501034_0075882_2212_2853	213
341	3300049571	Ga0501034_0169790	Ga0501034_0169790_1256_1897	213
342	3300049571	Ga0501034_0189349	Ga0501034_0189349_382_1023	213
343	3300049571	Ga0501034_0259332	Ga0501034_0259332_360_1001	213
344	3300049572	Ga0501036_0336495	Ga0501036_0336495_20_661	213
345	3300049573	Ga0501037_0158543	Ga0501037_0158543_189_830	213
346	3300049573	Ga0501037_0334053	Ga0501037_0334053_73_714	213
347	3300049574	Ga0501038_0001205	Ga0501038_0001205_15133_15774	213
348	3300049575	Ga0501039_0683309	Ga0501039_0683309_31_672	213
349	3300049579	Ga0501043_0008333	Ga0501043_0008333_3126_3767	213
350	3300049579	Ga0501043_0640962	Ga0501043_0640962_31_672	213
351	3300049581	Ga0501047_0012282	Ga0501047_0012282_1358_1999	213
352	3300049581	Ga0501047_0059386	Ga0501047_0059386_192_833	213
353	3300049581	Ga0501047_0487178	Ga0501047_0487178_30_671	213
354	3300049582	Ga0501048_0064286	Ga0501048_0064286_419_1060	213
355	3300049583	Ga0501067_0069991	Ga0501067_0069991_852_1493	213
356	3300049585	Ga0501069_0004194	Ga0501069_0004194_2023_2682	213
357	3300049586	Ga0501070_0000565	Ga0501070_0000565_9642_10301	213
358	3300049586	Ga0501070_0000938	Ga0501070_0000938_7472_8113	213
359	3300049586	Ga0501070_0004390	Ga0501070_0004390_11463_12104	213
360	3300049586	Ga0501070_0012534	Ga0501070_0012534_4740_5381	213
361	3300049587	Ga0501071_0000118	Ga0501071_0000118_14783_15442	213
362	3300049588	Ga0501072_0028572	Ga0501072_0028572_3019_3660	213
363	3300049589	Ga0501073_0000022	Ga0501073_0000022_112052_112693	213
364	3300049589	Ga0501073_0062100	Ga0501073_0062100_11_652	213
365	3300049741	Ga0501079_0102610	Ga0501079_0102610_1352_1993	213
366	3300049742	Ga0501080_0000833	Ga0501080_0000833_18934_19575	213
367	3300049742	Ga0501080_0454341	Ga0501080_0454341_82_723	213
368	3300049742	Ga0501080_0480385	Ga0501080_0480385_95_736	213
369	3300049742	Ga0501080_0614521	Ga0501080_0614521_78_719	213
370	3300049744	Ga0501083_0021234	Ga0501083_0021234_3156_3797	213
371	3300049744	Ga0501083_0022438	Ga0501083_0022438_1050_1691	213
372	3300049822	Ga0501035_0009512	Ga0501035_0009512_3185_3826	213
373	3300049823	Ga0501044_0015089	Ga0501044_0015089_1681_2322	213
374	3300050491	nmdc:mga00v17_11189_c1	nmdc:mga00v17_11189_c1_917_1558	213
375	3300050492	nmdc:mga0yw44_102091_c1	nmdc:mga0yw44_102091_c1_1094_1735	213
376	3300050492	nmdc:mga0yw44_40328_c1	nmdc:mga0yw44_40328_c1_1169_1810	213
377	3300050492	nmdc:mga0yw44_8188_c2	nmdc:mga0yw44_8188_c2_2177_2818	213
378	3300050507	nmdc:mga05p37_21304_c1	nmdc:mga05p37_21304_c1_4576_5217	213
379	3300050508	nmdc:mga09592_296152_c1	nmdc:mga09592_296152_c1_133_774	213
380	3300050509	nmdc:mga0qj67_104811_c1	nmdc:mga0qj67_104811_c1_750_1391	213
381	3300050511	nmdc:mga08y16_144973_c1	nmdc:mga08y16_144973_c1_306_947	213
382	3300050512	nmdc:mga0n895_3892_c1	nmdc:mga0n895_3892_c1_154_795	213
383	3300050513	nmdc:mga0rr50_34119_c1	nmdc:mga0rr50_34119_c1_422_1063	213
384	3300050515	nmdc:mga0a205_6069_c1	nmdc:mga0a205_6069_c1_3894_4535	213
385	3300050516	nmdc:mga0sz30_3108_c2	nmdc:mga0sz30_3108_c2_2468_3109	213
386	3300053080	Ga0500635_0000097	Ga0500635_0000097_47097_47738	213
387	3300053087	Ga0500643_007548	Ga0500643_007548_1899_2540	213
388	3300053104	Ga0500556_0000145	Ga0500556_0000145_29988_30629	213
389	3300053108	Ga0500562_000291	Ga0500562_000291_3594_4235	213
390	3300053136	Ga0500559_0000567	Ga0500559_0000567_10000_10641	213
391	3300053139	Ga0500568_0021831	Ga0500568_0021831_1552_2193	213
392	3300053139	Ga0500568_0078582	Ga0500568_0078582_96_737	213
393	3300053140	Ga0500573_0000024	Ga0500573_0000024_75196_75837	213
394	3300053140	Ga0500573_0002953	Ga0500573_0002953_6330_6971	213
395	3300053140	Ga0500573_0083436	Ga0500573_0083436_56_697	213
396	3300053153	Ga0500616_0000495	Ga0500616_0000495_33267_33908	213
397	3300053153	Ga0500616_0098946	Ga0500616_0098946_135_776	213
398	3300054114	Ga0501084_0092716	Ga0501084_0092716_1682_2323	213
399	3300054114	Ga0501084_0106868	Ga0501084_0106868_283_924	213
400	3300054114	Ga0501084_0125586	Ga0501084_0125586_919_1578	213

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

18

105

0.95 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5hs9-assembly1.cif.gz_A	crystal structure of the quinone-bound yodb from b. subtilis	0.9385	12	97
7kd3-assembly1.cif.gz_B	structure of an hxlr/duf24 family transcription regulator, cdtr_3200 from hypervirulent clostridioides difficile r20291	0.9298	12	97
7bze-assembly1.cif.gz_A-2	structure of bacillus subtilis hxlr, k13a mutant	0.9162	12	97
4a5n-assembly2.cif.gz_D	redoxregulator hypr in its reduced form	0.9082	10	97
5hs9-assembly1.cif.gz_B	crystal structure of the quinone-bound yodb from b. subtilis	0.904	8	97

ID	Description	Score	Start	End	Superfamily
5hs9A00	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9385	12	97	1.10.10.10
5hs9B00	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.904	8	97	1.10.10.10
af_P71983_1_102_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.8957	4	104	1.10.10.10
af_Q9VIH1_177_246_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.8854	36	80	1.10.10.10
2f2eB01	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.8807	14	97	1.10.10.10

ID	Description	Score	Start	End	GO Terms
AF-A0A7G9XQS0-F1-model_v4	Helix-turn-helix transcriptional regulator	0.973	1	213	GO:0003677
AF-A0A1X7JEE2-F1-model_v4	Transcriptional regulator, HxlR family	0.9723	1	213	GO:0003677
AF-A0A4Q7NR63-F1-model_v4	HxlR family transcriptional regulator	0.9662	1	213	GO:0003677
AF-A0A7J5UUW9-F1-model_v4	Transcriptional regulator	0.9657	1	212	GO:0003677
AF-A0A7J5UUW9-F1-model_v4	Transcriptional regulator	0.9569	1	212	GO:0003677

Feature Viewer

pLDDT	pTM	Quality
89.68	0.85	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F434642

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01638

HxlR

HxlR-like helix-turn-helix

18

105

0.95

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map