F434583

General Info

Members Datasets Scaffolds Average Seq Length
400 229 800 167

Family's Representative Sequence

Representative Sequence 3300025917|Ga0207660_10725310|Ga0207660_107253102
Length 194
Sequence MSRLLSRAVLVVTMLLSLCGLHQGASAQTANEPFIGQIMCAAFNFEPKGWLPLDGRLLAINVNQALFALLGTTYGGNGQTTFNLPNLRGQVPIHMGAGFTLGEAAGSSAVTITQQTMPQHIHFAQGSSNGGDTPTAVGNLLASALNVYRQADGLQNLEPTSLTNIGGSQPHNNMMPYLVLNFIIALQGIFPSQN

Samples

Sample ID Description Type Environment
1 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
128 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
141 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
142 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
153 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
154 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
155 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
156 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
165 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
166 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
167 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
168 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
169 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
170 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
171 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
172 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
173 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
174 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
175 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
176 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
177 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
178 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
179 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
180 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
181 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
182 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
183 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
184 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
185 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
186 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
187 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
188 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
189 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
190 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
191 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
192 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
193 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
194 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
195 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300060246 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87
Metatranscriptomes 13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 0
Rhizosphere 99.25
Stem 0
Stem Tuber 0
Unclassified 9.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207660_10725310 3300025917 Unclassified 811
2 CNAas_1000839 3300000532 Bacteria 2907
3 Ga0058863_11418228 3300004799 Bacteria 2209
4 Ga0058861_10094560 3300004800 Bacteria 2028
5 Ga0058862_11746648 3300004803 Bacteria 2008
6 Ga0065712_10521123 3300005290 Bacteria 630
7 Ga0065715_10006659 3300005293 Bacteria 5367
8 Ga0065715_10008980 3300005293 Unclassified 3973
9 Ga0065715_10100678 3300005293 Bacteria 3280
10 Ga0065715_10523068 3300005293 Bacteria 762
11 Ga0070676_10061669 3300005328 Bacteria 2229
12 Ga0070676_10067674 3300005328 Bacteria 2136
13 Ga0070676_10075972 3300005328 Bacteria 2027
14 Ga0070690_100101699 3300005330 Bacteria 1906
15 Ga0068869_100130689 3300005334 Bacteria 1930
16 Ga0068869_100614046 3300005334 Bacteria 920
17 Ga0070680_100000437 3300005336 Bacteria 28394
18 Ga0070680_100271370 3300005336 Viruses 1436
19 Ga0070680_100299618 3300005336 Unclassified 1363
20 Ga0070682_100001148 3300005337 Bacteria 15112
21 Ga0070682_100122797 3300005337 Bacteria 1746
22 Ga0070691_10334833 3300005341 Bacteria 836
23 Ga0070687_100000723 3300005343 Bacteria 10990
24 Ga0070692_10007688 3300005345 Bacteria 4765
25 Ga0070692_10086460 3300005345 Bacteria 1697
26 Ga0070692_10599508 3300005345 Bacteria 728
27 Ga0070692_10643174 3300005345 Viruses 707
28 Ga0070669_100029319 3300005353 Bacteria 3966
29 Ga0070669_100082056 3300005353 Bacteria 2403
30 Ga0070675_100544440 3300005354 Bacteria 1049
31 Ga0070675_100827321 3300005354 Bacteria 847
32 Ga0070675_100967315 3300005354 Bacteria 781
33 Ga0070671_100217127 3300005355 Bacteria 1622
34 Ga0070671_100318555 3300005355 Bacteria 1325
35 Ga0070673_100080603 3300005364 Unclassified 2638
36 Ga0070688_100444179 3300005365 Bacteria 968
37 Ga0070701_10096653 3300005438 Bacteria 1629
38 Ga0070701_10223927 3300005438 Viruses 1123
39 Ga0070701_10290794 3300005438 Viruses 1001
40 Ga0070701_10348325 3300005438 Bacteria 925
41 Ga0070705_100032854 3300005440 Bacteria 2887
42 Ga0070705_100161670 3300005440 Viruses 1498
43 Ga0070705_100314882 3300005440 Viruses 1127
44 Ga0070700_100000913 3300005441 Bacteria 14589
45 Ga0070700_100013797 3300005441 Bacteria 4545
46 Ga0070700_100019146 3300005441 Unclassified 3947
47 Ga0070700_100052111 3300005441 Bacteria 2550
48 Ga0070700_100257593 3300005441 Viruses 1255
49 Ga0070700_101073283 3300005441 Bacteria 666
50 Ga0070694_100007175 3300005444 Bacteria 6786
51 Ga0070694_100010258 3300005444 Bacteria 5771
52 Ga0070694_100014537 3300005444 Bacteria 4927
53 Ga0070694_100040275 3300005444 Bacteria 3114
54 Ga0070708_100293690 3300005445 Bacteria 1530
55 Ga0070662_100025708 3300005457 Unclassified 4069
56 Ga0070681_10000158 3300005458 Bacteria 52016
57 Ga0070681_10010318 3300005458 Bacteria 9221
58 Ga0068867_100074623 3300005459 Bacteria 2543
59 Ga0068867_100125715 3300005459 Unclassified 1987
60 Ga0070685_10000405 3300005466 Bacteria 25890
61 Ga0070698_100050963 3300005471 Bacteria 4218
62 Ga0070679_100000173 3300005530 Bacteria 51987
63 Ga0070679_101133676 3300005530 Bacteria 727
64 Ga0070684_101435721 3300005535 Bacteria 650
65 Ga0070697_100586488 3300005536 Bacteria 979
66 Ga0068853_100054950 3300005539 Bacteria 3431
67 Ga0070672_100237831 3300005543 Unclassified 1531
68 Ga0070695_100038159 3300005545 Bacteria 3029
69 Ga0070695_100038948 3300005545 Bacteria 3003
70 Ga0070695_100154886 3300005545 Bacteria 1603
71 Ga0070695_100304324 3300005545 Unclassified 1179
72 Ga0070695_100925804 3300005545 Bacteria 705
73 Ga0070696_100233297 3300005546 Bacteria 1385
74 Ga0070693_100199880 3300005547 Unclassified 1297
75 Ga0070693_100948293 3300005547 Bacteria 648
76 Ga0070704_100025493 3300005549 Bacteria 3894
77 Ga0070704_100053598 3300005549 Bacteria 2851
78 Ga0070704_100754511 3300005549 Bacteria 867
79 Ga0068857_100475364 3300005577 Bacteria 1171
80 Ga0068857_100606770 3300005577 Bacteria 1035
81 Ga0068857_100921403 3300005577 Bacteria 839
82 Ga0068854_100408636 3300005578 Bacteria 1125
83 Ga0068856_100006432 3300005614 Bacteria 11528
84 Ga0070702_100004924 3300005615 Bacteria 6154
85 Ga0070702_100069574 3300005615 Bacteria 2074
86 Ga0068852_100476916 3300005616 Viruses 1239
87 Ga0068859_100009955 3300005617 Bacteria 9589
88 Ga0068859_100021579 3300005617 Bacteria 6464
89 Ga0068859_100064193 3300005617 Bacteria 3704
90 Ga0068859_100068603 3300005617 Viruses 3580
91 Ga0068859_100096991 3300005617 Bacteria 3001
92 Ga0068859_100174698 3300005617 Viruses 2230
93 Ga0068859_100640996 3300005617 Bacteria 1155
94 Ga0068859_100704708 3300005617 Bacteria 1100
95 Ga0068864_100029006 3300005618 Unclassified 4681
96 Ga0068864_100049776 3300005618 Bacteria 3605
97 Ga0068864_100315949 3300005618 Bacteria 1466
98 Ga0068864_100642525 3300005618 Bacteria 1033
99 Ga0068864_100690279 3300005618 Viruses 997
100 Ga0068864_101428935 3300005618 Bacteria 694
101 Ga0068861_100025177 3300005719 Bacteria 4312
102 Ga0068861_100195726 3300005719 Bacteria 1693
103 Ga0068870_10028343 3300005840 Unclassified 2811
104 Ga0068870_10879297 3300005840 Bacteria 631
105 Ga0068863_100044247 3300005841 Bacteria 4226
106 Ga0068863_100117149 3300005841 Bacteria 2538
107 Ga0068863_100360975 3300005841 Bacteria 1416
108 Ga0068858_100327490 3300005842 Bacteria 1465
109 Ga0068860_100658234 3300005843 Bacteria 1055
110 Ga0068862_100023316 3300005844 Bacteria 5184
111 Ga0068862_100062670 3300005844 Unclassified 3198
112 Ga0081539_10083775 3300005985 Bacteria 1668
113 Ga0075364_10074465 3300006051 Bacteria 2239
114 Ga0097621_100000891 3300006237 Bacteria 20934
115 Ga0068871_100004032 3300006358 Bacteria 10144
116 Ga0068871_100016489 3300006358 Bacteria 5566
117 Ga0075428_100014452 3300006844 Bacteria 8768
118 Ga0075428_100134000 3300006844 Unclassified 2694
119 Ga0075431_100186937 3300006847 Bacteria 2124
120 Ga0075431_100854585 3300006847 Bacteria 881
121 Ga0075433_10239781 3300006852 Bacteria 1610
122 Ga0075434_100080442 3300006871 Bacteria 3255
123 Ga0075429_100329024 3300006880 Bacteria 1337
124 Ga0068865_100030480 3300006881 Bacteria 3588
125 Ga0075436_100382571 3300006914 Bacteria 1018
126 Ga0097620_100009955 3300006931 Bacteria 9589
127 Ga0097620_100021577 3300006931 Bacteria 6464
128 Ga0097620_100064191 3300006931 Bacteria 3704
129 Ga0097620_100068602 3300006931 Viruses 3580
130 Ga0097620_100096991 3300006931 Bacteria 3001
131 Ga0097620_100174699 3300006931 Viruses 2230
132 Ga0097620_100640970 3300006931 Bacteria 1155
133 Ga0097620_100704664 3300006931 Bacteria 1100
134 Ga0075435_100096547 3300007076 Bacteria 2445
135 Ga0105251_10028257 3300009011 Bacteria 2835
136 Ga0105240_10400151 3300009093 Viruses 1547
137 Ga0111539_10010768 3300009094 Bacteria 11513
138 Ga0111539_10020974 3300009094 Bacteria 8045
139 Ga0111539_10080774 3300009094 Bacteria 3824
140 Ga0111539_10123206 3300009094 Bacteria 3038
141 Ga0111539_10153258 3300009094 Bacteria 2697
142 Ga0111539_12574063 3300009094 Unclassified 590
143 Ga0105245_10657042 3300009098 Bacteria 1079
144 Ga0105245_11259360 3300009098 Bacteria 788
145 Ga0114129_10007892 3300009147 Bacteria 15148
146 Ga0114129_10048253 3300009147 Bacteria 5983
147 Ga0114129_10799959 3300009147 Viruses 1203
148 Ga0105243_10003627 3300009148 Bacteria 12434
149 Ga0105243_10290682 3300009148 Bacteria 1476
150 Ga0105243_10332362 3300009148 Viruses 1389
151 Ga0105241_10019067 3300009174 Bacteria 5059
152 Ga0105241_10090069 3300009174 Viruses 2419
153 Ga0105241_10457933 3300009174 Unclassified 1129
154 Ga0105241_10463743 3300009174 Bacteria 1123
155 Ga0105241_10835657 3300009174 Bacteria 851
156 Ga0105241_11139990 3300009174 Bacteria 736
157 Ga0105241_12017639 3300009174 Viruses 568
158 Ga0105242_10148862 3300009176 Bacteria 2039
159 Ga0105242_11175734 3300009176 Viruses 785
160 Ga0105248_10229449 3300009177 Bacteria 2090
161 Ga0105248_10312925 3300009177 Viruses 1769
162 Ga0105248_11395776 3300009177 Bacteria 792
163 Ga0105237_10013164 3300009545 Bacteria 8678
164 Ga0105237_10445279 3300009545 Bacteria 1301
165 Ga0105238_10015837 3300009551 Bacteria 7633
166 Ga0105238_11864229 3300009551 Bacteria 634
167 Ga0105249_10020367 3300009553 Bacteria 5930
168 Ga0105249_12272415 3300009553 Unclassified 615
169 Ga0105246_10005033 3300011119 Bacteria 8039
170 Ga0105246_10363565 3300011119 Bacteria 1190
171 Ga0157378_10028274 3300013297 Unclassified 4945
172 Ga0157378_10168304 3300013297 Bacteria 2054
173 Ga0157378_10329352 3300013297 Viruses 1486
174 Ga0157378_10344343 3300013297 Bacteria 1454
175 Ga0163162_10009723 3300013306 Bacteria 9361
176 Ga0163162_10091382 3300013306 Bacteria 3127
177 Ga0163162_10344160 3300013306 Unclassified 1624
178 Ga0163162_12659144 3300013306 Bacteria 576
179 Ga0157372_10534710 3300013307 Bacteria 1366
180 Ga0157372_10931724 3300013307 Unclassified 1007
181 Ga0157372_11100819 3300013307 Bacteria 919
182 Ga0157375_10028250 3300013308 Bacteria 5255
183 Ga0157375_10661521 3300013308 Viruses 1200
184 Ga0157375_11343120 3300013308 Bacteria 841
185 Ga0163163_10013210 3300014325 Bacteria 7549
186 Ga0163163_10151337 3300014325 Bacteria 2364
187 Ga0163163_10293069 3300014325 Bacteria 1679
188 Ga0163163_10492105 3300014325 Bacteria 1288
189 Ga0157380_10007130 3300014326 Bacteria 7920
190 Ga0157380_10086758 3300014326 Bacteria 2572
191 Ga0157377_10113070 3300014745 Bacteria 1635
192 Ga0163161_10021985 3300017792 Unclassified 4486
193 Ga0207713_1088735 3300025735 Viruses 1092
194 Ga0207682_10317997 3300025893 Bacteria 731
195 Ga0207647_10001140 3300025904 Bacteria 20474
196 Ga0207647_10414121 3300025904 Bacteria 758
197 Ga0207645_10028631 3300025907 Unclassified 3596
198 Ga0207645_10077570 3300025907 Bacteria 2129
199 Ga0207643_10008550 3300025908 Bacteria 5490
200 Ga0207643_10090462 3300025908 Viruses 1784
201 Ga0207654_10025603 3300025911 Bacteria 3184
202 Ga0207654_10588569 3300025911 Unclassified 793
203 Ga0207654_10792444 3300025911 Bacteria 684
204 Ga0207654_10866987 3300025911 Viruses 654
205 Ga0207707_10000072 3300025912 Bacteria 102454
206 Ga0207707_10093491 3300025912 Bacteria 2627
207 Ga0207695_10357413 3300025913 Viruses 1347
208 Ga0207671_10078418 3300025914 Bacteria 2474
209 Ga0207660_10000584 3300025917 Bacteria 24554
210 Ga0207660_10779947 3300025917 Bacteria 780
211 Ga0207662_10230648 3300025918 Viruses 1209
212 Ga0207662_10348850 3300025918 Bacteria 993
213 Ga0207652_10000083 3300025921 Bacteria 101957
214 Ga0207681_10006316 3300025923 Bacteria 7274
215 Ga0207681_10048967 3300025923 Unclassified 2855
216 Ga0207681_10082647 3300025923 Bacteria 2271
217 Ga0207694_10026015 3300025924 Bacteria 4449
218 Ga0207650_10193627 3300025925 Bacteria 1625
219 Ga0207659_10828844 3300025926 Bacteria 795
220 Ga0207644_10711955 3300025931 Bacteria 837
221 Ga0207706_10041838 3300025933 Unclassified 4061
222 Ga0207706_10656066 3300025933 Bacteria 898
223 Ga0207686_10083845 3300025934 Bacteria 2087
224 Ga0207686_11411182 3300025934 Unclassified 573
225 Ga0207709_10001808 3300025935 Bacteria 14284
226 Ga0207709_10510120 3300025935 Bacteria 940
227 Ga0207709_11088336 3300025935 Bacteria 656
228 Ga0207670_10428443 3300025936 Bacteria 1063
229 Ga0207704_10324430 3300025938 Viruses 1189
230 Ga0207689_10017403 3300025942 Unclassified 6082
231 Ga0207689_10651474 3300025942 Bacteria 887
232 Ga0207661_10636617 3300025944 Bacteria 980
233 Ga0207679_10198072 3300025945 Bacteria 1676
234 Ga0207679_10726553 3300025945 Bacteria 902
235 Ga0207651_10110661 3300025960 Bacteria 2061
236 Ga0207712_10057136 3300025961 Bacteria 2752
237 Ga0207640_10252481 3300025981 Bacteria 1370
238 Ga0207703_10046475 3300026035 Bacteria 3496
239 Ga0207703_10654487 3300026035 Unclassified 997
240 Ga0207703_10722380 3300026035 Bacteria 948
241 Ga0207639_10002910 3300026041 Bacteria 11510
242 Ga0207708_10002293 3300026075 Bacteria 14068
243 Ga0207708_10014151 3300026075 Bacteria 5965
244 Ga0207708_10019170 3300026075 Bacteria 5153
245 Ga0207708_10059024 3300026075 Bacteria 2928
246 Ga0207708_10110629 3300026075 Bacteria 2132
247 Ga0207708_10333679 3300026075 Viruses 1240
248 Ga0207702_10008531 3300026078 Bacteria 8638
249 Ga0207641_10034651 3300026088 Bacteria 4201
250 Ga0207641_10191274 3300026088 Bacteria 1881
251 Ga0207641_10535836 3300026088 Bacteria 1140
252 Ga0207648_10255252 3300026089 Viruses 1564
253 Ga0207676_10026494 3300026095 Viruses 4312
254 Ga0207676_10049356 3300026095 Bacteria 3273
255 Ga0207676_10536072 3300026095 Bacteria 1116
256 Ga0207676_10838190 3300026095 Bacteria 899
257 Ga0207676_11037059 3300026095 Bacteria 809
258 Ga0207676_11533884 3300026095 Bacteria 663
259 Ga0207674_10086626 3300026116 Bacteria 3126
260 Ga0207674_10126773 3300026116 Bacteria 2518
261 Ga0207674_10372860 3300026116 Bacteria 1379
262 Ga0207674_10951402 3300026116 Viruses 827
263 Ga0207675_100046935 3300026118 Bacteria 4034
264 Ga0207675_100566413 3300026118 Bacteria 1136
265 Ga0207428_10014710 3300027907 Bacteria 6781
266 Ga0207428_10059057 3300027907 Bacteria 3041
267 Ga0207428_10112964 3300027907 Bacteria 2089
268 Ga0268265_10007973 3300028380 Bacteria 7149
269 Ga0268265_10226300 3300028380 Bacteria 1640
270 Ga0268265_10544757 3300028380 Bacteria 1101
271 Ga0268265_11691869 3300028380 Unclassified 638
272 Ga0268264_10002589 3300028381 Bacteria 15820
273 Ga0268264_10090908 3300028381 Viruses 2632
274 Ga0268264_10841317 3300028381 Bacteria 919
275 Ga0265338_10000097 3300028800 Bacteria 161237
276 Ga0316177_1060249 3300030731 Bacteria 1247
277 Ga0316182_1103605 3300030745 Bacteria 595
278 Ga0265327_10028046 3300031251 Bacteria 3228
279 Ga0307408_100762577 3300031548 Bacteria 875
280 Ga0265314_10072280 3300031711 Bacteria 2305
281 Ga0307405_10127995 3300031731 Viruses 1750
282 Ga0307405_10839230 3300031731 Bacteria 773
283 Ga0307406_10956432 3300031901 Bacteria 732
284 Ga0307412_10171716 3300031911 Unclassified 1622
285 Ga0307412_11337576 3300031911 Bacteria 646
286 Ga0307416_100223796 3300032002 Viruses 1807
287 Ga0307415_100637447 3300032126 Bacteria 953
288 Ga0395900_0074762 3300037418 Bacteria 3483
289 Ga0395898_0085130 3300037466 Bacteria 3047
290 Ga0395901_0056632 3300038443 Bacteria 4078
291 Ga0242420_089889 3300038996 Viruses 643
292 Ga0439431_0109785 3300041997 Bacteria 763
293 Ga0439433_0060242 3300041999 Bacteria 904
294 Ga0466957_0000228 3300044842 Bacteria 26477
295 Ga0495643_0000286 3300046522 Bacteria 72166
296 Ga0495642_0244807 3300046528 Bacteria 784
297 Ga0501306_001322 3300049127 Bacteria 2295
298 Ga0501308_038447 3300049128 Bacteria 667
299 Ga0501309_007203 3300049129 Bacteria 1374
300 Ga0501310_001221 3300049130 Bacteria 2306
301 Ga0501305_007429 3300049161 Bacteria 1392
302 Ga0501307_000829 3300049162 Bacteria 2351
303 Ga0501307_021702 3300049162 Bacteria 840
304 Ga0501291_002189 3300049514 Bacteria 2319
305 Ga0501292_002347 3300049515 Bacteria 2433
306 Ga0501292_037300 3300049515 Unclassified 831
307 Ga0501293_005434 3300049516 Bacteria 1023
308 Ga0501295_035082 3300049518 Bacteria 1012
309 Ga0501311_003074 3300049527 Bacteria 1668
310 Ga0501312_001653 3300049528 Bacteria 2246
311 Ga0501317_005473 3300049533 Bacteria 1362
312 Ga0501318_004049 3300049534 Bacteria 1385
313 Ga0501321_025584 3300049537 Bacteria 762
314 Ga0501323_016011 3300049539 Bacteria 952
315 Ga0501323_023301 3300049539 Bacteria 830
316 Ga0501036_0890226 3300049572 Bacteria 731
317 Ga0501042_0958277 3300049578 Bacteria 623
318 Ga0501202_002316 3300049652 Bacteria 3188
319 Ga0501207_000807 3300049654 Bacteria 3704
320 Ga0501216_001264 3300049660 Bacteria 3376
321 Ga0501217_000471 3300049661 Bacteria 6612
322 Ga0501223_001215 3300049663 Bacteria 6024
323 Ga0501224_003402 3300049664 Bacteria 2216
324 Ga0501227_008334 3300049665 Bacteria 2224
325 Ga0501233_001737 3300049668 Bacteria 3754
326 Ga0501235_003127 3300049669 Bacteria 3569
327 Ga0501236_009430 3300049670 Bacteria 1259
328 Ga0501239_042480 3300049672 Bacteria 634
329 Ga0501240_000813 3300049673 Bacteria 2786
330 Ga0501242_010282 3300049674 Bacteria 1116
331 Ga0501243_010880 3300049675 Bacteria 1423
332 Ga0501247_000492 3300049677 Bacteria 3155
333 Ga0501249_003116 3300049679 Bacteria 3338
334 Ga0501253_002059 3300049683 Bacteria 2203
335 Ga0501257_000865 3300049686 Bacteria 6085
336 Ga0501259_013226 3300049688 Bacteria 1384
337 Ga0501259_124954 3300049688 Bacteria 615
338 Ga0501261_027574 3300049690 Bacteria 845
339 Ga0501221_014722 3300049704 Bacteria 1458
340 Ga0501225_0002335 3300049705 Bacteria 5851
341 Ga0501229_001892 3300049706 Bacteria 2454
342 Ga0501245_014580 3300049708 Bacteria 1174
343 Ga0501241_006368 3300049758 Bacteria 2172
344 Ga0501266_027966 3300049763 Bacteria 794
345 Ga0501268_002063 3300049765 Bacteria 2598
346 Ga0501273_000762 3300049770 Bacteria 2769
347 Ga0501283_001161 3300049779 Bacteria 3466
348 Ga0501204_003206 3300049850 Bacteria 1708
349 Ga0501212_001283 3300049851 Bacteria 2802
350 Ga0501226_001172 3300049853 Bacteria 3399
351 nmdc:mga00v17_58355_c1 3300050491 Bacteria 2364
352 nmdc:mga05p37_125917_c1 3300050507 Unclassified 3146
353 nmdc:mga05p37_166948_c1 3300050507 Bacteria 2686
354 nmdc:mga05p37_75530_c1 3300050507 Bacteria 4148
355 nmdc:mga09592_872155_c1 3300050508 Bacteria 758
356 nmdc:mga06r32_232335_c1 3300050510 Bacteria 1832
357 nmdc:mga06r32_833489_c1 3300050510 Bacteria 881
358 nmdc:mga08y16_23429_c1 3300050511 Bacteria 6522
359 nmdc:mga08y16_35247_c1 3300050511 Bacteria 5256
360 nmdc:mga08y16_35458_c1 3300050511 Bacteria 5238
361 nmdc:mga0n895_289481_c1 3300050512 Bacteria 1661
362 nmdc:mga0rr50_617110_c1 3300050513 Bacteria 925
363 nmdc:mga0a205_61742_c1 3300050515 Bacteria 3620
364 Ga0500628_000192 3300053129 Bacteria 11866
365 Ga0501084_1143151 3300054114 Bacteria 653
366 Ga0587084_024631 3300059477 Bacteria 927
367 Ga0587093_002138 3300059478 Bacteria 1793
368 Ga0587066_037935 3300059490 Bacteria 894
369 Ga0587070_008633 3300059491 Bacteria 1449
370 Ga0587070_048630 3300059491 Bacteria 839
371 Ga0587070_064671 3300059491 Bacteria 765
372 Ga0587077_007494 3300059493 Unclassified 1592
373 Ga0587077_031357 3300059493 Bacteria 1015
374 Ga0587080_040438 3300059503 Unclassified 848
375 Ga0587085_063296 3300059506 Bacteria 705
376 Ga0587086_002698 3300059507 Bacteria 1713
377 Ga0587086_017879 3300059507 Bacteria 939
378 Ga0587091_053750 3300059511 Unclassified 835
379 Ga0587092_008624 3300059512 Viruses 1351
380 Ga0587125_002832 3300059607 Bacteria 1427
381 Ga0587101_023903 3300059623 Bacteria 903
382 Ga0587109_024137 3300059624 Bacteria 1108
383 Ga0587117_002358 3300059627 Bacteria 1751
384 Ga0587117_005761 3300059627 Bacteria 1354
385 Ga0587117_052877 3300059627 Viruses 679
386 Ga0587062_002340 3300059639 Viruses 1790
387 Ga0587062_040333 3300059639 Bacteria 755
388 Ga0587068_009687 3300059641 Bacteria 1423
389 Ga0587068_051304 3300059641 Unclassified 773
390 Ga0587069_002954 3300059642 Bacteria 1786
391 Ga0587072_042182 3300059643 Bacteria 890
392 Ga0587078_012077 3300059646 Bacteria 1009
393 Ga0587100_002054 3300059648 Unclassified 1254
394 Ga0587100_010685 3300059648 Bacteria 778
395 Ga0587119_010675 3300059658 Bacteria 1045
396 Ga0587060_007334 3300060243 Bacteria 895
397 Ga0587081_01526 3300060246 Unclassified 1333
398 Ga0587111_0018801 3300060346 Bacteria 1304
399 Ga0587111_0037946 3300060346 Bacteria 1015
400 Ga0587111_0057635 3300060346 Bacteria 875
401 Ga0207660_10725310
402 CNAas_1000839
403 Ga0058863_11418228
404 Ga0058861_10094560
405 Ga0058862_11746648
406 Ga0065712_10521123
407 Ga0065715_10006659
408 Ga0065715_10008980
409 Ga0065715_10100678
410 Ga0065715_10523068
411 Ga0070676_10061669
412 Ga0070676_10067674
413 Ga0070676_10075972
414 Ga0070690_100101699
415 Ga0068869_100130689
416 Ga0068869_100614046
417 Ga0070680_100000437
418 Ga0070680_100271370
419 Ga0070680_100299618
420 Ga0070682_100001148
421 Ga0070682_100122797
422 Ga0070691_10334833
423 Ga0070687_100000723
424 Ga0070692_10007688
425 Ga0070692_10086460
426 Ga0070692_10599508
427 Ga0070692_10643174
428 Ga0070669_100029319
429 Ga0070669_100082056
430 Ga0070675_100544440
431 Ga0070675_100827321
432 Ga0070675_100967315
433 Ga0070671_100217127
434 Ga0070671_100318555
435 Ga0070673_100080603
436 Ga0070688_100444179
437 Ga0070701_10096653
438 Ga0070701_10223927
439 Ga0070701_10290794
440 Ga0070701_10348325
441 Ga0070705_100032854
442 Ga0070705_100161670
443 Ga0070705_100314882
444 Ga0070700_100000913
445 Ga0070700_100013797
446 Ga0070700_100019146
447 Ga0070700_100052111
448 Ga0070700_100257593
449 Ga0070700_101073283
450 Ga0070694_100007175
451 Ga0070694_100010258
452 Ga0070694_100014537
453 Ga0070694_100040275
454 Ga0070708_100293690
455 Ga0070662_100025708
456 Ga0070681_10000158
457 Ga0070681_10010318
458 Ga0068867_100074623
459 Ga0068867_100125715
460 Ga0070685_10000405
461 Ga0070698_100050963
462 Ga0070679_100000173
463 Ga0070679_101133676
464 Ga0070684_101435721
465 Ga0070697_100586488
466 Ga0068853_100054950
467 Ga0070672_100237831
468 Ga0070695_100038159
469 Ga0070695_100038948
470 Ga0070695_100154886
471 Ga0070695_100304324
472 Ga0070695_100925804
473 Ga0070696_100233297
474 Ga0070693_100199880
475 Ga0070693_100948293
476 Ga0070704_100025493
477 Ga0070704_100053598
478 Ga0070704_100754511
479 Ga0068857_100475364
480 Ga0068857_100606770
481 Ga0068857_100921403
482 Ga0068854_100408636
483 Ga0068856_100006432
484 Ga0070702_100004924
485 Ga0070702_100069574
486 Ga0068852_100476916
487 Ga0068859_100009955
488 Ga0068859_100021579
489 Ga0068859_100064193
490 Ga0068859_100068603
491 Ga0068859_100096991
492 Ga0068859_100174698
493 Ga0068859_100640996
494 Ga0068859_100704708
495 Ga0068864_100029006
496 Ga0068864_100049776
497 Ga0068864_100315949
498 Ga0068864_100642525
499 Ga0068864_100690279
500 Ga0068864_101428935
501 Ga0068861_100025177
502 Ga0068861_100195726
503 Ga0068870_10028343
504 Ga0068870_10879297
505 Ga0068863_100044247
506 Ga0068863_100117149
507 Ga0068863_100360975
508 Ga0068858_100327490
509 Ga0068860_100658234
510 Ga0068862_100023316
511 Ga0068862_100062670
512 Ga0081539_10083775
513 Ga0075364_10074465
514 Ga0097621_100000891
515 Ga0068871_100004032
516 Ga0068871_100016489
517 Ga0075428_100014452
518 Ga0075428_100134000
519 Ga0075431_100186937
520 Ga0075431_100854585
521 Ga0075433_10239781
522 Ga0075434_100080442
523 Ga0075429_100329024
524 Ga0068865_100030480
525 Ga0075436_100382571
526 Ga0097620_100009955
527 Ga0097620_100021577
528 Ga0097620_100064191
529 Ga0097620_100068602
530 Ga0097620_100096991
531 Ga0097620_100174699
532 Ga0097620_100640970
533 Ga0097620_100704664
534 Ga0075435_100096547
535 Ga0105251_10028257
536 Ga0105240_10400151
537 Ga0111539_10010768
538 Ga0111539_10020974
539 Ga0111539_10080774
540 Ga0111539_10123206
541 Ga0111539_10153258
542 Ga0111539_12574063
543 Ga0105245_10657042
544 Ga0105245_11259360
545 Ga0114129_10007892
546 Ga0114129_10048253
547 Ga0114129_10799959
548 Ga0105243_10003627
549 Ga0105243_10290682
550 Ga0105243_10332362
551 Ga0105241_10019067
552 Ga0105241_10090069
553 Ga0105241_10457933
554 Ga0105241_10463743
555 Ga0105241_10835657
556 Ga0105241_11139990
557 Ga0105241_12017639
558 Ga0105242_10148862
559 Ga0105242_11175734
560 Ga0105248_10229449
561 Ga0105248_10312925
562 Ga0105248_11395776
563 Ga0105237_10013164
564 Ga0105237_10445279
565 Ga0105238_10015837
566 Ga0105238_11864229
567 Ga0105249_10020367
568 Ga0105249_12272415
569 Ga0105246_10005033
570 Ga0105246_10363565
571 Ga0157378_10028274
572 Ga0157378_10168304
573 Ga0157378_10329352
574 Ga0157378_10344343
575 Ga0163162_10009723
576 Ga0163162_10091382
577 Ga0163162_10344160
578 Ga0163162_12659144
579 Ga0157372_10534710
580 Ga0157372_10931724
581 Ga0157372_11100819
582 Ga0157375_10028250
583 Ga0157375_10661521
584 Ga0157375_11343120
585 Ga0163163_10013210
586 Ga0163163_10151337
587 Ga0163163_10293069
588 Ga0163163_10492105
589 Ga0157380_10007130
590 Ga0157380_10086758
591 Ga0157377_10113070
592 Ga0163161_10021985
593 Ga0207713_1088735
594 Ga0207682_10317997
595 Ga0207647_10001140
596 Ga0207647_10414121
597 Ga0207645_10028631
598 Ga0207645_10077570
599 Ga0207643_10008550
600 Ga0207643_10090462
601 Ga0207654_10025603
602 Ga0207654_10588569
603 Ga0207654_10792444
604 Ga0207654_10866987
605 Ga0207707_10000072
606 Ga0207707_10093491
607 Ga0207695_10357413
608 Ga0207671_10078418
609 Ga0207660_10000584
610 Ga0207660_10779947
611 Ga0207662_10230648
612 Ga0207662_10348850
613 Ga0207652_10000083
614 Ga0207681_10006316
615 Ga0207681_10048967
616 Ga0207681_10082647
617 Ga0207694_10026015
618 Ga0207650_10193627
619 Ga0207659_10828844
620 Ga0207644_10711955
621 Ga0207706_10041838
622 Ga0207706_10656066
623 Ga0207686_10083845
624 Ga0207686_11411182
625 Ga0207709_10001808
626 Ga0207709_10510120
627 Ga0207709_11088336
628 Ga0207670_10428443
629 Ga0207704_10324430
630 Ga0207689_10017403
631 Ga0207689_10651474
632 Ga0207661_10636617
633 Ga0207679_10198072
634 Ga0207679_10726553
635 Ga0207651_10110661
636 Ga0207712_10057136
637 Ga0207640_10252481
638 Ga0207703_10046475
639 Ga0207703_10654487
640 Ga0207703_10722380
641 Ga0207639_10002910
642 Ga0207708_10002293
643 Ga0207708_10014151
644 Ga0207708_10019170
645 Ga0207708_10059024
646 Ga0207708_10110629
647 Ga0207708_10333679
648 Ga0207702_10008531
649 Ga0207641_10034651
650 Ga0207641_10191274
651 Ga0207641_10535836
652 Ga0207648_10255252
653 Ga0207676_10026494
654 Ga0207676_10049356
655 Ga0207676_10536072
656 Ga0207676_10838190
657 Ga0207676_11037059
658 Ga0207676_11533884
659 Ga0207674_10086626
660 Ga0207674_10126773
661 Ga0207674_10372860
662 Ga0207674_10951402
663 Ga0207675_100046935
664 Ga0207675_100566413
665 Ga0207428_10014710
666 Ga0207428_10059057
667 Ga0207428_10112964
668 Ga0268265_10007973
669 Ga0268265_10226300
670 Ga0268265_10544757
671 Ga0268265_11691869
672 Ga0268264_10002589
673 Ga0268264_10090908
674 Ga0268264_10841317
675 Ga0265338_10000097
676 Ga0316177_1060249
677 Ga0316182_1103605
678 Ga0265327_10028046
679 Ga0307408_100762577
680 Ga0265314_10072280
681 Ga0307405_10127995
682 Ga0307405_10839230
683 Ga0307406_10956432
684 Ga0307412_10171716
685 Ga0307412_11337576
686 Ga0307416_100223796
687 Ga0307415_100637447
688 Ga0395900_0074762
689 Ga0395898_0085130
690 Ga0395901_0056632
691 Ga0242420_089889
692 Ga0439431_0109785
693 Ga0439433_0060242
694 Ga0466957_0000228
695 Ga0495643_0000286
696 Ga0495642_0244807
697 Ga0501306_001322
698 Ga0501308_038447
699 Ga0501309_007203
700 Ga0501310_001221
701 Ga0501305_007429
702 Ga0501307_000829
703 Ga0501307_021702
704 Ga0501291_002189
705 Ga0501292_002347
706 Ga0501292_037300
707 Ga0501293_005434
708 Ga0501295_035082
709 Ga0501311_003074
710 Ga0501312_001653
711 Ga0501317_005473
712 Ga0501318_004049
713 Ga0501321_025584
714 Ga0501323_016011
715 Ga0501323_023301
716 Ga0501036_0890226
717 Ga0501042_0958277
718 Ga0501202_002316
719 Ga0501207_000807
720 Ga0501216_001264
721 Ga0501217_000471
722 Ga0501223_001215
723 Ga0501224_003402
724 Ga0501227_008334
725 Ga0501233_001737
726 Ga0501235_003127
727 Ga0501236_009430
728 Ga0501239_042480
729 Ga0501240_000813
730 Ga0501242_010282
731 Ga0501243_010880
732 Ga0501247_000492
733 Ga0501249_003116
734 Ga0501253_002059
735 Ga0501257_000865
736 Ga0501259_013226
737 Ga0501259_124954
738 Ga0501261_027574
739 Ga0501221_014722
740 Ga0501225_0002335
741 Ga0501229_001892
742 Ga0501245_014580
743 Ga0501241_006368
744 Ga0501266_027966
745 Ga0501268_002063
746 Ga0501273_000762
747 Ga0501283_001161
748 Ga0501204_003206
749 Ga0501212_001283
750 Ga0501226_001172
751 nmdc:mga00v17_58355_c1
752 nmdc:mga05p37_125917_c1
753 nmdc:mga05p37_166948_c1
754 nmdc:mga05p37_75530_c1
755 nmdc:mga09592_872155_c1
756 nmdc:mga06r32_232335_c1
757 nmdc:mga06r32_833489_c1
758 nmdc:mga08y16_23429_c1
759 nmdc:mga08y16_35247_c1
760 nmdc:mga08y16_35458_c1
761 nmdc:mga0n895_289481_c1
762 nmdc:mga0rr50_617110_c1
763 nmdc:mga0a205_61742_c1
764 Ga0500628_000192
765 Ga0501084_1143151
766 Ga0587084_024631
767 Ga0587093_002138
768 Ga0587066_037935
769 Ga0587070_008633
770 Ga0587070_048630
771 Ga0587070_064671
772 Ga0587077_007494
773 Ga0587077_031357
774 Ga0587080_040438
775 Ga0587085_063296
776 Ga0587086_002698
777 Ga0587086_017879
778 Ga0587091_053750
779 Ga0587092_008624
780 Ga0587125_002832
781 Ga0587101_023903
782 Ga0587109_024137
783 Ga0587117_002358
784 Ga0587117_005761
785 Ga0587117_052877
786 Ga0587062_002340
787 Ga0587062_040333
788 Ga0587068_009687
789 Ga0587068_051304
790 Ga0587069_002954
791 Ga0587072_042182
792 Ga0587078_012077
793 Ga0587100_002054
794 Ga0587100_010685
795 Ga0587119_010675
796 Ga0587060_007334
797 Ga0587081_01526
798 Ga0587111_0018801
799 Ga0587111_0037946
800 Ga0587111_0057635

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

36

92

0.99

Map