F434566

General Info

Members Datasets Scaffolds Average Seq Length
400 212 800 276

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10817054|Ga0114129_108170542
Length 309
Sequence MKIRLWGTRGSLASSGPETAGDGSNTAAVEIVSAGGTILVLDAGTGIRRLGAAIDPSVERLDILLTHLHMHHIQGLGFFAPFFRPSGEIHVWGPASATMDLRTRLTRYLSPPLFPVRIRDLDARVVLHDAPEEPVTIGGFEVVAQHVIHPGPTVGYRISADGASVAYLPDHEPALGARRFPEGPRWTSGFDLASRVDLLIHDGQYSDDERAGRIGWGHSSVNEAVAFAELARVRRLILFHHDPSHSDAVLDELTEAARARGTSIEVPRARAASVSSSSMASLWEGSWWKRISRRTEADSANVTASLTEL

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
127 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
128 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
129 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
130 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
131 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
134 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
141 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
142 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
154 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.5
Rhizosphere 95.5
Stem 0
Stem Tuber 0
Unclassified 17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10817054 3300009147 Bacteria 1188
2 Ga0070683_100128000 3300005329 Bacteria 2401
3 Ga0070690_100096335 3300005330 Bacteria 1955
4 Ga0070670_100106626 3300005331 Bacteria 2414
5 Ga0070670_100299817 3300005331 Bacteria 1406
6 Ga0070666_10214183 3300005335 Bacteria 1357
7 Ga0068868_100032254 3300005338 Bacteria 4029
8 Ga0068868_100141544 3300005338 Bacteria 1975
9 Ga0070689_100002705 3300005340 Bacteria 11607
10 Ga0070689_100050888 3300005340 Bacteria 3201
11 Ga0070689_100339121 3300005340 Unclassified 1259
12 Ga0070687_100019368 3300005343 Bacteria 3164
13 Ga0070687_100033686 3300005343 Bacteria 2530
14 Ga0070661_100064403 3300005344 Bacteria 2694
15 Ga0070661_100115475 3300005344 Bacteria 2007
16 Ga0070692_10204475 3300005345 Bacteria 1158
17 Ga0070668_100352902 3300005347 Unclassified 1245
18 Ga0070669_100076396 3300005353 Bacteria 2486
19 Ga0070675_100026606 3300005354 Bacteria 4643
20 Ga0070675_100210261 3300005354 Bacteria 1691
21 Ga0070675_100214280 3300005354 Bacteria 1675
22 Ga0070674_100007642 3300005356 Bacteria 6385
23 Ga0070674_100337574 3300005356 Unclassified 1213
24 Ga0070673_100206568 3300005364 Bacteria 1694
25 Ga0070688_100085642 3300005365 Bacteria 2049
26 Ga0070659_100006009 3300005366 Bacteria 8753
27 Ga0070667_100108564 3300005367 Bacteria 2404
28 Ga0070667_100226189 3300005367 Unclassified 1667
29 Ga0070701_10001602 3300005438 Bacteria 8428
30 Ga0070701_10014806 3300005438 Bacteria 3584
31 Ga0070711_100170905 3300005439 Bacteria 1656
32 Ga0070700_100018721 3300005441 Bacteria 3984
33 Ga0070700_100045157 3300005441 Bacteria 2717
34 Ga0070694_100195726 3300005444 Bacteria 1504
35 Ga0070694_100206479 3300005444 Bacteria 1467
36 Ga0070708_100180258 3300005445 Unclassified 1974
37 Ga0070708_100180784 3300005445 Unclassified 1971
38 Ga0070708_100208078 3300005445 Unclassified 1833
39 Ga0070663_100188070 3300005455 Bacteria 1606
40 Ga0070663_100234553 3300005455 Unclassified 1446
41 Ga0070678_100240402 3300005456 Bacteria 1514
42 Ga0070662_100079622 3300005457 Bacteria 2437
43 Ga0070662_100278246 3300005457 Bacteria 1354
44 Ga0068867_100012831 3300005459 Bacteria 5930
45 Ga0070685_10014218 3300005466 Bacteria 4211
46 Ga0070706_100013224 3300005467 Bacteria 7633
47 Ga0070706_100014325 3300005467 Bacteria 7328
48 Ga0070706_100239740 3300005467 Bacteria 1693
49 Ga0070706_100240858 3300005467 Bacteria 1689
50 Ga0070707_100011595 3300005468 Bacteria 8223
51 Ga0070707_100027762 3300005468 Bacteria 5385
52 Ga0070707_100045194 3300005468 Bacteria 4215
53 Ga0070707_100297879 3300005468 Unclassified 1567
54 Ga0070698_100018697 3300005471 Bacteria 7295
55 Ga0070698_100043307 3300005471 Bacteria 4616
56 Ga0070699_100229860 3300005518 Unclassified 1654
57 Ga0070672_100010181 3300005543 Bacteria 6513
58 Ga0070672_100366748 3300005543 Bacteria 1230
59 Ga0070686_100003777 3300005544 Bacteria 8329
60 Ga0070686_100007252 3300005544 Bacteria 6176
61 Ga0070686_100034310 3300005544 Bacteria 3126
62 Ga0070695_100274668 3300005545 Bacteria 1236
63 Ga0070696_100164797 3300005546 Bacteria 1635
64 Ga0070693_100007495 3300005547 Bacteria 5335
65 Ga0070693_100040741 3300005547 Bacteria 2609
66 Ga0070704_100083839 3300005549 Bacteria 2354
67 Ga0070704_100333015 3300005549 Unclassified 1276
68 Ga0070664_100053776 3300005564 Unclassified 3414
69 Ga0068857_100164057 3300005577 Bacteria 2017
70 Ga0068857_100302962 3300005577 Bacteria 1473
71 Ga0068859_100038528 3300005617 Bacteria 4796
72 Ga0068859_100088411 3300005617 Unclassified 3148
73 Ga0068859_100207206 3300005617 Bacteria 2046
74 Ga0068859_100233467 3300005617 Unclassified 1928
75 Ga0068859_100308713 3300005617 Bacteria 1675
76 Ga0068859_100355822 3300005617 Bacteria 1559
77 Ga0068864_100058223 3300005618 Bacteria 3339
78 Ga0068864_100168858 3300005618 Bacteria 1993
79 Ga0068866_10078807 3300005718 Bacteria 1763
80 Ga0068861_100206074 3300005719 Bacteria 1654
81 Ga0068861_100272453 3300005719 Bacteria 1454
82 Ga0068870_10029273 3300005840 Bacteria 2773
83 Ga0068858_100059732 3300005842 Bacteria 3523
84 Ga0068860_100018853 3300005843 Bacteria 6704
85 Ga0068860_100033178 3300005843 Bacteria 4956
86 Ga0068860_100070391 3300005843 Unclassified 3326
87 Ga0068860_100097812 3300005843 Bacteria 2798
88 Ga0068860_100215819 3300005843 Unclassified 1862
89 Ga0068862_100022867 3300005844 Bacteria 5233
90 Ga0068862_100226132 3300005844 Unclassified 1696
91 Ga0075432_10057313 3300006058 Unclassified 1382
92 Ga0070712_100004352 3300006175 Bacteria 8729
93 Ga0097621_100195644 3300006237 Bacteria 1753
94 Ga0068871_100255140 3300006358 Bacteria 1528
95 Ga0075428_100044777 3300006844 Unclassified 4862
96 Ga0075428_100068423 3300006844 Bacteria 3884
97 Ga0075430_100006814 3300006846 Bacteria 9630
98 Ga0075430_100207091 3300006846 Unclassified 1628
99 Ga0075431_100011535 3300006847 Bacteria 8914
100 Ga0075431_100020810 3300006847 Bacteria 6704
101 Ga0075431_100329035 3300006847 Unclassified 1539
102 Ga0075433_10105060 3300006852 Bacteria 2502
103 Ga0075433_10222815 3300006852 Bacteria 1675
104 Ga0075434_100028687 3300006871 Bacteria 5471
105 Ga0075434_100152142 3300006871 Bacteria 2334
106 Ga0075434_100393124 3300006871 Bacteria 1407
107 Ga0075429_100092382 3300006880 Bacteria 2639
108 Ga0075429_100135571 3300006880 Bacteria 2154
109 Ga0068865_100046422 3300006881 Bacteria 2980
110 Ga0075436_100122156 3300006914 Bacteria 1823
111 Ga0097620_100038527 3300006931 Bacteria 4796
112 Ga0097620_100088409 3300006931 Unclassified 3148
113 Ga0097620_100207208 3300006931 Bacteria 2046
114 Ga0097620_100233472 3300006931 Unclassified 1928
115 Ga0097620_100308696 3300006931 Bacteria 1675
116 Ga0097620_100355809 3300006931 Bacteria 1559
117 Ga0075435_100002038 3300007076 Bacteria 13230
118 Ga0075435_100041176 3300007076 Bacteria 3692
119 Ga0075435_100057006 3300007076 Bacteria 3159
120 Ga0111539_10000236 3300009094 Bacteria 65842
121 Ga0111539_10011500 3300009094 Bacteria 11105
122 Ga0111539_10070995 3300009094 Bacteria 4110
123 Ga0111539_10157600 3300009094 Bacteria 2656
124 Ga0105245_10016224 3300009098 Bacteria 6493
125 Ga0105247_10003669 3300009101 Bacteria 9972
126 Ga0114129_10003070 3300009147 Bacteria 23421
127 Ga0114129_10016427 3300009147 Bacteria 10534
128 Ga0114129_10038856 3300009147 Bacteria 6710
129 Ga0114129_10076056 3300009147 Unclassified 4674
130 Ga0114129_10170098 3300009147 Bacteria 2971
131 Ga0114129_10692043 3300009147 Unclassified 1311
132 Ga0105243_10001933 3300009148 Bacteria 17647
133 Ga0105243_10004322 3300009148 Bacteria 11253
134 Ga0105242_10098245 3300009176 Unclassified 2476
135 Ga0105248_10302419 3300009177 Bacteria 1801
136 Ga0105237_10246666 3300009545 Bacteria 1788
137 Ga0105249_10020007 3300009553 Bacteria 5977
138 Ga0105249_10022489 3300009553 Bacteria 5648
139 Ga0105249_10034127 3300009553 Bacteria 4608
140 Ga0105249_10062852 3300009553 Bacteria 3409
141 Ga0105249_10086262 3300009553 Bacteria 2927
142 Ga0105249_10461747 3300009553 Unclassified 1310
143 Ga0105239_10007610 3300010375 Bacteria 12413
144 Ga0105239_10084447 3300010375 Bacteria 3497
145 Ga0157371_10148549 3300013102 Bacteria 1671
146 Ga0157378_10029499 3300013297 Bacteria 4843
147 Ga0157378_10154150 3300013297 Bacteria 2143
148 Ga0157378_10250430 3300013297 Bacteria 1695
149 Ga0163162_10016842 3300013306 Bacteria 7144
150 Ga0163162_10681948 3300013306 Bacteria 1150
151 Ga0157375_10002966 3300013308 Bacteria 14734
152 Ga0157375_10054468 3300013308 Bacteria 3940
153 Ga0157375_10130590 3300013308 Bacteria 2631
154 Ga0157375_10197628 3300013308 Bacteria 2166
155 Ga0163163_10009085 3300014325 Bacteria 8857
156 Ga0163163_10155446 3300014325 Bacteria 2331
157 Ga0157380_10130902 3300014326 Bacteria 2140
158 Ga0157380_10175672 3300014326 Unclassified 1876
159 Ga0157380_10382986 3300014326 Unclassified 1328
160 Ga0157377_10008058 3300014745 Bacteria 5123
161 Ga0157377_10043093 3300014745 Bacteria 2510
162 Ga0157379_10031191 3300014968 Bacteria 4748
163 Ga0157379_10062995 3300014968 Unclassified 3315
164 Ga0157379_10163648 3300014968 Bacteria 2008
165 Ga0157376_10137588 3300014969 Bacteria 2187
166 Ga0157376_10732245 3300014969 Bacteria 997
167 Ga0163161_10060765 3300017792 Bacteria 2751
168 Ga0207642_10040352 3300025899 Bacteria 2036
169 Ga0207710_10009133 3300025900 Bacteria 4173
170 Ga0207688_10005160 3300025901 Bacteria 7099
171 Ga0207688_10017146 3300025901 Bacteria 3936
172 Ga0207643_10004432 3300025908 Bacteria 7548
173 Ga0207643_10016409 3300025908 Bacteria 4041
174 Ga0207684_10012979 3300025910 Bacteria 7213
175 Ga0207684_10055372 3300025910 Bacteria 3365
176 Ga0207684_10177069 3300025910 Bacteria 1839
177 Ga0207693_10006160 3300025915 Bacteria 9950
178 Ga0207660_10116454 3300025917 Bacteria 2018
179 Ga0207662_10000235 3300025918 Bacteria 25730
180 Ga0207662_10021306 3300025918 Bacteria 3704
181 Ga0207657_10106755 3300025919 Bacteria 2316
182 Ga0207649_10282256 3300025920 Bacteria 1208
183 Ga0207646_10012724 3300025922 Bacteria 8074
184 Ga0207646_10053439 3300025922 Bacteria 3613
185 Ga0207646_10072471 3300025922 Bacteria 3077
186 Ga0207646_10259163 3300025922 Unclassified 1571
187 Ga0207650_10219550 3300025925 Bacteria 1529
188 Ga0207650_10400869 3300025925 Bacteria 1135
189 Ga0207659_10049857 3300025926 Bacteria 2971
190 Ga0207659_10152303 3300025926 Unclassified 1807
191 Ga0207706_10095365 3300025933 Unclassified 2617
192 Ga0207706_10131777 3300025933 Bacteria 2199
193 Ga0207706_10187885 3300025933 Bacteria 1814
194 Ga0207706_10220736 3300025933 Bacteria 1660
195 Ga0207709_10116923 3300025935 Bacteria 1794
196 Ga0207670_10408687 3300025936 Bacteria 1087
197 Ga0207669_10003428 3300025937 Bacteria 6858
198 Ga0207704_10166700 3300025938 Bacteria 1574
199 Ga0207691_10133052 3300025940 Bacteria 2195
200 Ga0207689_10020345 3300025942 Bacteria 5588
201 Ga0207689_10178497 3300025942 Bacteria 1751
202 Ga0207661_10433519 3300025944 Bacteria 1195
203 Ga0207679_10172031 3300025945 Bacteria 1784
204 Ga0207712_10018747 3300025961 Bacteria 4511
205 Ga0207712_10061169 3300025961 Bacteria 2672
206 Ga0207712_10074012 3300025961 Bacteria 2459
207 Ga0207712_10260234 3300025961 Bacteria 1407
208 Ga0207658_10105496 3300025986 Unclassified 2217
209 Ga0207658_10334644 3300025986 Unclassified 1314
210 Ga0207677_10083879 3300026023 Bacteria 2295
211 Ga0207703_10563990 3300026035 Unclassified 1075
212 Ga0207678_10159614 3300026067 Bacteria 1926
213 Ga0207678_10217235 3300026067 Unclassified 1636
214 Ga0207708_10003096 3300026075 Bacteria 12243
215 Ga0207708_10010810 3300026075 Bacteria 6786
216 Ga0207648_10005704 3300026089 Bacteria 12479
217 Ga0207648_10023948 3300026089 Bacteria 5457
218 Ga0207648_10572502 3300026089 Bacteria 1039
219 Ga0207676_10079564 3300026095 Bacteria 2658
220 Ga0207676_10135206 3300026095 Bacteria 2102
221 Ga0207676_10268376 3300026095 Bacteria 1544
222 Ga0207674_10013889 3300026116 Bacteria 8911
223 Ga0207674_10066582 3300026116 Bacteria 3628
224 Ga0207674_10183495 3300026116 Bacteria 2043
225 Ga0207675_100172744 3300026118 Unclassified 2066
226 Ga0207675_100364814 3300026118 Bacteria 1418
227 Ga0207683_10003546 3300026121 Bacteria 13608
228 Ga0207683_10022469 3300026121 Bacteria 5415
229 Ga0207698_10106184 3300026142 Bacteria 2341
230 Ga0209983_1015449 3300027665 Bacteria 1575
231 Ga0209998_10001037 3300027717 Bacteria 6978
232 Ga0209974_10025914 3300027876 Bacteria 1941
233 Ga0207428_10000280 3300027907 Bacteria 68712
234 Ga0207428_10095670 3300027907 Bacteria 2301
235 Ga0207428_10217090 3300027907 Bacteria 1435
236 Ga0268265_10041523 3300028380 Bacteria 3405
237 Ga0268265_10300013 3300028380 Bacteria 1446
238 Ga0268264_10073897 3300028381 Bacteria 2895
239 Ga0268264_10084297 3300028381 Bacteria 2724
240 Ga0268264_10137925 3300028381 Unclassified 2171
241 Ga0268264_10254228 3300028381 Bacteria 1634
242 Ga0268264_10301526 3300028381 Bacteria 1508
243 Ga0265319_1001815 3300028563 Bacteria 12175
244 Ga0265334_10034600 3300028573 Unclassified 2004
245 Ga0265325_10122129 3300031241 Unclassified 1254
246 Ga0265342_10079525 3300031712 Bacteria 1896
247 Ga0316576_10024287 3300031727 Bacteria 4231
248 Ga0316578_10149127 3300031728 Bacteria 1409
249 Ga0316577_10020693 3300031733 Bacteria 3645
250 Ga0373940_0007990 3300035088 Bacteria 2411
251 Ga0373951_0036743 3300035091 Bacteria 1170
252 Ga0373945_0125137 3300035116 Bacteria 1025
253 Ga0373943_0005478 3300035170 Bacteria 5709
254 Ga0373962_0037304 3300035242 Unclassified 1357
255 Ga0373962_0051741 3300035242 Bacteria 1185
256 Ga0316574_0019894 3300035398 Bacteria 3968
257 Ga0316574_0132381 3300035398 Bacteria 1605
258 Ga0373931_0040868 3300035691 Bacteria 2435
259 Ga0373947_0178179 3300035725 Bacteria 1382
260 Ga0373937_0027103 3300036401 Bacteria 5180
261 Ga0316584_0049134 3300036712 Bacteria 3153
262 Ga0395901_0821115 3300038443 Bacteria 917
263 Ga0450923_000404 3300042125 Bacteria 4616
264 Ga0450910_004830 3300042147 Bacteria 1829
265 Ga0439460_0069316 3300042461 Bacteria 1090
266 Ga0466961_0094315 3300044693 Unclassified 1888
267 Ga0453684_0183787 3300044712 Unclassified 2452
268 Ga0466960_0009088 3300044901 Bacteria 4087
269 Ga0451576_0188181 3300045051 Bacteria 2156
270 Ga0451576_0860795 3300045051 Bacteria 951
271 Ga0495592_0159265 3300046454 Bacteria 1555
272 Ga0495603_0105567 3300046455 Unclassified 1644
273 Ga0495641_0041513 3300046461 Unclassified 2137
274 Ga0495580_0099871 3300046472 Bacteria 2019
275 Ga0495630_0177452 3300046517 Unclassified 1624
276 Ga0495656_0068968 3300046615 Bacteria 1565
277 Ga0495659_0147515 3300046664 Unclassified 943
278 Ga0495647_0051626 3300046681 Bacteria 1599
279 Ga0495647_0124130 3300046681 Bacteria 1089
280 Ga0495658_0283369 3300046683 Bacteria 1046
281 Ga0495658_0363557 3300046683 Bacteria 920
282 Ga0495674_0228103 3300047319 Bacteria 1538
283 Ga0495684_0031799 3300047471 Unclassified 4054
284 Ga0495602_0173538 3300048088 Unclassified 1671
285 Ga0496100_0104820 3300048903 Bacteria 1955
286 Ga0496101_0058347 3300048904 Bacteria 2795
287 Ga0496102_0028802 3300048905 Bacteria 4965
288 Ga0496102_0045285 3300048905 Bacteria 3995
289 Ga0496102_0313265 3300048905 Bacteria 1479
290 Ga0496102_0332378 3300048905 Unclassified 1431
291 Ga0496105_0399405 3300048908 Unclassified 1091
292 Ga0496107_0061016 3300048910 Bacteria 2730
293 Ga0496108_0004470 3300048911 Bacteria 11256
294 Ga0496108_0045045 3300048911 Bacteria 3684
295 Ga0496108_0053344 3300048911 Bacteria 3390
296 Ga0496109_0356683 3300048912 Bacteria 1381
297 Ga0496109_0674975 3300048912 Bacteria 971
298 Ga0496110_0027525 3300048913 Bacteria 4875
299 Ga0496110_0258262 3300048913 Unclassified 1586
300 Ga0496111_0047032 3300048914 Bacteria 3107
301 Ga0496111_0151999 3300048914 Bacteria 1717
302 Ga0496113_0054164 3300048916 Bacteria 3002
303 Ga0501031_0046304 3300049568 Bacteria 2836
304 Ga0501032_0018967 3300049569 Bacteria 4813
305 Ga0501033_0021539 3300049570 Bacteria 4863
306 Ga0501034_0733905 3300049571 Bacteria 884
307 Ga0501036_0056415 3300049572 Bacteria 3328
308 Ga0501037_0026548 3300049573 Bacteria 4281
309 Ga0501037_0050357 3300049573 Bacteria 3049
310 Ga0501038_0061063 3300049574 Bacteria 3224
311 Ga0501038_0153867 3300049574 Unclassified 1874
312 Ga0501038_0257665 3300049574 Bacteria 1380
313 Ga0501039_0038931 3300049575 Bacteria 3672
314 Ga0501039_0073699 3300049575 Bacteria 2652
315 Ga0501039_0198339 3300049575 Bacteria 1578
316 Ga0501040_0036862 3300049576 Bacteria 3321
317 Ga0501040_0040479 3300049576 Bacteria 3171
318 Ga0501041_0015868 3300049577 Bacteria 4477
319 Ga0501041_0030757 3300049577 Bacteria 3241
320 Ga0501041_0088208 3300049577 Bacteria 1915
321 Ga0501042_0007619 3300049578 Bacteria 7103
322 Ga0501043_0184180 3300049579 Bacteria 1626
323 Ga0501046_0044641 3300049580 Bacteria 3524
324 Ga0501047_0724928 3300049581 Bacteria 811
325 Ga0501048_0007284 3300049582 Bacteria 8388
326 Ga0501048_0221484 3300049582 Bacteria 1342
327 Ga0501067_0084580 3300049583 Bacteria 1760
328 Ga0501068_0003772 3300049584 Bacteria 8207
329 Ga0501068_0003893 3300049584 Bacteria 8109
330 Ga0501068_0342756 3300049584 Unclassified 960
331 Ga0501069_0032672 3300049585 Bacteria 2865
332 Ga0501070_0134658 3300049586 Bacteria 2040
333 Ga0501071_0007127 3300049587 Bacteria 7307
334 Ga0501071_0122270 3300049587 Bacteria 1930
335 Ga0501071_0187188 3300049587 Unclassified 1552
336 Ga0501071_0228550 3300049587 Unclassified 1401
337 Ga0501071_0276088 3300049587 Bacteria 1271
338 Ga0501072_0005288 3300049588 Bacteria 9831
339 Ga0501072_0086691 3300049588 Bacteria 2484
340 Ga0501072_0145220 3300049588 Bacteria 1892
341 Ga0501072_0293510 3300049588 Bacteria 1292
342 Ga0501073_0080219 3300049589 Bacteria 2271
343 Ga0501074_0033704 3300049590 Bacteria 3711
344 Ga0501074_0292743 3300049590 Bacteria 1157
345 Ga0501075_0033730 3300049591 Bacteria 3808
346 Ga0501076_0013428 3300049592 Bacteria 6143
347 Ga0501076_0070558 3300049592 Bacteria 2794
348 Ga0501076_0083406 3300049592 Bacteria 2566
349 Ga0501076_0306253 3300049592 Unclassified 1303
350 Ga0501076_0407534 3300049592 Bacteria 1118
351 Ga0501077_0015524 3300049593 Bacteria 4795
352 Ga0501077_0037452 3300049593 Bacteria 3088
353 Ga0501077_0061395 3300049593 Unclassified 2385
354 Ga0501079_0746288 3300049741 Unclassified 770
355 Ga0501080_0007277 3300049742 Bacteria 9986
356 Ga0501081_0002818 3300049743 Bacteria 11032
357 Ga0501081_0033215 3300049743 Bacteria 3504
358 Ga0501081_0050334 3300049743 Bacteria 2870
359 Ga0501035_0153208 3300049822 Bacteria 1999
360 Ga0501035_0207521 3300049822 Unclassified 1677
361 Ga0501045_0054091 3300049824 Bacteria 2934
362 Ga0501045_0062137 3300049824 Bacteria 2740
363 nmdc:mga05p37_10743_c1 3300050507 Bacteria 10867
364 nmdc:mga05p37_14379_c1 3300050507 Bacteria 9504
365 nmdc:mga05p37_146155_c1 3300050507 Bacteria 2895
366 nmdc:mga05p37_1666_c1 3300050507 Bacteria 25812
367 nmdc:mga05p37_23530_c1 3300050507 Bacteria 7475
368 nmdc:mga05p37_349385_c1 3300050507 Bacteria 1742
369 nmdc:mga09592_209584_c1 3300050508 Bacteria 1688
370 nmdc:mga09592_360166_c1 3300050508 Bacteria 1259
371 nmdc:mga09592_402888_c1 3300050508 Bacteria 1182
372 nmdc:mga0qj67_175703_c1 3300050509 Unclassified 1739
373 nmdc:mga0qj67_42337_c1 3300050509 Unclassified 3585
374 nmdc:mga06r32_36293_c1 3300050510 Bacteria 4657
375 nmdc:mga06r32_439931_c1 3300050510 Bacteria 1284
376 nmdc:mga08y16_139305_c1 3300050511 Bacteria 2522
377 nmdc:mga08y16_22456_c1 3300050511 Bacteria 6660
378 nmdc:mga08y16_68611_c1 3300050511 Bacteria 3697
379 nmdc:mga08y16_8392_c1 3300050511 Bacteria 10809
380 nmdc:mga0n895_107480_c1 3300050512 Bacteria 2804
381 nmdc:mga0n895_601950_c1 3300050512 Unclassified 1101
382 nmdc:mga0n895_78317_c1 3300050512 Bacteria 3290
383 nmdc:mga0rr50_141864_c1 3300050513 Bacteria 1934
384 nmdc:mga0rr50_53537_c1 3300050513 Bacteria 3003
385 nmdc:mga0a205_184376_c1 3300050515 Bacteria 1981
386 nmdc:mga0a205_29714_c1 3300050515 Bacteria 5231
387 nmdc:mga0a205_65783_c1 3300050515 Archaea 3503
388 Ga0495595_0068967 3300053084 Bacteria 1668
389 Ga0495619_0007583 3300053085 Bacteria 6869
390 Ga0501084_0004198 3300054114 Bacteria 11750
391 Ga0501084_0102403 3300054114 Unclassified 2405
392 Ga0501084_0133591 3300054114 Unclassified 2089
393 Ga0501084_0254041 3300054114 Bacteria 1484
394 Ga0501084_0297106 3300054114 Unclassified 1364
395 Ga0501084_0460030 3300054114 Bacteria 1076
396 Ga0501082_0043706 3300060353 Bacteria 3864
397 Ga0530510_0098772 3300061734 Bacteria 2134
398 Ga0530510_0125283 3300061734 Unclassified 1888
399 Ga0530510_0200186 3300061734 Bacteria 1483
400 Ga0530510_0432085 3300061734 Bacteria 994
401 Ga0114129_10817054
402 Ga0070683_100128000
403 Ga0070690_100096335
404 Ga0070670_100106626
405 Ga0070670_100299817
406 Ga0070666_10214183
407 Ga0068868_100032254
408 Ga0068868_100141544
409 Ga0070689_100002705
410 Ga0070689_100050888
411 Ga0070689_100339121
412 Ga0070687_100019368
413 Ga0070687_100033686
414 Ga0070661_100064403
415 Ga0070661_100115475
416 Ga0070692_10204475
417 Ga0070668_100352902
418 Ga0070669_100076396
419 Ga0070675_100026606
420 Ga0070675_100210261
421 Ga0070675_100214280
422 Ga0070674_100007642
423 Ga0070674_100337574
424 Ga0070673_100206568
425 Ga0070688_100085642
426 Ga0070659_100006009
427 Ga0070667_100108564
428 Ga0070667_100226189
429 Ga0070701_10001602
430 Ga0070701_10014806
431 Ga0070711_100170905
432 Ga0070700_100018721
433 Ga0070700_100045157
434 Ga0070694_100195726
435 Ga0070694_100206479
436 Ga0070708_100180258
437 Ga0070708_100180784
438 Ga0070708_100208078
439 Ga0070663_100188070
440 Ga0070663_100234553
441 Ga0070678_100240402
442 Ga0070662_100079622
443 Ga0070662_100278246
444 Ga0068867_100012831
445 Ga0070685_10014218
446 Ga0070706_100013224
447 Ga0070706_100014325
448 Ga0070706_100239740
449 Ga0070706_100240858
450 Ga0070707_100011595
451 Ga0070707_100027762
452 Ga0070707_100045194
453 Ga0070707_100297879
454 Ga0070698_100018697
455 Ga0070698_100043307
456 Ga0070699_100229860
457 Ga0070672_100010181
458 Ga0070672_100366748
459 Ga0070686_100003777
460 Ga0070686_100007252
461 Ga0070686_100034310
462 Ga0070695_100274668
463 Ga0070696_100164797
464 Ga0070693_100007495
465 Ga0070693_100040741
466 Ga0070704_100083839
467 Ga0070704_100333015
468 Ga0070664_100053776
469 Ga0068857_100164057
470 Ga0068857_100302962
471 Ga0068859_100038528
472 Ga0068859_100088411
473 Ga0068859_100207206
474 Ga0068859_100233467
475 Ga0068859_100308713
476 Ga0068859_100355822
477 Ga0068864_100058223
478 Ga0068864_100168858
479 Ga0068866_10078807
480 Ga0068861_100206074
481 Ga0068861_100272453
482 Ga0068870_10029273
483 Ga0068858_100059732
484 Ga0068860_100018853
485 Ga0068860_100033178
486 Ga0068860_100070391
487 Ga0068860_100097812
488 Ga0068860_100215819
489 Ga0068862_100022867
490 Ga0068862_100226132
491 Ga0075432_10057313
492 Ga0070712_100004352
493 Ga0097621_100195644
494 Ga0068871_100255140
495 Ga0075428_100044777
496 Ga0075428_100068423
497 Ga0075430_100006814
498 Ga0075430_100207091
499 Ga0075431_100011535
500 Ga0075431_100020810
501 Ga0075431_100329035
502 Ga0075433_10105060
503 Ga0075433_10222815
504 Ga0075434_100028687
505 Ga0075434_100152142
506 Ga0075434_100393124
507 Ga0075429_100092382
508 Ga0075429_100135571
509 Ga0068865_100046422
510 Ga0075436_100122156
511 Ga0097620_100038527
512 Ga0097620_100088409
513 Ga0097620_100207208
514 Ga0097620_100233472
515 Ga0097620_100308696
516 Ga0097620_100355809
517 Ga0075435_100002038
518 Ga0075435_100041176
519 Ga0075435_100057006
520 Ga0111539_10000236
521 Ga0111539_10011500
522 Ga0111539_10070995
523 Ga0111539_10157600
524 Ga0105245_10016224
525 Ga0105247_10003669
526 Ga0114129_10003070
527 Ga0114129_10016427
528 Ga0114129_10038856
529 Ga0114129_10076056
530 Ga0114129_10170098
531 Ga0114129_10692043
532 Ga0105243_10001933
533 Ga0105243_10004322
534 Ga0105242_10098245
535 Ga0105248_10302419
536 Ga0105237_10246666
537 Ga0105249_10020007
538 Ga0105249_10022489
539 Ga0105249_10034127
540 Ga0105249_10062852
541 Ga0105249_10086262
542 Ga0105249_10461747
543 Ga0105239_10007610
544 Ga0105239_10084447
545 Ga0157371_10148549
546 Ga0157378_10029499
547 Ga0157378_10154150
548 Ga0157378_10250430
549 Ga0163162_10016842
550 Ga0163162_10681948
551 Ga0157375_10002966
552 Ga0157375_10054468
553 Ga0157375_10130590
554 Ga0157375_10197628
555 Ga0163163_10009085
556 Ga0163163_10155446
557 Ga0157380_10130902
558 Ga0157380_10175672
559 Ga0157380_10382986
560 Ga0157377_10008058
561 Ga0157377_10043093
562 Ga0157379_10031191
563 Ga0157379_10062995
564 Ga0157379_10163648
565 Ga0157376_10137588
566 Ga0157376_10732245
567 Ga0163161_10060765
568 Ga0207642_10040352
569 Ga0207710_10009133
570 Ga0207688_10005160
571 Ga0207688_10017146
572 Ga0207643_10004432
573 Ga0207643_10016409
574 Ga0207684_10012979
575 Ga0207684_10055372
576 Ga0207684_10177069
577 Ga0207693_10006160
578 Ga0207660_10116454
579 Ga0207662_10000235
580 Ga0207662_10021306
581 Ga0207657_10106755
582 Ga0207649_10282256
583 Ga0207646_10012724
584 Ga0207646_10053439
585 Ga0207646_10072471
586 Ga0207646_10259163
587 Ga0207650_10219550
588 Ga0207650_10400869
589 Ga0207659_10049857
590 Ga0207659_10152303
591 Ga0207706_10095365
592 Ga0207706_10131777
593 Ga0207706_10187885
594 Ga0207706_10220736
595 Ga0207709_10116923
596 Ga0207670_10408687
597 Ga0207669_10003428
598 Ga0207704_10166700
599 Ga0207691_10133052
600 Ga0207689_10020345
601 Ga0207689_10178497
602 Ga0207661_10433519
603 Ga0207679_10172031
604 Ga0207712_10018747
605 Ga0207712_10061169
606 Ga0207712_10074012
607 Ga0207712_10260234
608 Ga0207658_10105496
609 Ga0207658_10334644
610 Ga0207677_10083879
611 Ga0207703_10563990
612 Ga0207678_10159614
613 Ga0207678_10217235
614 Ga0207708_10003096
615 Ga0207708_10010810
616 Ga0207648_10005704
617 Ga0207648_10023948
618 Ga0207648_10572502
619 Ga0207676_10079564
620 Ga0207676_10135206
621 Ga0207676_10268376
622 Ga0207674_10013889
623 Ga0207674_10066582
624 Ga0207674_10183495
625 Ga0207675_100172744
626 Ga0207675_100364814
627 Ga0207683_10003546
628 Ga0207683_10022469
629 Ga0207698_10106184
630 Ga0209983_1015449
631 Ga0209998_10001037
632 Ga0209974_10025914
633 Ga0207428_10000280
634 Ga0207428_10095670
635 Ga0207428_10217090
636 Ga0268265_10041523
637 Ga0268265_10300013
638 Ga0268264_10073897
639 Ga0268264_10084297
640 Ga0268264_10137925
641 Ga0268264_10254228
642 Ga0268264_10301526
643 Ga0265319_1001815
644 Ga0265334_10034600
645 Ga0265325_10122129
646 Ga0265342_10079525
647 Ga0316576_10024287
648 Ga0316578_10149127
649 Ga0316577_10020693
650 Ga0373940_0007990
651 Ga0373951_0036743
652 Ga0373945_0125137
653 Ga0373943_0005478
654 Ga0373962_0037304
655 Ga0373962_0051741
656 Ga0316574_0019894
657 Ga0316574_0132381
658 Ga0373931_0040868
659 Ga0373947_0178179
660 Ga0373937_0027103
661 Ga0316584_0049134
662 Ga0395901_0821115
663 Ga0450923_000404
664 Ga0450910_004830
665 Ga0439460_0069316
666 Ga0466961_0094315
667 Ga0453684_0183787
668 Ga0466960_0009088
669 Ga0451576_0188181
670 Ga0451576_0860795
671 Ga0495592_0159265
672 Ga0495603_0105567
673 Ga0495641_0041513
674 Ga0495580_0099871
675 Ga0495630_0177452
676 Ga0495656_0068968
677 Ga0495659_0147515
678 Ga0495647_0051626
679 Ga0495647_0124130
680 Ga0495658_0283369
681 Ga0495658_0363557
682 Ga0495674_0228103
683 Ga0495684_0031799
684 Ga0495602_0173538
685 Ga0496100_0104820
686 Ga0496101_0058347
687 Ga0496102_0028802
688 Ga0496102_0045285
689 Ga0496102_0313265
690 Ga0496102_0332378
691 Ga0496105_0399405
692 Ga0496107_0061016
693 Ga0496108_0004470
694 Ga0496108_0045045
695 Ga0496108_0053344
696 Ga0496109_0356683
697 Ga0496109_0674975
698 Ga0496110_0027525
699 Ga0496110_0258262
700 Ga0496111_0047032
701 Ga0496111_0151999
702 Ga0496113_0054164
703 Ga0501031_0046304
704 Ga0501032_0018967
705 Ga0501033_0021539
706 Ga0501034_0733905
707 Ga0501036_0056415
708 Ga0501037_0026548
709 Ga0501037_0050357
710 Ga0501038_0061063
711 Ga0501038_0153867
712 Ga0501038_0257665
713 Ga0501039_0038931
714 Ga0501039_0073699
715 Ga0501039_0198339
716 Ga0501040_0036862
717 Ga0501040_0040479
718 Ga0501041_0015868
719 Ga0501041_0030757
720 Ga0501041_0088208
721 Ga0501042_0007619
722 Ga0501043_0184180
723 Ga0501046_0044641
724 Ga0501047_0724928
725 Ga0501048_0007284
726 Ga0501048_0221484
727 Ga0501067_0084580
728 Ga0501068_0003772
729 Ga0501068_0003893
730 Ga0501068_0342756
731 Ga0501069_0032672
732 Ga0501070_0134658
733 Ga0501071_0007127
734 Ga0501071_0122270
735 Ga0501071_0187188
736 Ga0501071_0228550
737 Ga0501071_0276088
738 Ga0501072_0005288
739 Ga0501072_0086691
740 Ga0501072_0145220
741 Ga0501072_0293510
742 Ga0501073_0080219
743 Ga0501074_0033704
744 Ga0501074_0292743
745 Ga0501075_0033730
746 Ga0501076_0013428
747 Ga0501076_0070558
748 Ga0501076_0083406
749 Ga0501076_0306253
750 Ga0501076_0407534
751 Ga0501077_0015524
752 Ga0501077_0037452
753 Ga0501077_0061395
754 Ga0501079_0746288
755 Ga0501080_0007277
756 Ga0501081_0002818
757 Ga0501081_0033215
758 Ga0501081_0050334
759 Ga0501035_0153208
760 Ga0501035_0207521
761 Ga0501045_0054091
762 Ga0501045_0062137
763 nmdc:mga05p37_10743_c1
764 nmdc:mga05p37_14379_c1
765 nmdc:mga05p37_146155_c1
766 nmdc:mga05p37_1666_c1
767 nmdc:mga05p37_23530_c1
768 nmdc:mga05p37_349385_c1
769 nmdc:mga09592_209584_c1
770 nmdc:mga09592_360166_c1
771 nmdc:mga09592_402888_c1
772 nmdc:mga0qj67_175703_c1
773 nmdc:mga0qj67_42337_c1
774 nmdc:mga06r32_36293_c1
775 nmdc:mga06r32_439931_c1
776 nmdc:mga08y16_139305_c1
777 nmdc:mga08y16_22456_c1
778 nmdc:mga08y16_68611_c1
779 nmdc:mga08y16_8392_c1
780 nmdc:mga0n895_107480_c1
781 nmdc:mga0n895_601950_c1
782 nmdc:mga0n895_78317_c1
783 nmdc:mga0rr50_141864_c1
784 nmdc:mga0rr50_53537_c1
785 nmdc:mga0a205_184376_c1
786 nmdc:mga0a205_29714_c1
787 nmdc:mga0a205_65783_c1
788 Ga0495595_0068967
789 Ga0495619_0007583
790 Ga0501084_0004198
791 Ga0501084_0102403
792 Ga0501084_0133591
793 Ga0501084_0254041
794 Ga0501084_0297106
795 Ga0501084_0460030
796 Ga0501082_0043706
797 Ga0530510_0098772
798 Ga0530510_0125283
799 Ga0530510_0200186
800 Ga0530510_0432085

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

37

241

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kns-assembly2.cif.gz_B-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.8339 2 275
6kns-assembly4.cif.gz_D-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.8305 2 276
6kns-assembly3.cif.gz_C-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.8259 2 275
6kns-assembly4.cif.gz_D-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.8177 2 276
6kns-assembly1.cif.gz_A crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.8156 2 275
ID Description Score Start End Superfamily
af_P9WGC1_17_267_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.811 2 275 3.60.15.10
af_P9WGC1_17_267_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.802 2 275 3.60.15.10
1zkpC00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8015 1 277 3.60.15.10
1zkpC00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7984 1 277 3.60.15.10
af_P16692_1_251_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7579 2 275 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A524L1I8-F1-model_v4 MBL fold metallo-hydrolase 0.9664 3 94 GO:0016787
AF-A0A538AEH3-F1-model_v4 MBL fold metallo-hydrolase 0.9582 1 275 GO:0016787
AF-A0A7Y3GHM0-F1-model_v4 MBL fold metallo-hydrolase 0.9579 1 275 GO:0016787
AF-A0A7V9NPZ8-F1-model_v4 MBL fold metallo-hydrolase 0.9521 3 234 GO:0016787
AF-A0A1M7ZF46-F1-model_v4 Phosphoribosyl 1,2-cyclic phosphodiesterase 0.9514 1 277 GO:0042781

Map