F434563

General Info

Members Datasets Scaffolds Average Seq Length
400 196 800 243

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10154616|Ga0105247_101546162
Length 277
Sequence LPIADCQLPIERGVKSVNVNWQSAIGNIMDADTEIGGALHRFPITNHSAIIAARSDDQLTRRRAFETILTSYWKPAYKYIRLKWQADNEDAKDLTQGFFANAFEKNHFAGYDARKASFQTYLRTCLDGFVANERKAGRRLKRGGDFDHYQLDFANAENELASHAAAATLSAEDYFHREWVRWMFTLAVEAFRRHCDDAGRSIHFQLFERYDLNDHDEHVSYASLAKEFGLEPATVNNYLAAARRDFRRIVLEKLREITATDEEFRTEARSLLGIDVK

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
157 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
158 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
178 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
179 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
180 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
181 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
182 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
183 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
184 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
185 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5
Rhizosphere 94.75
Stem 0
Stem Tuber 0
Unclassified 20.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_10154616 3300009101 Unclassified 1514
2 CNBas_1001608 3300000531 Eukaryota 1201
3 CNAas_1001181 3300000532 Bacteria 2357
4 JGI24751J29686_10000012 3300002459 Bacteria 115709
5 JGI25406J46586_10003148 3300003203 Bacteria 7758
6 rootL2_10141106 3300003322 Bacteria 1763
7 Ga0065714_10064422 3300005288 Bacteria 270668
8 Ga0065704_10072722 3300005289 Bacteria 8096
9 Ga0065712_10012373 3300005290 Unclassified 3627
10 Ga0065712_10022912 3300005290 Bacteria 1579
11 Ga0065712_10067728 3300005290 Bacteria 178215
12 Ga0065712_10274724 3300005290 Unclassified 908
13 Ga0065715_10113777 3300005293 Unclassified 2476
14 Ga0065707_10003687 3300005295 Bacteria 4060
15 Ga0065707_10120708 3300005295 Bacteria 2127
16 Ga0070676_10082419 3300005328 Bacteria 1954
17 Ga0070670_100000165 3300005331 Bacteria 59984
18 Ga0070670_100991006 3300005331 Unclassified 764
19 Ga0068869_100116913 3300005334 Bacteria 2035
20 Ga0068869_100153388 3300005334 Bacteria 1788
21 Ga0070666_10045798 3300005335 Bacteria 2932
22 Ga0070682_100003969 3300005337 Bacteria 8216
23 Ga0070682_100010312 3300005337 Bacteria 5303
24 Ga0068868_100026929 3300005338 Bacteria 4383
25 Ga0070689_100001120 3300005340 Bacteria 16876
26 Ga0070691_10003411 3300005341 Bacteria 7140
27 Ga0070692_10005382 3300005345 Bacteria 5451
28 Ga0070692_10034458 3300005345 Bacteria 2558
29 Ga0070692_10075604 3300005345 Bacteria 1804
30 Ga0070692_10140990 3300005345 Bacteria 1364
31 Ga0070669_100290632 3300005353 Bacteria 1312
32 Ga0070675_100049238 3300005354 Unclassified 3458
33 Ga0070673_100063878 3300005364 Bacteria 2931
34 Ga0070713_100062745 3300005436 Bacteria 3113
35 Ga0070713_100184140 3300005436 Bacteria 1878
36 Ga0070701_10043665 3300005438 Unclassified 2294
37 Ga0070701_10120628 3300005438 Bacteria 1477
38 Ga0070711_100016761 3300005439 Bacteria 4657
39 Ga0070705_100004810 3300005440 Bacteria 6566
40 Ga0070705_100006451 3300005440 Bacteria 5753
41 Ga0070705_100158885 3300005440 Bacteria 1509
42 Ga0070705_100191606 3300005440 Bacteria 1394
43 Ga0070705_100529954 3300005440 Unclassified 899
44 Ga0070700_100000225 3300005441 Bacteria 31350
45 Ga0070700_100004474 3300005441 Bacteria 7303
46 Ga0070700_100015332 3300005441 Bacteria 4344
47 Ga0070700_100073120 3300005441 Bacteria 2193
48 Ga0070700_100369499 3300005441 Bacteria 1069
49 Ga0070700_100380836 3300005441 Bacteria 1055
50 Ga0070700_100441336 3300005441 Unclassified 988
51 Ga0070694_100003261 3300005444 Bacteria 9690
52 Ga0070694_100012012 3300005444 Bacteria 5376
53 Ga0070694_100234902 3300005444 Bacteria 1381
54 Ga0070694_100333820 3300005444 Bacteria 1170
55 Ga0070708_100000344 3300005445 Bacteria 35030
56 Ga0070708_100040112 3300005445 Bacteria 4100
57 Ga0070681_10002525 3300005458 Bacteria 16779
58 Ga0070681_10040233 3300005458 Unclassified 4685
59 Ga0070681_10315051 3300005458 Bacteria 1474
60 Ga0068867_100055949 3300005459 Bacteria 2918
61 Ga0068867_100153696 3300005459 Bacteria 1809
62 Ga0070706_100000128 3300005467 Bacteria 92969
63 Ga0070706_100001754 3300005467 Bacteria 22513
64 Ga0070706_100102450 3300005467 Bacteria 2661
65 Ga0070707_100226240 3300005468 Bacteria 1821
66 Ga0070707_100450806 3300005468 Bacteria 1247
67 Ga0070698_100019045 3300005471 Bacteria 7218
68 Ga0070698_100019101 3300005471 Bacteria 7204
69 Ga0070699_100001870 3300005518 Bacteria 19038
70 Ga0070699_100011062 3300005518 Bacteria 7804
71 Ga0070699_100230681 3300005518 Bacteria 1651
72 Ga0070699_100602236 3300005518 Bacteria 1002
73 Ga0070684_100349066 3300005535 Bacteria 1361
74 Ga0070697_100072160 3300005536 Unclassified 2833
75 Ga0070697_100452032 3300005536 Bacteria 1119
76 Ga0068853_100243569 3300005539 Bacteria 1649
77 Ga0070672_100387552 3300005543 Bacteria 1196
78 Ga0070672_100408040 3300005543 Bacteria 1165
79 Ga0070695_100055441 3300005545 Bacteria 2555
80 Ga0070695_100178121 3300005545 Bacteria 1504
81 Ga0070695_100199017 3300005545 Bacteria 1430
82 Ga0070695_100306779 3300005545 Unclassified 1175
83 Ga0070695_100611484 3300005545 Unclassified 857
84 Ga0070696_100006608 3300005546 Bacteria 7745
85 Ga0070696_100012246 3300005546 Bacteria 5748
86 Ga0070696_100055636 3300005546 Bacteria 2759
87 Ga0070696_100204607 3300005546 Unclassified 1475
88 Ga0070696_100310363 3300005546 Bacteria 1211
89 Ga0070696_100311915 3300005546 Bacteria 1208
90 Ga0070693_100001436 3300005547 Bacteria 10739
91 Ga0070693_100027523 3300005547 Bacteria 3083
92 Ga0070693_100045170 3300005547 Bacteria 2495
93 Ga0070693_100533090 3300005547 Unclassified 838
94 Ga0070704_100020041 3300005549 Bacteria 4305
95 Ga0070704_100027358 3300005549 Bacteria 3781
96 Ga0068857_100160059 3300005577 Bacteria 2043
97 Ga0068857_100248873 3300005577 Bacteria 1629
98 Ga0068857_100653156 3300005577 Unclassified 997
99 Ga0068857_100812975 3300005577 Bacteria 893
100 Ga0068854_100099343 3300005578 Bacteria 2180
101 Ga0068856_100030860 3300005614 Bacteria 5241
102 Ga0068856_100476672 3300005614 Bacteria 1269
103 Ga0070702_100007303 3300005615 Bacteria 5284
104 Ga0070702_100016277 3300005615 Unclassified 3812
105 Ga0070702_100025637 3300005615 Bacteria 3161
106 Ga0068859_100008065 3300005617 Bacteria 10677
107 Ga0068859_100008191 3300005617 Bacteria 10599
108 Ga0068859_100064387 3300005617 Unclassified 3699
109 Ga0068859_100092695 3300005617 Unclassified 3072
110 Ga0068859_100102291 3300005617 Unclassified 2922
111 Ga0068859_100126825 3300005617 Unclassified 2621
112 Ga0068859_101020588 3300005617 Bacteria 909
113 Ga0068864_100101101 3300005618 Bacteria 2557
114 Ga0068864_100142670 3300005618 Unclassified 2162
115 Ga0068861_100006469 3300005719 Bacteria 7982
116 Ga0068861_100015626 3300005719 Bacteria 5354
117 Ga0068861_100424941 3300005719 Bacteria 1185
118 Ga0068861_100481512 3300005719 Bacteria 1118
119 Ga0068851_10013836 3300005834 Bacteria 3822
120 Ga0068870_10035976 3300005840 Bacteria 2545
121 Ga0068870_10188159 3300005840 Bacteria 1244
122 Ga0068863_100424163 3300005841 Bacteria 1303
123 Ga0068863_100520696 3300005841 Bacteria 1172
124 Ga0068858_100081814 3300005842 Bacteria 3001
125 Ga0068858_100085640 3300005842 Bacteria 2932
126 Ga0068858_100537914 3300005842 Bacteria 1131
127 Ga0068858_100678993 3300005842 Bacteria 1002
128 Ga0068860_100026380 3300005843 Bacteria 5601
129 Ga0068860_100030961 3300005843 Bacteria 5145
130 Ga0068860_100077655 3300005843 Bacteria 3158
131 Ga0068860_100177660 3300005843 Bacteria 2058
132 Ga0068860_100467622 3300005843 Bacteria 1256
133 Ga0068862_100128319 3300005844 Bacteria 2241
134 Ga0068862_100230336 3300005844 Bacteria 1680
135 Ga0068862_100375545 3300005844 Bacteria 1325
136 Ga0081539_10000858 3300005985 Bacteria 58194
137 Ga0081539_10127112 3300005985 Unclassified 1257
138 Ga0070716_100244176 3300006173 Unclassified 1219
139 Ga0070716_100440255 3300006173 Unclassified 947
140 Ga0070712_100015248 3300006175 Unclassified 4942
141 Ga0097621_100003157 3300006237 Bacteria 11316
142 Ga0097621_100004250 3300006237 Bacteria 9952
143 Ga0097621_100061605 3300006237 Bacteria 3077
144 Ga0097621_100370047 3300006237 Bacteria 1278
145 Ga0068871_100041511 3300006358 Bacteria 3689
146 Ga0075430_100017615 3300006846 Bacteria 6082
147 Ga0075431_100075249 3300006847 Unclassified 3484
148 Ga0075431_100145088 3300006847 Unclassified 2446
149 Ga0075433_10006155 3300006852 Bacteria 9461
150 Ga0075433_10011110 3300006852 Bacteria 7242
151 Ga0075433_10069879 3300006852 Bacteria 3085
152 Ga0075434_100081096 3300006871 Bacteria 3241
153 Ga0075434_100127001 3300006871 Bacteria 2567
154 Ga0075434_100164310 3300006871 Bacteria 2240
155 Ga0075429_100096510 3300006880 Unclassified 2579
156 Ga0068865_100055309 3300006881 Bacteria 2760
157 Ga0075436_100003346 3300006914 Bacteria 10981
158 Ga0097620_100008065 3300006931 Bacteria 10677
159 Ga0097620_100008191 3300006931 Bacteria 10599
160 Ga0097620_100064382 3300006931 Unclassified 3699
161 Ga0097620_100092696 3300006931 Unclassified 3072
162 Ga0097620_100102295 3300006931 Unclassified 2922
163 Ga0097620_100126827 3300006931 Unclassified 2621
164 Ga0097620_101020679 3300006931 Bacteria 909
165 Ga0075435_100015176 3300007076 Bacteria 5785
166 Ga0105251_10016912 3300009011 Bacteria 3922
167 Ga0105240_10089609 3300009093 Unclassified 3762
168 Ga0111539_10015097 3300009094 Bacteria 9626
169 Ga0111539_10063867 3300009094 Unclassified 4357
170 Ga0105245_10003706 3300009098 Bacteria 13636
171 Ga0105245_10007840 3300009098 Bacteria 9352
172 Ga0105245_10307019 3300009098 Bacteria 1559
173 Ga0105247_10003325 3300009101 Bacteria 10532
174 Ga0114129_10205230 3300009147 Unclassified 2667
175 Ga0105243_10009032 3300009148 Bacteria 7614
176 Ga0105243_10029461 3300009148 Bacteria 4222
177 Ga0105243_10099165 3300009148 Unclassified 2414
178 Ga0105241_10206654 3300009174 Bacteria 1643
179 Ga0105241_10219554 3300009174 Bacteria 1597
180 Ga0105241_10462035 3300009174 Bacteria 1125
181 Ga0105242_10007870 3300009176 Bacteria 8203
182 Ga0105242_10045215 3300009176 Unclassified 3567
183 Ga0105242_10299549 3300009176 Bacteria 1467
184 Ga0105248_10197758 3300009177 Unclassified 2265
185 Ga0105248_10301921 3300009177 Bacteria 1803
186 Ga0105248_10441203 3300009177 Bacteria 1466
187 Ga0105248_10477619 3300009177 Bacteria 1405
188 Ga0105248_10540940 3300009177 Bacteria 1314
189 Ga0105237_10000502 3300009545 Bacteria 55436
190 Ga0105238_10053130 3300009551 Bacteria 4072
191 Ga0105238_10058525 3300009551 Bacteria 3862
192 Ga0105238_10078190 3300009551 Unclassified 3299
193 Ga0105249_10055636 3300009553 Unclassified 3620
194 Ga0099796_10066348 3300010159 Unclassified 1293
195 Ga0105239_10124404 3300010375 Unclassified 2865
196 Ga0105239_10160840 3300010375 Bacteria 2508
197 Ga0105239_11232538 3300010375 Bacteria 862
198 Ga0105246_10146796 3300011119 Bacteria 1781
199 Ga0105246_10251034 3300011119 Bacteria 1404
200 Ga0105246_10489302 3300011119 Bacteria 1042
201 Ga0157373_10003071 3300013100 Bacteria 12609
202 Ga0157369_10154675 3300013105 Bacteria 2423
203 Ga0157374_10641728 3300013296 Bacteria 1073
204 Ga0157378_10000614 3300013297 Bacteria 33505
205 Ga0163162_10251917 3300013306 Bacteria 1898
206 Ga0163162_10450386 3300013306 Unclassified 1419
207 Ga0157372_10025973 3300013307 Bacteria 6370
208 Ga0157372_10547692 3300013307 Bacteria 1349
209 Ga0157372_10786668 3300013307 Bacteria 1106
210 Ga0157375_10007015 3300013308 Bacteria 9838
211 Ga0157375_10029851 3300013308 Bacteria 5133
212 Ga0157375_10507127 3300013308 Bacteria 1370
213 Ga0157375_11072704 3300013308 Bacteria 942
214 Ga0157375_11124079 3300013308 Viruses 920
215 Ga0163163_10001068 3300014325 Bacteria 23309
216 Ga0163163_10594526 3300014325 Bacteria 1170
217 Ga0163163_10810184 3300014325 Bacteria 1000
218 Ga0157380_10278900 3300014326 Bacteria 1528
219 Ga0157377_10073190 3300014745 Bacteria 1985
220 Ga0157377_10159464 3300014745 Bacteria 1402
221 Ga0157377_10229581 3300014745 Bacteria 1192
222 Ga0157379_10062778 3300014968 Unclassified 3322
223 Ga0157379_10222687 3300014968 Bacteria 1709
224 Ga0157379_10259487 3300014968 Bacteria 1579
225 Ga0182007_10036281 3300015262 Bacteria 1659
226 Ga0207656_10028999 3300025321 Bacteria 2276
227 Ga0207653_10006723 3300025885 Bacteria 3593
228 Ga0207653_10008434 3300025885 Bacteria 3209
229 Ga0207710_10002567 3300025900 Bacteria 8393
230 Ga0207680_10022755 3300025903 Bacteria 3413
231 Ga0207647_10050773 3300025904 Unclassified 2566
232 Ga0207645_10011741 3300025907 Bacteria 5968
233 Ga0207645_10114278 3300025907 Bacteria 1749
234 Ga0207643_10001640 3300025908 Bacteria 12590
235 Ga0207643_10006247 3300025908 Bacteria 6373
236 Ga0207643_10036800 3300025908 Unclassified 2745
237 Ga0207684_10000150 3300025910 Bacteria 121849
238 Ga0207684_10000687 3300025910 Bacteria 39983
239 Ga0207654_10093758 3300025911 Bacteria 1836
240 Ga0207707_10003634 3300025912 Bacteria 13675
241 Ga0207707_10255485 3300025912 Unclassified 1521
242 Ga0207707_10351296 3300025912 Bacteria 1270
243 Ga0207671_10013889 3300025914 Bacteria 6394
244 Ga0207693_10077297 3300025915 Bacteria 2606
245 Ga0207663_10032967 3300025916 Bacteria 3081
246 Ga0207662_10127518 3300025918 Bacteria 1601
247 Ga0207652_10529555 3300025921 Bacteria 1060
248 Ga0207646_10192374 3300025922 Bacteria 1843
249 Ga0207694_10033482 3300025924 Bacteria 3936
250 Ga0207694_10044367 3300025924 Bacteria 3434
251 Ga0207694_10653142 3300025924 Bacteria 886
252 Ga0207650_10000011 3300025925 Bacteria 450115
253 Ga0207650_10426499 3300025925 Bacteria 1101
254 Ga0207687_10002379 3300025927 Bacteria 12766
255 Ga0207687_10004748 3300025927 Bacteria 9042
256 Ga0207687_10635525 3300025927 Bacteria 902
257 Ga0207700_10035574 3300025928 Unclassified 3588
258 Ga0207664_10219208 3300025929 Bacteria 1649
259 Ga0207690_10168938 3300025932 Bacteria 1637
260 Ga0207686_10073330 3300025934 Unclassified 2208
261 Ga0207686_10176640 3300025934 Bacteria 1511
262 Ga0207709_10002326 3300025935 Bacteria 12000
263 Ga0207709_10216289 3300025935 Bacteria 1379
264 Ga0207670_10263732 3300025936 Bacteria 1336
265 Ga0207670_10286259 3300025936 Bacteria 1286
266 Ga0207704_10037397 3300025938 Bacteria 2804
267 Ga0207665_10055404 3300025939 Bacteria 2675
268 Ga0207691_10263767 3300025940 Bacteria 1484
269 Ga0207711_10004285 3300025941 Bacteria 12188
270 Ga0207711_10085666 3300025941 Bacteria 2761
271 Ga0207711_10336645 3300025941 Unclassified 1396
272 Ga0207711_10445687 3300025941 Unclassified 1205
273 Ga0207689_10132673 3300025942 Bacteria 2050
274 Ga0207689_10263425 3300025942 Bacteria 1426
275 Ga0207689_10505350 3300025942 Bacteria 1013
276 Ga0207689_10583977 3300025942 Unclassified 939
277 Ga0207661_10060852 3300025944 Unclassified 3049
278 Ga0207679_10141103 3300025945 Bacteria 1948
279 Ga0207651_10015578 3300025960 Bacteria 4424
280 Ga0207651_10055537 3300025960 Bacteria 2721
281 Ga0207651_10184011 3300025960 Bacteria 1660
282 Ga0207712_10322570 3300025961 Bacteria 1275
283 Ga0207640_10103243 3300025981 Bacteria 2004
284 Ga0207640_10213348 3300025981 Bacteria 1472
285 Ga0207703_10505801 3300026035 Unclassified 1135
286 Ga0207708_10000136 3300026075 Bacteria 57790
287 Ga0207708_10002672 3300026075 Bacteria 13098
288 Ga0207708_10135758 3300026075 Bacteria 1927
289 Ga0207708_10204865 3300026075 Unclassified 1575
290 Ga0207708_10383455 3300026075 Bacteria 1159
291 Ga0207708_10488379 3300026075 Bacteria 1030
292 Ga0207708_10514628 3300026075 Bacteria 1005
293 Ga0207702_10108052 3300026078 Bacteria 2468
294 Ga0207641_10167433 3300026088 Bacteria 2003
295 Ga0207641_10175655 3300026088 Bacteria 1958
296 Ga0207641_10285343 3300026088 Bacteria 1554
297 Ga0207641_10315686 3300026088 Bacteria 1480
298 Ga0207648_10018535 3300026089 Bacteria 6300
299 Ga0207648_10115946 3300026089 Bacteria 2354
300 Ga0207676_10054051 3300026095 Bacteria 3145
301 Ga0207676_10256880 3300026095 Unclassified 1575
302 Ga0207676_10386075 3300026095 Unclassified 1305
303 Ga0207674_10134559 3300026116 Unclassified 2434
304 Ga0207674_10137328 3300026116 Bacteria 2406
305 Ga0207674_10332451 3300026116 Bacteria 1469
306 Ga0207675_100001265 3300026118 Bacteria 25256
307 Ga0207675_100001980 3300026118 Bacteria 20425
308 Ga0207675_100053015 3300026118 Bacteria 3785
309 Ga0207675_100130930 3300026118 Bacteria 2379
310 Ga0207675_100464840 3300026118 Bacteria 1255
311 Ga0207675_100515774 3300026118 Bacteria 1191
312 Ga0207698_10371477 3300026142 Bacteria 1358
313 Ga0207698_10750864 3300026142 Bacteria 974
314 Ga0207428_10268026 3300027907 Bacteria 1270
315 Ga0268265_10280275 3300028380 Unclassified 1491
316 Ga0268265_10325887 3300028380 Unclassified 1393
317 Ga0268265_10517095 3300028380 Bacteria 1128
318 Ga0268264_10037333 3300028381 Unclassified 4006
319 Ga0268264_10102784 3300028381 Unclassified 2487
320 Ga0268264_10146229 3300028381 Bacteria 2114
321 Ga0265338_10199278 3300028800 Unclassified 1511
322 Ga0265325_10010328 3300031241 Bacteria 5412
323 Ga0307408_100053081 3300031548 Unclassified 2926
324 Ga0307408_100091769 3300031548 Unclassified 2294
325 Ga0307408_100150426 3300031548 Bacteria 1837
326 Ga0307413_10123241 3300031824 Bacteria 1760
327 Ga0307413_10447544 3300031824 Bacteria 1024
328 Ga0307406_10003602 3300031901 Bacteria 8448
329 Ga0307409_100022514 3300031995 Bacteria 4347
330 Ga0307409_100280276 3300031995 Bacteria 1540
331 Ga0307416_100058180 3300032002 Unclassified 3132
332 Ga0307416_100492327 3300032002 Bacteria 1288
333 Ga0307414_10002969 3300032004 Bacteria 8974
334 Ga0307414_10747172 3300032004 Unclassified 889
335 Ga0307411_10070612 3300032005 Unclassified 2364
336 Ga0307415_100230364 3300032126 Bacteria 1491
337 Ga0373951_0000974 3300035091 Bacteria 7703
338 Ga0373942_0008828 3300035207 Bacteria 2354
339 Ga0373962_0100899 3300035242 Bacteria 900
340 Ga0373927_0155070 3300035695 Bacteria 1500
341 Ga0373937_0025835 3300036401 Bacteria 5303
342 Ga0395900_0289273 3300037418 Unclassified 1628
343 Ga0395898_0024095 3300037466 Bacteria 6143
344 Ga0395898_0257468 3300037466 Bacteria 1664
345 Ga0395898_0305776 3300037466 Bacteria 1517
346 Ga0395901_0068929 3300038443 Bacteria 3684
347 Ga0451576_0498004 3300045051 Bacteria 1280
348 Ga0496102_0143202 3300048905 Bacteria 2242
349 Ga0496104_0095856 3300048907 Bacteria 2838
350 Ga0496104_0371055 3300048907 Bacteria 1344
351 Ga0496105_0000682 3300048908 Bacteria 22828
352 Ga0496106_0063704 3300048909 Bacteria 2803
353 Ga0496106_0418144 3300048909 Bacteria 1077
354 Ga0496107_0096406 3300048910 Bacteria 2165
355 Ga0496107_0604732 3300048910 Bacteria 810
356 Ga0496108_0016090 3300048911 Bacteria 6098
357 Ga0496110_0068938 3300048913 Bacteria 3131
358 Ga0496110_0431344 3300048913 Bacteria 1201
359 Ga0496112_0031485 3300048915 Bacteria 5146
360 Ga0496112_0117903 3300048915 Bacteria 2625
361 Ga0496112_0167384 3300048915 Bacteria 2164
362 Ga0496112_0186558 3300048915 Bacteria 2037
363 Ga0496112_0197728 3300048915 Bacteria 1971
364 Ga0496112_0349137 3300048915 Unclassified 1422
365 Ga0496112_0769224 3300048915 Bacteria 889
366 Ga0496113_0069382 3300048916 Bacteria 2677
367 Ga0496113_0335207 3300048916 Bacteria 1213
368 Ga0501038_0012265 3300049574 Bacteria 7828
369 Ga0501048_0106404 3300049582 Bacteria 1980
370 Ga0501075_0117382 3300049591 Bacteria 2023
371 Ga0501075_0347831 3300049591 Bacteria 1130
372 Ga0501217_008865 3300049661 Unclassified 2180
373 Ga0501223_018469 3300049663 Bacteria 1372
374 Ga0501235_012052 3300049669 Unclassified 1900
375 Ga0501249_014505 3300049679 Bacteria 1680
376 Ga0501257_059387 3300049686 Unclassified 965
377 Ga0501261_004957 3300049690 Bacteria 1663
378 Ga0501225_0013938 3300049705 Unclassified 2248
379 Ga0501265_002359 3300049762 Bacteria 2143
380 Ga0501212_007427 3300049851 Bacteria 1502
381 nmdc:mga05p37_1193710_c1 3300050507 Unclassified 787
382 nmdc:mga05p37_18402_c1 3300050507 Bacteria 8439
383 nmdc:mga09592_103020_c1 3300050508 Bacteria 2445
384 nmdc:mga09592_616227_c1 3300050508 Unclassified 929
385 nmdc:mga09592_90308_c1 3300050508 Bacteria 2617
386 nmdc:mga0qj67_278962_c1 3300050509 Bacteria 1355
387 nmdc:mga06r32_155432_c1 3300050510 Unclassified 2268
388 nmdc:mga06r32_327201_c1 3300050510 Unclassified 1518
389 nmdc:mga08y16_31419_c1 3300050511 Bacteria 5584
390 nmdc:mga08y16_5991_c1 3300050511 Bacteria 12747
391 nmdc:mga0n895_35146_c1 3300050512 Unclassified 4829
392 nmdc:mga0n895_553781_c1 3300050512 Bacteria 1156
393 nmdc:mga0rr50_8273_c1 3300050513 Bacteria 6467
394 nmdc:mga08x19_117526_c1 3300050514 Unclassified 1779
395 nmdc:mga08x19_2717_c1 3300050514 Bacteria 10694
396 nmdc:mga0a205_368281_c1 3300050515 Bacteria 1303
397 nmdc:mga0a205_530216_c1 3300050515 Bacteria 1034
398 nmdc:mga0a205_63123_c1 3300050515 Bacteria 3579
399 Ga0501084_0220054 3300054114 Bacteria 1602
400 Ga0530510_0050863 3300061734 Bacteria 2993
401 Ga0105247_10154616
402 CNBas_1001608
403 CNAas_1001181
404 JGI24751J29686_10000012
405 JGI25406J46586_10003148
406 rootL2_10141106
407 Ga0065714_10064422
408 Ga0065704_10072722
409 Ga0065712_10012373
410 Ga0065712_10022912
411 Ga0065712_10067728
412 Ga0065712_10274724
413 Ga0065715_10113777
414 Ga0065707_10003687
415 Ga0065707_10120708
416 Ga0070676_10082419
417 Ga0070670_100000165
418 Ga0070670_100991006
419 Ga0068869_100116913
420 Ga0068869_100153388
421 Ga0070666_10045798
422 Ga0070682_100003969
423 Ga0070682_100010312
424 Ga0068868_100026929
425 Ga0070689_100001120
426 Ga0070691_10003411
427 Ga0070692_10005382
428 Ga0070692_10034458
429 Ga0070692_10075604
430 Ga0070692_10140990
431 Ga0070669_100290632
432 Ga0070675_100049238
433 Ga0070673_100063878
434 Ga0070713_100062745
435 Ga0070713_100184140
436 Ga0070701_10043665
437 Ga0070701_10120628
438 Ga0070711_100016761
439 Ga0070705_100004810
440 Ga0070705_100006451
441 Ga0070705_100158885
442 Ga0070705_100191606
443 Ga0070705_100529954
444 Ga0070700_100000225
445 Ga0070700_100004474
446 Ga0070700_100015332
447 Ga0070700_100073120
448 Ga0070700_100369499
449 Ga0070700_100380836
450 Ga0070700_100441336
451 Ga0070694_100003261
452 Ga0070694_100012012
453 Ga0070694_100234902
454 Ga0070694_100333820
455 Ga0070708_100000344
456 Ga0070708_100040112
457 Ga0070681_10002525
458 Ga0070681_10040233
459 Ga0070681_10315051
460 Ga0068867_100055949
461 Ga0068867_100153696
462 Ga0070706_100000128
463 Ga0070706_100001754
464 Ga0070706_100102450
465 Ga0070707_100226240
466 Ga0070707_100450806
467 Ga0070698_100019045
468 Ga0070698_100019101
469 Ga0070699_100001870
470 Ga0070699_100011062
471 Ga0070699_100230681
472 Ga0070699_100602236
473 Ga0070684_100349066
474 Ga0070697_100072160
475 Ga0070697_100452032
476 Ga0068853_100243569
477 Ga0070672_100387552
478 Ga0070672_100408040
479 Ga0070695_100055441
480 Ga0070695_100178121
481 Ga0070695_100199017
482 Ga0070695_100306779
483 Ga0070695_100611484
484 Ga0070696_100006608
485 Ga0070696_100012246
486 Ga0070696_100055636
487 Ga0070696_100204607
488 Ga0070696_100310363
489 Ga0070696_100311915
490 Ga0070693_100001436
491 Ga0070693_100027523
492 Ga0070693_100045170
493 Ga0070693_100533090
494 Ga0070704_100020041
495 Ga0070704_100027358
496 Ga0068857_100160059
497 Ga0068857_100248873
498 Ga0068857_100653156
499 Ga0068857_100812975
500 Ga0068854_100099343
501 Ga0068856_100030860
502 Ga0068856_100476672
503 Ga0070702_100007303
504 Ga0070702_100016277
505 Ga0070702_100025637
506 Ga0068859_100008065
507 Ga0068859_100008191
508 Ga0068859_100064387
509 Ga0068859_100092695
510 Ga0068859_100102291
511 Ga0068859_100126825
512 Ga0068859_101020588
513 Ga0068864_100101101
514 Ga0068864_100142670
515 Ga0068861_100006469
516 Ga0068861_100015626
517 Ga0068861_100424941
518 Ga0068861_100481512
519 Ga0068851_10013836
520 Ga0068870_10035976
521 Ga0068870_10188159
522 Ga0068863_100424163
523 Ga0068863_100520696
524 Ga0068858_100081814
525 Ga0068858_100085640
526 Ga0068858_100537914
527 Ga0068858_100678993
528 Ga0068860_100026380
529 Ga0068860_100030961
530 Ga0068860_100077655
531 Ga0068860_100177660
532 Ga0068860_100467622
533 Ga0068862_100128319
534 Ga0068862_100230336
535 Ga0068862_100375545
536 Ga0081539_10000858
537 Ga0081539_10127112
538 Ga0070716_100244176
539 Ga0070716_100440255
540 Ga0070712_100015248
541 Ga0097621_100003157
542 Ga0097621_100004250
543 Ga0097621_100061605
544 Ga0097621_100370047
545 Ga0068871_100041511
546 Ga0075430_100017615
547 Ga0075431_100075249
548 Ga0075431_100145088
549 Ga0075433_10006155
550 Ga0075433_10011110
551 Ga0075433_10069879
552 Ga0075434_100081096
553 Ga0075434_100127001
554 Ga0075434_100164310
555 Ga0075429_100096510
556 Ga0068865_100055309
557 Ga0075436_100003346
558 Ga0097620_100008065
559 Ga0097620_100008191
560 Ga0097620_100064382
561 Ga0097620_100092696
562 Ga0097620_100102295
563 Ga0097620_100126827
564 Ga0097620_101020679
565 Ga0075435_100015176
566 Ga0105251_10016912
567 Ga0105240_10089609
568 Ga0111539_10015097
569 Ga0111539_10063867
570 Ga0105245_10003706
571 Ga0105245_10007840
572 Ga0105245_10307019
573 Ga0105247_10003325
574 Ga0114129_10205230
575 Ga0105243_10009032
576 Ga0105243_10029461
577 Ga0105243_10099165
578 Ga0105241_10206654
579 Ga0105241_10219554
580 Ga0105241_10462035
581 Ga0105242_10007870
582 Ga0105242_10045215
583 Ga0105242_10299549
584 Ga0105248_10197758
585 Ga0105248_10301921
586 Ga0105248_10441203
587 Ga0105248_10477619
588 Ga0105248_10540940
589 Ga0105237_10000502
590 Ga0105238_10053130
591 Ga0105238_10058525
592 Ga0105238_10078190
593 Ga0105249_10055636
594 Ga0099796_10066348
595 Ga0105239_10124404
596 Ga0105239_10160840
597 Ga0105239_11232538
598 Ga0105246_10146796
599 Ga0105246_10251034
600 Ga0105246_10489302
601 Ga0157373_10003071
602 Ga0157369_10154675
603 Ga0157374_10641728
604 Ga0157378_10000614
605 Ga0163162_10251917
606 Ga0163162_10450386
607 Ga0157372_10025973
608 Ga0157372_10547692
609 Ga0157372_10786668
610 Ga0157375_10007015
611 Ga0157375_10029851
612 Ga0157375_10507127
613 Ga0157375_11072704
614 Ga0157375_11124079
615 Ga0163163_10001068
616 Ga0163163_10594526
617 Ga0163163_10810184
618 Ga0157380_10278900
619 Ga0157377_10073190
620 Ga0157377_10159464
621 Ga0157377_10229581
622 Ga0157379_10062778
623 Ga0157379_10222687
624 Ga0157379_10259487
625 Ga0182007_10036281
626 Ga0207656_10028999
627 Ga0207653_10006723
628 Ga0207653_10008434
629 Ga0207710_10002567
630 Ga0207680_10022755
631 Ga0207647_10050773
632 Ga0207645_10011741
633 Ga0207645_10114278
634 Ga0207643_10001640
635 Ga0207643_10006247
636 Ga0207643_10036800
637 Ga0207684_10000150
638 Ga0207684_10000687
639 Ga0207654_10093758
640 Ga0207707_10003634
641 Ga0207707_10255485
642 Ga0207707_10351296
643 Ga0207671_10013889
644 Ga0207693_10077297
645 Ga0207663_10032967
646 Ga0207662_10127518
647 Ga0207652_10529555
648 Ga0207646_10192374
649 Ga0207694_10033482
650 Ga0207694_10044367
651 Ga0207694_10653142
652 Ga0207650_10000011
653 Ga0207650_10426499
654 Ga0207687_10002379
655 Ga0207687_10004748
656 Ga0207687_10635525
657 Ga0207700_10035574
658 Ga0207664_10219208
659 Ga0207690_10168938
660 Ga0207686_10073330
661 Ga0207686_10176640
662 Ga0207709_10002326
663 Ga0207709_10216289
664 Ga0207670_10263732
665 Ga0207670_10286259
666 Ga0207704_10037397
667 Ga0207665_10055404
668 Ga0207691_10263767
669 Ga0207711_10004285
670 Ga0207711_10085666
671 Ga0207711_10336645
672 Ga0207711_10445687
673 Ga0207689_10132673
674 Ga0207689_10263425
675 Ga0207689_10505350
676 Ga0207689_10583977
677 Ga0207661_10060852
678 Ga0207679_10141103
679 Ga0207651_10015578
680 Ga0207651_10055537
681 Ga0207651_10184011
682 Ga0207712_10322570
683 Ga0207640_10103243
684 Ga0207640_10213348
685 Ga0207703_10505801
686 Ga0207708_10000136
687 Ga0207708_10002672
688 Ga0207708_10135758
689 Ga0207708_10204865
690 Ga0207708_10383455
691 Ga0207708_10488379
692 Ga0207708_10514628
693 Ga0207702_10108052
694 Ga0207641_10167433
695 Ga0207641_10175655
696 Ga0207641_10285343
697 Ga0207641_10315686
698 Ga0207648_10018535
699 Ga0207648_10115946
700 Ga0207676_10054051
701 Ga0207676_10256880
702 Ga0207676_10386075
703 Ga0207674_10134559
704 Ga0207674_10137328
705 Ga0207674_10332451
706 Ga0207675_100001265
707 Ga0207675_100001980
708 Ga0207675_100053015
709 Ga0207675_100130930
710 Ga0207675_100464840
711 Ga0207675_100515774
712 Ga0207698_10371477
713 Ga0207698_10750864
714 Ga0207428_10268026
715 Ga0268265_10280275
716 Ga0268265_10325887
717 Ga0268265_10517095
718 Ga0268264_10037333
719 Ga0268264_10102784
720 Ga0268264_10146229
721 Ga0265338_10199278
722 Ga0265325_10010328
723 Ga0307408_100053081
724 Ga0307408_100091769
725 Ga0307408_100150426
726 Ga0307413_10123241
727 Ga0307413_10447544
728 Ga0307406_10003602
729 Ga0307409_100022514
730 Ga0307409_100280276
731 Ga0307416_100058180
732 Ga0307416_100492327
733 Ga0307414_10002969
734 Ga0307414_10747172
735 Ga0307411_10070612
736 Ga0307415_100230364
737 Ga0373951_0000974
738 Ga0373942_0008828
739 Ga0373962_0100899
740 Ga0373927_0155070
741 Ga0373937_0025835
742 Ga0395900_0289273
743 Ga0395898_0024095
744 Ga0395898_0257468
745 Ga0395898_0305776
746 Ga0395901_0068929
747 Ga0451576_0498004
748 Ga0496102_0143202
749 Ga0496104_0095856
750 Ga0496104_0371055
751 Ga0496105_0000682
752 Ga0496106_0063704
753 Ga0496106_0418144
754 Ga0496107_0096406
755 Ga0496107_0604732
756 Ga0496108_0016090
757 Ga0496110_0068938
758 Ga0496110_0431344
759 Ga0496112_0031485
760 Ga0496112_0117903
761 Ga0496112_0167384
762 Ga0496112_0186558
763 Ga0496112_0197728
764 Ga0496112_0349137
765 Ga0496112_0769224
766 Ga0496113_0069382
767 Ga0496113_0335207
768 Ga0501038_0012265
769 Ga0501048_0106404
770 Ga0501075_0117382
771 Ga0501075_0347831
772 Ga0501217_008865
773 Ga0501223_018469
774 Ga0501235_012052
775 Ga0501249_014505
776 Ga0501257_059387
777 Ga0501261_004957
778 Ga0501225_0013938
779 Ga0501265_002359
780 Ga0501212_007427
781 nmdc:mga05p37_1193710_c1
782 nmdc:mga05p37_18402_c1
783 nmdc:mga09592_103020_c1
784 nmdc:mga09592_616227_c1
785 nmdc:mga09592_90308_c1
786 nmdc:mga0qj67_278962_c1
787 nmdc:mga06r32_155432_c1
788 nmdc:mga06r32_327201_c1
789 nmdc:mga08y16_31419_c1
790 nmdc:mga08y16_5991_c1
791 nmdc:mga0n895_35146_c1
792 nmdc:mga0n895_553781_c1
793 nmdc:mga0rr50_8273_c1
794 nmdc:mga08x19_117526_c1
795 nmdc:mga08x19_2717_c1
796 nmdc:mga0a205_368281_c1
797 nmdc:mga0a205_530216_c1
798 nmdc:mga0a205_63123_c1
799 Ga0501084_0220054
800 Ga0530510_0050863

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ku3-assembly1.cif.gz_A crystal structure of thermus aquaticus rna polymerase sigma subunit fragment, region 4 0.8626 172 220
3n97-assembly1.cif.gz_D rna polymerase alpha c-terminal domain (e. coli) and sigma region 4 (t. aq. mutant) bound to (up,-35 element) dna 0.8608 172 216
1rio-assembly1.cif.gz_H structure of bacteriophage lambda ci-ntd in complex with sigma-region4 of thermus aquaticus bound to dna 0.8556 174 218
3n97-assembly1.cif.gz_A rna polymerase alpha c-terminal domain (e. coli) and sigma region 4 (t. aq. mutant) bound to (up,-35 element) dna 0.8515 174 218
6ido-assembly1.cif.gz_A crystal structure of klebsiella pneumoniae sigma4 of sigmas fusing with the rna polymerase beta-flap-tip-helix in complex with -35 element dna 0.851 174 221
ID Description Score Start End Superfamily
1ku3A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8626 172 220 1.10.10.10
3n97D00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8608 172 216 1.10.10.10
1rioH00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8556 174 218 1.10.10.10
3hugK00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8357 152 223 1.10.10.10
3hugA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.827 137 224 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7Y4RLZ9-F1-model_v4 RNA polymerase sigma-70 region 2 domain-containing protein 0.9697 12 248 GO:0003700
GO:0006352
AF-A0A7Y4RLZ9-F1-model_v4 RNA polymerase sigma-70 region 2 domain-containing protein 0.9462 12 248 GO:0003700
GO:0006352
AF-A0A849ZE20-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.9343 12 248
AF-A0A2E0UI74-F1-model_v4 RNA polymerase sigma-70 region 2 domain-containing protein 0.9331 12 245 GO:0003700
GO:0006352
AF-A0A2N9N584-F1-model_v4 RNA polymerase, sigma-24 subunit, ECF subfamily 0.9314 137 243

Map