F434539

General Info

Members Datasets Scaffolds Average Seq Length
400 224 398 189

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10007111|Ga0081538_100071112
Length 188
Sequence MLIYSMSVSVDGFIADREGAFGWTAPSEELFRFHTAQVRELGGYLLGRRLYETMLVWETDPSMRETELRAAFADVWCAIPKVVFSRTLDGVQGGNARLAEASVADEAAAALDATDKDVAIGGAGLAAAAIELGLVDELRMFRHPVVVGGGTPFLPPVTEDVPLDLIETRTFGSRVIYERYGRARDESD

Samples

Sample ID Description Type Environment
1 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
2 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
48 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
62 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
105 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
113 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
114 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
115 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
116 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
133 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
134 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
135 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
136 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
137 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
138 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
142 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
153 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
154 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
157 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
160 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
208 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
218 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
219 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.25
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.25
Nodule 0
Rhizoplane 4.75
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 6.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10017961 3300002067 Bacteria 2185
2 JGI25407J50210_10008154 3300003373 Bacteria 2638
3 JGI25407J50210_10071352 3300003373 Bacteria 867
4 JGI25407J50210_10082522 3300003373 Bacteria 798
5 Ga0070682_100022818 3300005337 Bacteria 3711
6 Ga0068868_100434738 3300005338 Bacteria 1139
7 Ga0070689_100117565 3300005340 Bacteria 2120
8 Ga0070668_100032245 3300005347 Bacteria 3987
9 Ga0070674_100146400 3300005356 Bacteria 1778
10 Ga0070667_100014650 3300005367 Bacteria 6479
11 Ga0070713_100062755 3300005436 Bacteria 3113
12 Ga0070711_100146831 3300005439 Bacteria 1774
13 Ga0070711_100180669 3300005439 Bacteria 1615
14 Ga0070705_100058161 3300005440 Bacteria 2284
15 Ga0070681_10926199 3300005458 Bacteria 790
16 Ga0070707_100129882 3300005468 Bacteria 2450
17 Ga0070698_100554580 3300005471 Bacteria 1089
18 Ga0070679_100790467 3300005530 Bacteria 892
19 Ga0070684_100070265 3300005535 Bacteria 3080
20 Ga0070684_100156500 3300005535 Bacteria 2066
21 Ga0070697_100133972 3300005536 Bacteria 2080
22 Ga0070686_100022821 3300005544 Bacteria 3732
23 Ga0068856_100475953 3300005614 Bacteria 1270
24 Ga0068861_100442383 3300005719 Bacteria 1163
25 Ga0068862_100005580 3300005844 Bacteria 10513
26 Ga0081455_10007613 3300005937 Bacteria 11383
27 Ga0081455_10028134 3300005937 Bacteria 5138
28 Ga0081455_10029931 3300005937 Bacteria 4956
29 Ga0081455_10034319 3300005937 Bacteria 4547
30 Ga0081455_10077257 3300005937 Bacteria 2739
31 Ga0081455_10124915 3300005937 Bacteria 2021
32 Ga0081538_10001721 3300005981 Bacteria 22267
33 Ga0081538_10004352 3300005981 Bacteria 13080
34 Ga0081538_10004854 3300005981 Bacteria 12242
35 Ga0081538_10007111 3300005981 Bacteria 9722
36 Ga0081538_10007744 3300005981 Bacteria 9240
37 Ga0081538_10010584 3300005981 Bacteria 7554
38 Ga0081538_10014953 3300005981 Bacteria 6042
39 Ga0081538_10015180 3300005981 Bacteria 5978
40 Ga0081538_10018382 3300005981 Bacteria 5252
41 Ga0081539_10017444 3300005985 Bacteria 5041
42 Ga0081539_10085901 3300005985 Bacteria 1639
43 Ga0075365_10001325 3300006038 Bacteria 11067
44 Ga0075432_10069812 3300006058 Bacteria 1261
45 Ga0070712_100407151 3300006175 Bacteria 1124
46 Ga0075367_10532157 3300006178 Bacteria 746
47 Ga0075428_101019727 3300006844 Bacteria 876
48 Ga0075430_100003884 3300006846 Bacteria 12584
49 Ga0075430_100142798 3300006846 Bacteria 1994
50 Ga0075431_100025124 3300006847 Bacteria 6107
51 Ga0075431_100050713 3300006847 Bacteria 4278
52 Ga0075431_100408836 3300006847 Bacteria 1357
53 Ga0075431_100828483 3300006847 Bacteria 897
54 Ga0075433_10044545 3300006852 Bacteria 3855
55 Ga0075433_10064760 3300006852 Bacteria 3205
56 Ga0075433_10420194 3300006852 Bacteria 1179
57 Ga0075434_100178251 3300006871 Bacteria 2145
58 Ga0075429_100063123 3300006880 Bacteria 3228
59 Ga0099794_10071075 3300007265 Bacteria 1705
60 Ga0105240_10202112 3300009093 Bacteria 2328
61 Ga0111539_10064987 3300009094 Bacteria 4314
62 Ga0111539_10386653 3300009094 Bacteria 1629
63 Ga0105245_10128170 3300009098 Bacteria 2377
64 Ga0105245_10210843 3300009098 Bacteria 1870
65 Ga0105245_10243962 3300009098 Bacteria 1743
66 Ga0105245_10252496 3300009098 Bacteria 1714
67 Ga0105247_10077518 3300009101 Bacteria 2089
68 Ga0105247_10808716 3300009101 Bacteria 716
69 Ga0114129_10420445 3300009147 Bacteria 1758
70 Ga0114129_10479541 3300009147 Bacteria 1628
71 Ga0114129_10574718 3300009147 Bacteria 1463
72 Ga0105243_10467841 3300009148 Bacteria 1187
73 Ga0105243_11735822 3300009148 Bacteria 654
74 Ga0105248_10702412 3300009177 Bacteria 1141
75 Ga0105248_10732138 3300009177 Bacteria 1116
76 Ga0105238_10479350 3300009551 Bacteria 1243
77 Ga0105249_10011928 3300009553 Bacteria 7644
78 Ga0105249_10285724 3300009553 Bacteria 1649
79 Ga0157342_1020699 3300012507 Bacteria 762
80 Ga0157315_1001954 3300012508 Bacteria 1228
81 Ga0157370_10146515 3300013104 Bacteria 2198
82 Ga0157369_10595845 3300013105 Bacteria 1141
83 Ga0157374_10647199 3300013296 Bacteria 1069
84 Ga0157378_11254310 3300013297 Bacteria 781
85 Ga0157378_11886483 3300013297 Bacteria 646
86 Ga0157372_10000024 3300013307 Bacteria 197716
87 Ga0157375_10311128 3300013308 Bacteria 1739
88 Ga0163163_10161406 3300014325 Bacteria 2287
89 Ga0157380_11868227 3300014326 Bacteria 661
90 Ga0182008_10038836 3300014497 Bacteria 2380
91 Ga0157379_10021195 3300014968 Bacteria 5752
92 Ga0157376_10328658 3300014969 Bacteria 1456
93 Ga0206356_10875947 3300020070 Bacteria 681
94 Ga0213873_10086319 3300021358 Bacteria 885
95 Ga0213874_10001860 3300021377 Bacteria 4435
96 Ga0213876_10047210 3300021384 Bacteria 2276
97 Ga0213876_10084966 3300021384 Bacteria 1674
98 Ga0213876_10208677 3300021384 Bacteria 1038
99 Ga0213875_10007354 3300021388 Bacteria 5694
100 Ga0213875_10128419 3300021388 Bacteria 1185
101 Ga0207710_10035790 3300025900 Bacteria 2186
102 Ga0207688_10049098 3300025901 Bacteria 2358
103 Ga0207647_10126516 3300025904 Bacteria 1504
104 Ga0207645_10686501 3300025907 Bacteria 696
105 Ga0207695_10146146 3300025913 Bacteria 2308
106 Ga0207693_10284680 3300025915 Bacteria 1295
107 Ga0207693_10907130 3300025915 Bacteria 676
108 Ga0207663_10120624 3300025916 Bacteria 1795
109 Ga0207663_10366030 3300025916 Bacteria 1095
110 Ga0207662_10030372 3300025918 Bacteria 3135
111 Ga0207646_10158237 3300025922 Bacteria 2044
112 Ga0207687_11179579 3300025927 Bacteria 658
113 Ga0207700_10018375 3300025928 Bacteria 4695
114 Ga0207670_10834843 3300025936 Bacteria 769
115 Ga0207665_10770334 3300025939 Bacteria 759
116 Ga0207711_10416642 3300025941 Bacteria 1249
117 Ga0207689_10047076 3300025942 Bacteria 3562
118 Ga0207667_11028842 3300025949 Bacteria 810
119 Ga0207712_10005079 3300025961 Bacteria 8322
120 Ga0207712_10048641 3300025961 Bacteria 2950
121 Ga0207668_10225253 3300025972 Bacteria 1508
122 Ga0207658_11125060 3300025986 Bacteria 717
123 Ga0207677_10468269 3300026023 Bacteria 1083
124 Ga0207703_10142704 3300026035 Bacteria 2080
125 Ga0207708_10100939 3300026075 Bacteria 2233
126 Ga0207702_10146035 3300026078 Bacteria 2146
127 Ga0207702_10364513 3300026078 Bacteria 1386
128 Ga0207641_10283181 3300026088 Bacteria 1560
129 Ga0207648_10078251 3300026089 Bacteria 2884
130 Ga0207648_10250382 3300026089 Bacteria 1579
131 Ga0207676_11056822 3300026095 Bacteria 802
132 Ga0207675_100239524 3300026118 Bacteria 1753
133 Ga0207428_10027192 3300027907 Bacteria 4764
134 Ga0207428_10581002 3300027907 Bacteria 808
135 Ga0268266_10080446 3300028379 Bacteria 2839
136 Ga0268265_10006868 3300028380 Bacteria 7701
137 Ga0268264_10054983 3300028381 Bacteria 3325
138 Ga0268264_10420239 3300028381 Bacteria 1289
139 Ga0268264_11171385 3300028381 Bacteria 778
140 Ga0265338_10364295 3300028800 Bacteria 1036
141 Ga0307408_100007146 3300031548 Bacteria 7392
142 Ga0307408_100138884 3300031548 Bacteria 1905
143 Ga0307408_100744834 3300031548 Bacteria 884
144 Ga0265313_10032593 3300031595 Bacteria 2658
145 Ga0265314_10233237 3300031711 Bacteria 1066
146 Ga0265342_10168731 3300031712 Bacteria 1206
147 Ga0307405_10030797 3300031731 Bacteria 3150
148 Ga0307405_10032164 3300031731 Bacteria 3098
149 Ga0307413_10165508 3300031824 Bacteria 1559
150 Ga0307410_10021275 3300031852 Bacteria 3986
151 Ga0307410_10152788 3300031852 Bacteria 1720
152 Ga0307410_10532129 3300031852 Bacteria 971
153 Ga0307406_10000367 3300031901 Bacteria 26120
154 Ga0307407_10005260 3300031903 Bacteria 5594
155 Ga0307412_10662815 3300031911 Bacteria 891
156 Ga0307412_10952865 3300031911 Bacteria 755
157 Ga0307409_100000860 3300031995 Bacteria 14016
158 Ga0307409_100021576 3300031995 Bacteria 4419
159 Ga0307409_100040431 3300031995 Bacteria 3472
160 Ga0307409_100519116 3300031995 Bacteria 1163
161 Ga0307409_101032107 3300031995 Bacteria 841
162 Ga0307416_100000089 3300032002 Bacteria 62440
163 Ga0307416_100017348 3300032002 Bacteria 5034
164 Ga0307416_100053872 3300032002 Bacteria 3230
165 Ga0307416_100368957 3300032002 Bacteria 1461
166 Ga0307416_100504908 3300032002 Bacteria 1274
167 Ga0307414_10125938 3300032004 Bacteria 1979
168 Ga0307414_10419865 3300032004 Bacteria 1166
169 Ga0307411_10032798 3300032005 Bacteria 3214
170 Ga0307411_10129577 3300032005 Bacteria 1841
171 Ga0307415_100000878 3300032126 Bacteria 13748
172 Ga0307415_100001869 3300032126 Bacteria 10332
173 Ga0307415_100013918 3300032126 Bacteria 4710
174 Ga0373926_0033243 3300035083 Bacteria 1823
175 Ga0373945_0044395 3300035116 Bacteria 1616
176 Ga0373954_0065073 3300035118 Bacteria 1725
177 Ga0373956_0031704 3300035119 Bacteria 2317
178 Ga0373960_0095801 3300035121 Bacteria 955
179 Ga0373943_0002243 3300035170 Bacteria 8783
180 Ga0373946_0286269 3300035171 Bacteria 812
181 Ga0373931_0110991 3300035691 Bacteria 1556
182 Ga0373935_0088075 3300035692 Bacteria 2028
183 Ga0373947_0027069 3300035725 Bacteria 3355
184 Ga0316584_0757880 3300036712 Bacteria 662
185 Ga0373925_0054612 3300037068 Bacteria 2988
186 Ga0395899_0008348 3300037312 Bacteria 7974
187 Ga0395899_0022127 3300037312 Bacteria 4820
188 Ga0395899_0221960 3300037312 Bacteria 1309
189 Ga0395899_0261565 3300037312 Bacteria 1183
190 Ga0395899_0393640 3300037312 Bacteria 918
191 Ga0395899_0400796 3300037312 Bacteria 908
192 Ga0395900_0012817 3300037418 Bacteria 8568
193 Ga0395900_0020994 3300037418 Bacteria 6675
194 Ga0395900_0053758 3300037418 Bacteria 4145
195 Ga0395900_0056955 3300037418 Bacteria 4023
196 Ga0395900_0139869 3300037418 Bacteria 2479
197 Ga0395900_0295863 3300037418 Bacteria 1606
198 Ga0395900_0621139 3300037418 Bacteria 1019
199 Ga0395900_1474949 3300037418 Bacteria 592
200 Ga0395898_0005158 3300037466 Bacteria 14137
201 Ga0395898_0013655 3300037466 Bacteria 8356
202 Ga0395898_0014924 3300037466 Bacteria 7976
203 Ga0395898_0042574 3300037466 Bacteria 4479
204 Ga0395898_0133467 3300037466 Bacteria 2377
205 Ga0395898_0274670 3300037466 Bacteria 1607
206 Ga0395898_0446279 3300037466 Bacteria 1232
207 Ga0395898_0487692 3300037466 Bacteria 1172
208 Ga0395898_0506103 3300037466 Bacteria 1148
209 Ga0395898_0857434 3300037466 Bacteria 847
210 Ga0395905_0004823 3300037471 Bacteria 13911
211 Ga0395905_0022170 3300037471 Bacteria 6008
212 Ga0395905_0201449 3300037471 Bacteria 1866
213 Ga0436364_0023304 3300037853 Bacteria 14882
214 Ga0436364_0048882 3300037853 Bacteria 1392
215 Ga0436364_0133121 3300037853 Bacteria 932
216 Ga0436364_0262228 3300037853 Bacteria 2635
217 Ga0436364_0804153 3300037853 Bacteria 23696
218 Ga0436364_0853176 3300037853 Bacteria 15186
219 Ga0395901_0023002 3300038443 Bacteria 6388
220 Ga0395901_0025835 3300038443 Bacteria 6030
221 Ga0395901_0026537 3300038443 Bacteria 5948
222 Ga0395901_0038544 3300038443 Bacteria 4944
223 Ga0395901_0098219 3300038443 Bacteria 3070
224 Ga0395901_0105504 3300038443 Bacteria 2957
225 Ga0395901_0174659 3300038443 Bacteria 2253
226 Ga0395901_0239800 3300038443 Bacteria 1891
227 Ga0395901_0629808 3300038443 Bacteria 1078
228 Ga0395901_0813518 3300038443 Bacteria 922
229 Ga0395901_0837337 3300038443 Bacteria 906
230 Ga0395901_1645066 3300038443 Bacteria 594
231 Ga0436365_0150236 3300039437 Bacteria 1169
232 Ga0436365_0155754 3300039437 Bacteria 5283
233 Ga0436365_1230013 3300039437 Bacteria 2905
234 Ga0436365_1248108 3300039437 Bacteria 5089
235 Ga0436365_1762117 3300039437 Bacteria 20148
236 Ga0436363_0178570 3300039450 Bacteria 1140
237 Ga0436363_0828464 3300039450 Bacteria 4323
238 Ga0436363_1081980 3300039450 Bacteria 4622
239 Ga0436363_1266409 3300039450 Bacteria 1018
240 Ga0436363_1398506 3300039450 Bacteria 1696
241 Ga0436363_1620364 3300039450 Bacteria 5551
242 Ga0436362_0304971 3300039453 Bacteria 1197
243 Ga0436362_0567581 3300039453 Bacteria 1713
244 Ga0436362_0712664 3300039453 Bacteria 902
245 Ga0436362_0728702 3300039453 Bacteria 2210
246 Ga0436362_0748031 3300039453 Bacteria 1440
247 Ga0439453_0035494 3300041408 Bacteria 961
248 Ga0451837_0256192 3300041494 Bacteria 1754
249 Ga0439451_035831 3300042009 Bacteria 997
250 Ga0439435_0070462 3300042436 Bacteria 1034
251 Ga0439459_0096601 3300042438 Bacteria 718
252 Ga0466969_0058760 3300044656 Bacteria 1871
253 Ga0466966_0019954 3300044684 Bacteria 4408
254 Ga0466963_0013471 3300044694 Bacteria 5021
255 Ga0466963_0039188 3300044694 Bacteria 3102
256 Ga0466963_0520892 3300044694 Bacteria 839
257 Ga0466964_0368219 3300044706 Bacteria 743
258 Ga0466971_0038392 3300044719 Bacteria 2149
259 Ga0466957_0024326 3300044842 Bacteria 3583
260 Ga0466957_0094444 3300044842 Bacteria 1878
261 Ga0466957_0304191 3300044842 Bacteria 1072
262 Ga0466960_0204283 3300044901 Bacteria 1081
263 Ga0466959_0021215 3300045049 Bacteria 4790
264 Ga0466959_0122232 3300045049 Bacteria 1850
265 Ga0466959_0256420 3300045049 Bacteria 1205
266 Ga0466959_0310425 3300045049 Bacteria 1079
267 Ga0466959_0356401 3300045049 Bacteria 997
268 Ga0466958_0058266 3300045836 Bacteria 2348
269 Ga0466958_0094116 3300045836 Bacteria 1856
270 Ga0466958_0227442 3300045836 Bacteria 1191
271 Ga0466967_0118529 3300045976 Bacteria 2442
272 Ga0466967_0158430 3300045976 Bacteria 2123
273 Ga0466967_0506756 3300045976 Unclassified 1185
274 Ga0495603_0465063 3300046455 Bacteria 724
275 Ga0495629_0138542 3300046459 Bacteria 1694
276 Ga0495629_0405982 3300046459 Bacteria 926
277 Ga0495651_0071988 3300046462 Bacteria 2627
278 Ga0495580_0296913 3300046472 Bacteria 1101
279 Ga0495584_0165991 3300046491 Bacteria 1122
280 Ga0495607_0080254 3300046501 Bacteria 1795
281 Ga0495583_0163525 3300046506 Bacteria 917
282 Ga0495608_0102396 3300046511 Bacteria 1846
283 Ga0495610_0191219 3300046512 Bacteria 845
284 Ga0495644_0157500 3300046523 Bacteria 870
285 Ga0495652_0312982 3300046529 Bacteria 1137
286 Ga0495656_0064863 3300046615 Bacteria 1605
287 Ga0495661_0314964 3300046665 Bacteria 779
288 Ga0495657_0052434 3300046675 Bacteria 2735
289 Ga0495599_0308128 3300046678 Bacteria 955
290 Ga0495670_0298580 3300046691 Bacteria 863
291 Ga0495671_0314684 3300046692 Bacteria 752
292 Ga0495581_0039180 3300047315 Bacteria 2743
293 Ga0495676_0200350 3300047321 Bacteria 1387
294 Ga0495602_0052004 3300048088 Bacteria 3642
295 Ga0496101_0320345 3300048904 Bacteria 1216
296 Ga0496102_0376133 3300048905 Bacteria 1337
297 Ga0496104_0010691 3300048907 Bacteria 8205
298 Ga0496105_0032643 3300048908 Bacteria 4273
299 Ga0496106_0415382 3300048909 Bacteria 1081
300 Ga0496108_0022184 3300048911 Bacteria 5220
301 Ga0496108_0405116 3300048911 Bacteria 1191
302 Ga0496108_0446077 3300048911 Bacteria 1130
303 Ga0496109_0060136 3300048912 Bacteria 3471
304 Ga0496109_0065351 3300048912 Bacteria 3330
305 Ga0496109_0422024 3300048912 Bacteria 1260
306 Ga0496110_0282047 3300048913 Bacteria 1513
307 Ga0496110_0385235 3300048913 Bacteria 1278
308 Ga0496110_0604092 3300048913 Bacteria 995
309 Ga0496112_0160278 3300048915 Bacteria 2216
310 Ga0496112_0160943 3300048915 Bacteria 2211
311 Ga0496112_0629499 3300048915 Bacteria 1003
312 Ga0496115_0066283 3300048918 Bacteria 2918
313 Ga0496115_0140924 3300048918 Bacteria 1989
314 Ga0496126_0013502 3300048929 Bacteria 8299
315 Ga0501033_0135941 3300049570 Bacteria 1778
316 Ga0501034_0115313 3300049571 Bacteria 2675
317 Ga0501034_0521823 3300049571 Bacteria 1100
318 Ga0501037_0064110 3300049573 Bacteria 2678
319 Ga0501037_0362656 3300049573 Bacteria 998
320 Ga0501038_0047471 3300049574 Bacteria 3720
321 Ga0501038_0482761 3300049574 Bacteria 949
322 Ga0501039_0095903 3300049575 Bacteria 2312
323 Ga0501041_0089797 3300049577 Bacteria 1897
324 Ga0501042_0116536 3300049578 Bacteria 1923
325 Ga0501042_0221816 3300049578 Bacteria 1363
326 Ga0501042_0591152 3300049578 Bacteria 807
327 Ga0501043_0108587 3300049579 Bacteria 2179
328 Ga0501046_0036135 3300049580 Bacteria 3977
329 Ga0501046_0211838 3300049580 Bacteria 1438
330 Ga0501046_0651809 3300049580 Bacteria 744
331 Ga0501046_0787067 3300049580 Bacteria 667
332 Ga0501047_0001096 3300049581 Bacteria 26955
333 Ga0501047_0004906 3300049581 Bacteria 12563
334 Ga0501047_0042493 3300049581 Bacteria 4392
335 Ga0501048_0552481 3300049582 Bacteria 826
336 Ga0501069_0004899 3300049585 Bacteria 6933
337 Ga0501070_0030012 3300049586 Bacteria 4555
338 Ga0501070_0932744 3300049586 Bacteria 676
339 Ga0501071_0063601 3300049587 Bacteria 2675
340 Ga0501071_0112493 3300049587 Bacteria 2013
341 Ga0501072_0116327 3300049588 Bacteria 2129
342 Ga0501074_0093548 3300049590 Bacteria 2152
343 Ga0501075_0065940 3300049591 Bacteria 2732
344 Ga0501076_0038427 3300049592 Bacteria 3757
345 Ga0501076_0068072 3300049592 Bacteria 2843
346 Ga0501076_0316468 3300049592 Bacteria 1280
347 Ga0501076_0635455 3300049592 Bacteria 881
348 Ga0501076_0790316 3300049592 Bacteria 783
349 Ga0501077_0733357 3300049593 Bacteria 635
350 Ga0501227_062215 3300049665 Bacteria 959
351 Ga0501079_0206483 3300049741 Bacteria 1534
352 Ga0501079_0311280 3300049741 Bacteria 1232
353 Ga0501080_0061803 3300049742 Bacteria 3486
354 Ga0501083_0055132 3300049744 Bacteria 2666
355 Ga0501083_0158146 3300049744 Bacteria 1483
356 Ga0501280_034538 3300049776 Bacteria 801
357 Ga0501035_0002282 3300049822 Bacteria 18955
358 Ga0501044_0031849 3300049823 Bacteria 5546
359 Ga0501044_0059150 3300049823 Bacteria 3927
360 Ga0501045_0434370 3300049824 Bacteria 976
361 nmdc:mga00v17_5164_c1 3300050491 Bacteria 6867
362 nmdc:mga0yw44_169553_c1 3300050492 Bacteria 1433
363 nmdc:mga06z11_209579_c1 3300050494 Bacteria 1135
364 nmdc:mga05p37_113980_c1 3300050507 Bacteria 3323
365 nmdc:mga05p37_476466_c1 3300050507 Bacteria 1439
366 nmdc:mga05p37_5413_c1 3300050507 Bacteria 14999
367 nmdc:mga09592_128383_c1 3300050508 Bacteria 2180
368 nmdc:mga09592_152810_c1 3300050508 Bacteria 1992
369 nmdc:mga0qj67_134523_c1 3300050509 Bacteria 2003
370 nmdc:mga0qj67_391191_c1 3300050509 Bacteria 1122
371 nmdc:mga0qj67_9899_c1 3300050509 Bacteria 7109
372 nmdc:mga06r32_182227_c1 3300050510 Bacteria 2086
373 nmdc:mga06r32_3479_c1 3300050510 Bacteria 14061
374 nmdc:mga06r32_39763_c1 3300050510 Bacteria 4464
375 nmdc:mga06r32_673013_c1 3300050510 Bacteria 1002
376 nmdc:mga06r32_735404_c1 3300050510 Bacteria 950
377 nmdc:mga06r32_89654_c1 3300050510 Bacteria 3003
378 nmdc:mga08y16_194511_c1 3300050511 Bacteria 2103
379 nmdc:mga08y16_441672_c1 3300050511 Bacteria 1328
380 nmdc:mga08y16_492988_c1 3300050511 Bacteria 1246
381 nmdc:mga0n895_110735_c1 3300050512 Bacteria 2762
382 nmdc:mga0n895_194966_c1 3300050512 Bacteria 2057
383 nmdc:mga0rr50_277486_c1 3300050513 Bacteria 1398
384 nmdc:mga0a205_10975_c1 3300050515 Bacteria 8337
385 nmdc:mga0a205_32149_c1 3300050515 Bacteria 4035
386 nmdc:mga0a205_397599_c1 3300050515 Bacteria 1242
387 Ga0495612_0016469 3300053078 Bacteria 2961
388 Ga0495655_0032864 3300053083 Bacteria 1273
389 Ga0495619_0124820 3300053085 Bacteria 1766
390 Ga0501084_0011572 3300054114 Bacteria 7304
391 Ga0501084_0092329 3300054114 Bacteria 2542
392 Ga0501084_0231541 3300054114 Bacteria 1559
393 Ga0501084_0773366 3300054114 Bacteria 809
394 Ga0590075_015474 3300059424 Bacteria 1872
395 Ga0501082_0917145 3300060353 Bacteria 766
396 Ga0466962_0034863 3300061719 Bacteria 2410
397 Ga0466962_0314491 3300061719 Bacteria 776
398 Ga0530510_0119447 3300061734 Bacteria 1934

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0239800 Ga0395901_0239800_94_591 161
2 3300005347 Ga0070668_100032245 Ga0070668_1000322454 178
3 3300005439 Ga0070711_100180669 Ga0070711_1001806692 178
4 3300005719 Ga0068861_100442383 Ga0068861_1004423831 178
5 3300005981 Ga0081538_10018382 Ga0081538_100183826 178
6 3300025913 Ga0207695_10146146 Ga0207695_101461463 178
7 3300025916 Ga0207663_10120624 Ga0207663_101206242 178
8 3300025927 Ga0207687_11179579 Ga0207687_111795791 178
9 3300025942 Ga0207689_10047076 Ga0207689_100470766 178
10 3300025986 Ga0207658_11125060 Ga0207658_111250601 178
11 3300026095 Ga0207676_11056822 Ga0207676_110568222 178
12 3300031852 Ga0307410_10532129 Ga0307410_105321292 178
13 3300032004 Ga0307414_10419865 Ga0307414_104198652 178
14 3300032005 Ga0307411_10032798 Ga0307411_100327984 178
15 3300036712 Ga0316584_0757880 Ga0316584_0757880_34_582 178
16 3300037418 Ga0395900_1474949 Ga0395900_1474949_30_578 178
17 3300038443 Ga0395901_0837337 Ga0395901_0837337_114_662 178
18 3300038443 Ga0395901_1645066 Ga0395901_1645066_15_563 178
19 3300046472 Ga0495580_0296913 Ga0495580_0296913_41_592 179
20 iso_pu_bacteria 2799112218 2799185901 179
21 iso_pu_bacteria 2906799679 2906801870 179
22 3300005535 Ga0070684_100070265 Ga0070684_1000702652 182
23 3300005937 Ga0081455_10028134 Ga0081455_100281346 182
24 3300005985 Ga0081539_10017444 Ga0081539_100174443 182
25 3300009098 Ga0105245_10243962 Ga0105245_102439622 182
26 3300013296 Ga0157374_10647199 Ga0157374_106471992 182
27 3300025941 Ga0207711_10416642 Ga0207711_104166422 182
28 3300032002 Ga0307416_100368957 Ga0307416_1003689572 182
29 3300035118 Ga0373954_0065073 Ga0373954_0065073_15_617 182
30 3300035119 Ga0373956_0031704 Ga0373956_0031704_1508_2110 182
31 3300045976 Ga0466967_0118529 Ga0466967_0118529_521_1069 182
32 3300046511 Ga0495608_0102396 Ga0495608_0102396_1096_1698 182
33 3300046675 Ga0495657_0052434 Ga0495657_0052434_235_837 182
34 3300048088 Ga0495602_0052004 Ga0495602_0052004_1792_2394 182
35 3300048913 Ga0496110_0282047 Ga0496110_0282047_515_1063 182
36 3300050509 nmdc:mga0qj67_391191_c1 nmdc:mga0qj67_391191_c1_179_790 182
37 3300003373 JGI25407J50210_10008154 JGI25407J50210_100081542 183
38 3300003373 JGI25407J50210_10071352 JGI25407J50210_100713521 183
39 3300003373 JGI25407J50210_10082522 JGI25407J50210_100825221 183
40 3300005337 Ga0070682_100022818 Ga0070682_1000228182 183
41 3300005338 Ga0068868_100434738 Ga0068868_1004347382 183
42 3300005340 Ga0070689_100117565 Ga0070689_1001175653 183
43 3300005356 Ga0070674_100146400 Ga0070674_1001464002 183
44 3300005367 Ga0070667_100014650 Ga0070667_1000146506 183
45 3300005436 Ga0070713_100062755 Ga0070713_1000627554 183
46 3300005439 Ga0070711_100146831 Ga0070711_1001468313 183
47 3300005440 Ga0070705_100058161 Ga0070705_1000581612 183
48 3300005458 Ga0070681_10926199 Ga0070681_109261991 183
49 3300005468 Ga0070707_100129882 Ga0070707_1001298823 183
50 3300005471 Ga0070698_100554580 Ga0070698_1005545802 183
51 3300005535 Ga0070684_100156500 Ga0070684_1001565002 183
52 3300005536 Ga0070697_100133972 Ga0070697_1001339723 183
53 3300005544 Ga0070686_100022821 Ga0070686_1000228214 183
54 3300005844 Ga0068862_100005580 Ga0068862_1000055809 183
55 3300005937 Ga0081455_10007613 Ga0081455_100076135 183
56 3300005937 Ga0081455_10029931 Ga0081455_100299314 183
57 3300005937 Ga0081455_10034319 Ga0081455_100343197 183
58 3300005937 Ga0081455_10077257 Ga0081455_100772575 183
59 3300005937 Ga0081455_10124915 Ga0081455_101249154 183
60 3300005981 Ga0081538_10001721 Ga0081538_100017217 183
61 3300005981 Ga0081538_10004352 Ga0081538_100043526 183
62 3300005981 Ga0081538_10004854 Ga0081538_100048543 183
63 3300005981 Ga0081538_10007111 Ga0081538_100071112 183
64 3300005981 Ga0081538_10007744 Ga0081538_100077448 183
65 3300005981 Ga0081538_10010584 Ga0081538_1001058411 183
66 3300005981 Ga0081538_10014953 Ga0081538_100149536 183
67 3300005981 Ga0081538_10015180 Ga0081538_100151804 183
68 3300005985 Ga0081539_10085901 Ga0081539_100859012 183
69 3300006038 Ga0075365_10001325 Ga0075365_100013254 183
70 3300006058 Ga0075432_10069812 Ga0075432_100698122 183
71 3300006175 Ga0070712_100407151 Ga0070712_1004071512 183
72 3300006178 Ga0075367_10532157 Ga0075367_105321571 183
73 3300006844 Ga0075428_101019727 Ga0075428_1010197271 183
74 3300006846 Ga0075430_100003884 Ga0075430_1000038846 183
75 3300006846 Ga0075430_100142798 Ga0075430_1001427982 183
76 3300006847 Ga0075431_100025124 Ga0075431_1000251245 183
77 3300006847 Ga0075431_100050713 Ga0075431_1000507136 183
78 3300006847 Ga0075431_100408836 Ga0075431_1004088363 183
79 3300006847 Ga0075431_100828483 Ga0075431_1008284831 183
80 3300006852 Ga0075433_10044545 Ga0075433_100445452 183
81 3300006852 Ga0075433_10064760 Ga0075433_100647602 183
82 3300006852 Ga0075433_10420194 Ga0075433_104201942 183
83 3300006871 Ga0075434_100178251 Ga0075434_1001782513 183
84 3300006880 Ga0075429_100063123 Ga0075429_1000631234 183
85 3300007265 Ga0099794_10071075 Ga0099794_100710751 183
86 3300009093 Ga0105240_10202112 Ga0105240_102021122 183
87 3300009094 Ga0111539_10064987 Ga0111539_100649875 183
88 3300009094 Ga0111539_10386653 Ga0111539_103866533 183
89 3300009098 Ga0105245_10128170 Ga0105245_101281703 183
90 3300009098 Ga0105245_10210843 Ga0105245_102108434 183
91 3300009098 Ga0105245_10252496 Ga0105245_102524962 183
92 3300009101 Ga0105247_10077518 Ga0105247_100775182 183
93 3300009101 Ga0105247_10808716 Ga0105247_108087161 183
94 3300009147 Ga0114129_10420445 Ga0114129_104204452 183
95 3300009147 Ga0114129_10479541 Ga0114129_104795412 183
96 3300009147 Ga0114129_10574718 Ga0114129_105747182 183
97 3300009148 Ga0105243_10467841 Ga0105243_104678411 183
98 3300009177 Ga0105248_10732138 Ga0105248_107321381 183
99 3300009551 Ga0105238_10479350 Ga0105238_104793502 183
100 3300009553 Ga0105249_10011928 Ga0105249_100119282 183
101 3300009553 Ga0105249_10285724 Ga0105249_102857243 183
102 3300012507 Ga0157342_1020699 Ga0157342_10206991 183
103 3300012508 Ga0157315_1001954 Ga0157315_10019543 183
104 3300013105 Ga0157369_10595845 Ga0157369_105958451 183
105 3300013297 Ga0157378_11254310 Ga0157378_112543102 183
106 3300013297 Ga0157378_11886483 Ga0157378_118864831 183
107 3300013307 Ga0157372_10000024 Ga0157372_1000002479 183
108 3300013308 Ga0157375_10311128 Ga0157375_103111282 183
109 3300014326 Ga0157380_11868227 Ga0157380_118682272 183
110 3300014497 Ga0182008_10038836 Ga0182008_100388361 183
111 3300014968 Ga0157379_10021195 Ga0157379_100211954 183
112 3300014969 Ga0157376_10328658 Ga0157376_103286583 183
113 3300020070 Ga0206356_10875947 Ga0206356_108759471 183
114 3300021358 Ga0213873_10086319 Ga0213873_100863191 183
115 3300021377 Ga0213874_10001860 Ga0213874_100018604 183
116 3300021384 Ga0213876_10047210 Ga0213876_100472102 183
117 3300021384 Ga0213876_10084966 Ga0213876_100849663 183
118 3300021384 Ga0213876_10208677 Ga0213876_102086772 183
119 3300021388 Ga0213875_10007354 Ga0213875_100073548 183
120 3300025900 Ga0207710_10035790 Ga0207710_100357902 183
121 3300025901 Ga0207688_10049098 Ga0207688_100490982 183
122 3300025904 Ga0207647_10126516 Ga0207647_101265162 183
123 3300025907 Ga0207645_10686501 Ga0207645_106865012 183
124 3300025915 Ga0207693_10284680 Ga0207693_102846803 183
125 3300025915 Ga0207693_10907130 Ga0207693_109071302 183
126 3300025916 Ga0207663_10366030 Ga0207663_103660302 183
127 3300025918 Ga0207662_10030372 Ga0207662_100303723 183
128 3300025922 Ga0207646_10158237 Ga0207646_101582372 183
129 3300025928 Ga0207700_10018375 Ga0207700_100183753 183
130 3300025936 Ga0207670_10834843 Ga0207670_108348431 183
131 3300025939 Ga0207665_10770334 Ga0207665_107703341 183
132 3300025949 Ga0207667_11028842 Ga0207667_110288422 183
133 3300025961 Ga0207712_10005079 Ga0207712_100050799 183
134 3300025961 Ga0207712_10048641 Ga0207712_100486414 183
135 3300025972 Ga0207668_10225253 Ga0207668_102252532 183
136 3300026023 Ga0207677_10468269 Ga0207677_104682692 183
137 3300026035 Ga0207703_10142704 Ga0207703_101427042 183
138 3300026075 Ga0207708_10100939 Ga0207708_101009391 183
139 3300026078 Ga0207702_10146035 Ga0207702_101460352 183
140 3300026088 Ga0207641_10283181 Ga0207641_102831812 183
141 3300026089 Ga0207648_10078251 Ga0207648_100782512 183
142 3300026089 Ga0207648_10250382 Ga0207648_102503822 183
143 3300026118 Ga0207675_100239524 Ga0207675_1002395241 183
144 3300027907 Ga0207428_10027192 Ga0207428_100271921 183
145 3300027907 Ga0207428_10581002 Ga0207428_105810022 183
146 3300028379 Ga0268266_10080446 Ga0268266_100804462 183
147 3300028380 Ga0268265_10006868 Ga0268265_100068687 183
148 3300028381 Ga0268264_10054983 Ga0268264_100549832 183
149 3300028381 Ga0268264_10420239 Ga0268264_104202392 183
150 3300028381 Ga0268264_11171385 Ga0268264_111713851 183
151 3300028800 Ga0265338_10364295 Ga0265338_103642952 183
152 3300031548 Ga0307408_100007146 Ga0307408_1000071465 183
153 3300031548 Ga0307408_100138884 Ga0307408_1001388843 183
154 3300031548 Ga0307408_100744834 Ga0307408_1007448341 183
155 3300031595 Ga0265313_10032593 Ga0265313_100325932 183
156 3300031711 Ga0265314_10233237 Ga0265314_102332371 183
157 3300031712 Ga0265342_10168731 Ga0265342_101687312 183
158 3300031731 Ga0307405_10030797 Ga0307405_100307972 183
159 3300031731 Ga0307405_10032164 Ga0307405_100321645 183
160 3300031824 Ga0307413_10165508 Ga0307413_101655082 183
161 3300031852 Ga0307410_10021275 Ga0307410_100212755 183
162 3300031852 Ga0307410_10152788 Ga0307410_101527882 183
163 3300031901 Ga0307406_10000367 Ga0307406_100003675 183
164 3300031903 Ga0307407_10005260 Ga0307407_100052605 183
165 3300031911 Ga0307412_10662815 Ga0307412_106628152 183
166 3300031911 Ga0307412_10952865 Ga0307412_109528651 183
167 3300031995 Ga0307409_100000860 Ga0307409_10000086010 183
168 3300031995 Ga0307409_100021576 Ga0307409_1000215762 183
169 3300031995 Ga0307409_100040431 Ga0307409_1000404312 183
170 3300031995 Ga0307409_100519116 Ga0307409_1005191161 183
171 3300031995 Ga0307409_101032107 Ga0307409_1010321071 183
172 3300032002 Ga0307416_100000089 Ga0307416_10000008960 183
173 3300032002 Ga0307416_100017348 Ga0307416_1000173484 183
174 3300032002 Ga0307416_100053872 Ga0307416_1000538722 183
175 3300032002 Ga0307416_100504908 Ga0307416_1005049082 183
176 3300032004 Ga0307414_10125938 Ga0307414_101259381 183
177 3300032005 Ga0307411_10129577 Ga0307411_101295771 183
178 3300032126 Ga0307415_100000878 Ga0307415_10000087810 183
179 3300032126 Ga0307415_100001869 Ga0307415_1000018699 183
180 3300032126 Ga0307415_100013918 Ga0307415_1000139183 183
181 3300035083 Ga0373926_0033243 Ga0373926_0033243_86_649 183
182 3300035116 Ga0373945_0044395 Ga0373945_0044395_691_1254 183
183 3300035121 Ga0373960_0095801 Ga0373960_0095801_135_710 183
184 3300035170 Ga0373943_0002243 Ga0373943_0002243_2517_3080 183
185 3300035171 Ga0373946_0286269 Ga0373946_0286269_193_756 183
186 3300035691 Ga0373931_0110991 Ga0373931_0110991_559_1134 183
187 3300035692 Ga0373935_0088075 Ga0373935_0088075_1177_1740 183
188 3300035725 Ga0373947_0027069 Ga0373947_0027069_604_1167 183
189 3300037068 Ga0373925_0054612 Ga0373925_0054612_1937_2500 183
190 3300037312 Ga0395899_0008348 Ga0395899_0008348_4583_5146 183
191 3300037312 Ga0395899_0022127 Ga0395899_0022127_1108_1671 183
192 3300037312 Ga0395899_0221960 Ga0395899_0221960_355_918 183
193 3300037312 Ga0395899_0261565 Ga0395899_0261565_585_1148 183
194 3300037312 Ga0395899_0393640 Ga0395899_0393640_71_634 183
195 3300037312 Ga0395899_0400796 Ga0395899_0400796_122_685 183
196 3300037418 Ga0395900_0012817 Ga0395900_0012817_6031_6594 183
197 3300037418 Ga0395900_0020994 Ga0395900_0020994_3627_4178 183
198 3300037418 Ga0395900_0053758 Ga0395900_0053758_789_1340 183
199 3300037418 Ga0395900_0056955 Ga0395900_0056955_922_1485 183
200 3300037418 Ga0395900_0139869 Ga0395900_0139869_644_1207 183
201 3300037418 Ga0395900_0295863 Ga0395900_0295863_451_1014 183
202 3300037418 Ga0395900_0621139 Ga0395900_0621139_91_654 183
203 3300037466 Ga0395898_0005158 Ga0395898_0005158_5831_6394 183
204 3300037466 Ga0395898_0013655 Ga0395898_0013655_4266_4817 183
205 3300037466 Ga0395898_0014924 Ga0395898_0014924_6173_6736 183
206 3300037466 Ga0395898_0042574 Ga0395898_0042574_52_615 183
207 3300037466 Ga0395898_0133467 Ga0395898_0133467_565_1128 183
208 3300037466 Ga0395898_0274670 Ga0395898_0274670_1025_1588 183
209 3300037466 Ga0395898_0446279 Ga0395898_0446279_356_919 183
210 3300037466 Ga0395898_0487692 Ga0395898_0487692_297_860 183
211 3300037466 Ga0395898_0506103 Ga0395898_0506103_556_1119 183
212 3300037466 Ga0395898_0857434 Ga0395898_0857434_132_695 183
213 3300037471 Ga0395905_0004823 Ga0395905_0004823_4568_5131 183
214 3300037471 Ga0395905_0022170 Ga0395905_0022170_3459_4010 183
215 3300037471 Ga0395905_0201449 Ga0395905_0201449_1078_1641 183
216 3300037853 Ga0436364_0023304 Ga0436364_0023304_2795_3358 183
217 3300037853 Ga0436364_0133121 Ga0436364_0133121_341_901 183
218 3300037853 Ga0436364_0262228 Ga0436364_0262228_2043_2606 183
219 3300037853 Ga0436364_0804153 Ga0436364_0804153_2442_3080 183
220 3300037853 Ga0436364_0853176 Ga0436364_0853176_2214_2801 183
221 3300038443 Ga0395901_0023002 Ga0395901_0023002_3459_4010 183
222 3300038443 Ga0395901_0025835 Ga0395901_0025835_2447_3010 183
223 3300038443 Ga0395901_0026537 Ga0395901_0026537_1259_1822 183
224 3300038443 Ga0395901_0038544 Ga0395901_0038544_522_1085 183
225 3300038443 Ga0395901_0098219 Ga0395901_0098219_1124_1687 183
226 3300038443 Ga0395901_0105504 Ga0395901_0105504_355_918 183
227 3300038443 Ga0395901_0174659 Ga0395901_0174659_417_980 183
228 3300038443 Ga0395901_0629808 Ga0395901_0629808_182_745 183
229 3300038443 Ga0395901_0813518 Ga0395901_0813518_233_796 183
230 3300039437 Ga0436365_0150236 Ga0436365_0150236_295_858 183
231 3300039437 Ga0436365_0155754 Ga0436365_0155754_598_1236 183
232 3300039437 Ga0436365_1230013 Ga0436365_1230013_918_1571 183
233 3300039437 Ga0436365_1248108 Ga0436365_1248108_1221_1838 183
234 3300039437 Ga0436365_1762117 Ga0436365_1762117_17067_17630 183
235 3300039450 Ga0436363_0178570 Ga0436363_0178570_15_578 183
236 3300039450 Ga0436363_0828464 Ga0436363_0828464_488_1051 183
237 3300039450 Ga0436363_1081980 Ga0436363_1081980_2373_2990 183
238 3300039450 Ga0436363_1266409 Ga0436363_1266409_39_602 183
239 3300039450 Ga0436363_1398506 Ga0436363_1398506_903_1466 183
240 3300039450 Ga0436363_1620364 Ga0436363_1620364_2448_3011 183
241 3300039453 Ga0436362_0304971 Ga0436362_0304971_63_626 183
242 3300039453 Ga0436362_0567581 Ga0436362_0567581_1130_1693 183
243 3300039453 Ga0436362_0712664 Ga0436362_0712664_158_721 183
244 3300039453 Ga0436362_0728702 Ga0436362_0728702_731_1291 183
245 3300039453 Ga0436362_0748031 Ga0436362_0748031_402_965 183
246 3300041408 Ga0439453_0035494 Ga0439453_0035494_28_591 183
247 3300041494 Ga0451837_0256192 Ga0451837_0256192_853_1431 183
248 3300042009 Ga0439451_035831 Ga0439451_035831_179_742 183
249 3300042436 Ga0439435_0070462 Ga0439435_0070462_56_619 183
250 3300042438 Ga0439459_0096601 Ga0439459_0096601_47_628 183
251 3300044656 Ga0466969_0058760 Ga0466969_0058760_668_1231 183
252 3300044684 Ga0466966_0019954 Ga0466966_0019954_1064_1627 183
253 3300044694 Ga0466963_0013471 Ga0466963_0013471_3338_3901 183
254 3300044706 Ga0466964_0368219 Ga0466964_0368219_51_626 183
255 3300044719 Ga0466971_0038392 Ga0466971_0038392_799_1362 183
256 3300044842 Ga0466957_0024326 Ga0466957_0024326_1701_2264 183
257 3300044842 Ga0466957_0094444 Ga0466957_0094444_151_750 183
258 3300044901 Ga0466960_0204283 Ga0466960_0204283_328_891 183
259 3300045049 Ga0466959_0021215 Ga0466959_0021215_3948_4511 183
260 3300045049 Ga0466959_0122232 Ga0466959_0122232_1263_1826 183
261 3300045049 Ga0466959_0256420 Ga0466959_0256420_597_1160 183
262 3300045049 Ga0466959_0310425 Ga0466959_0310425_465_1064 183
263 3300045836 Ga0466958_0058266 Ga0466958_0058266_204_767 183
264 3300045836 Ga0466958_0227442 Ga0466958_0227442_29_592 183
265 3300045976 Ga0466967_0158430 Ga0466967_0158430_852_1403 183
266 3300045976 Ga0466967_0506756 Ga0466967_0506756_258_821 183
267 3300046455 Ga0495603_0465063 Ga0495603_0465063_14_577 183
268 3300046459 Ga0495629_0138542 Ga0495629_0138542_366_929 183
269 3300046462 Ga0495651_0071988 Ga0495651_0071988_1036_1734 183
270 3300046491 Ga0495584_0165991 Ga0495584_0165991_138_701 183
271 3300046501 Ga0495607_0080254 Ga0495607_0080254_780_1343 183
272 3300046506 Ga0495583_0163525 Ga0495583_0163525_321_884 183
273 3300046512 Ga0495610_0191219 Ga0495610_0191219_89_652 183
274 3300046523 Ga0495644_0157500 Ga0495644_0157500_248_811 183
275 3300046529 Ga0495652_0312982 Ga0495652_0312982_250_948 183
276 3300046615 Ga0495656_0064863 Ga0495656_0064863_433_996 183
277 3300046665 Ga0495661_0314964 Ga0495661_0314964_105_668 183
278 3300046678 Ga0495599_0308128 Ga0495599_0308128_186_749 183
279 3300046691 Ga0495670_0298580 Ga0495670_0298580_240_803 183
280 3300046692 Ga0495671_0314684 Ga0495671_0314684_146_709 183
281 3300047315 Ga0495581_0039180 Ga0495581_0039180_1285_1848 183
282 3300047321 Ga0495676_0200350 Ga0495676_0200350_814_1377 183
283 3300048904 Ga0496101_0320345 Ga0496101_0320345_42_614 183
284 3300048905 Ga0496102_0376133 Ga0496102_0376133_736_1302 183
285 3300048909 Ga0496106_0415382 Ga0496106_0415382_402_1055 183
286 3300048911 Ga0496108_0022184 Ga0496108_0022184_3274_3846 183
287 3300048911 Ga0496108_0405116 Ga0496108_0405116_171_824 183
288 3300048912 Ga0496109_0060136 Ga0496109_0060136_1281_1853 183
289 3300048913 Ga0496110_0385235 Ga0496110_0385235_656_1219 183
290 3300048913 Ga0496110_0604092 Ga0496110_0604092_382_939 183
291 3300048915 Ga0496112_0629499 Ga0496112_0629499_86_658 183
292 3300048918 Ga0496115_0066283 Ga0496115_0066283_1399_1962 183
293 3300048918 Ga0496115_0140924 Ga0496115_0140924_1304_1876 183
294 3300048929 Ga0496126_0013502 Ga0496126_0013502_5267_5818 183
295 3300049570 Ga0501033_0135941 Ga0501033_0135941_458_1012 183
296 3300049571 Ga0501034_0521823 Ga0501034_0521823_359_913 183
297 3300049573 Ga0501037_0064110 Ga0501037_0064110_1038_1592 183
298 3300049574 Ga0501038_0482761 Ga0501038_0482761_107_661 183
299 3300049575 Ga0501039_0095903 Ga0501039_0095903_21_575 183
300 3300049577 Ga0501041_0089797 Ga0501041_0089797_106_669 183
301 3300049578 Ga0501042_0116536 Ga0501042_0116536_669_1232 183
302 3300049578 Ga0501042_0221816 Ga0501042_0221816_188_742 183
303 3300049578 Ga0501042_0591152 Ga0501042_0591152_161_736 183
304 3300049580 Ga0501046_0036135 Ga0501046_0036135_2386_2940 183
305 3300049580 Ga0501046_0211838 Ga0501046_0211838_305_868 183
306 3300049580 Ga0501046_0651809 Ga0501046_0651809_105_668 183
307 3300049580 Ga0501046_0787067 Ga0501046_0787067_31_594 183
308 3300049581 Ga0501047_0001096 Ga0501047_0001096_19971_20525 183
309 3300049581 Ga0501047_0042493 Ga0501047_0042493_1868_2422 183
310 3300049582 Ga0501048_0552481 Ga0501048_0552481_174_728 183
311 3300049585 Ga0501069_0004899 Ga0501069_0004899_3134_3688 183
312 3300049586 Ga0501070_0030012 Ga0501070_0030012_2385_2939 183
313 3300049586 Ga0501070_0932744 Ga0501070_0932744_41_604 183
314 3300049587 Ga0501071_0063601 Ga0501071_0063601_1947_2516 183
315 3300049587 Ga0501071_0112493 Ga0501071_0112493_863_1426 183
316 3300049588 Ga0501072_0116327 Ga0501072_0116327_1555_2109 183
317 3300049590 Ga0501074_0093548 Ga0501074_0093548_1578_2132 183
318 3300049591 Ga0501075_0065940 Ga0501075_0065940_1034_1597 183
319 3300049592 Ga0501076_0038427 Ga0501076_0038427_2687_3241 183
320 3300049592 Ga0501076_0068072 Ga0501076_0068072_241_819 183
321 3300049592 Ga0501076_0316468 Ga0501076_0316468_297_860 183
322 3300049592 Ga0501076_0635455 Ga0501076_0635455_63_626 183
323 3300049592 Ga0501076_0790316 Ga0501076_0790316_207_770 183
324 3300049593 Ga0501077_0733357 Ga0501077_0733357_46_609 183
325 3300049665 Ga0501227_062215 Ga0501227_062215_62_625 183
326 3300049741 Ga0501079_0206483 Ga0501079_0206483_70_633 183
327 3300049741 Ga0501079_0311280 Ga0501079_0311280_458_1021 183
328 3300049742 Ga0501080_0061803 Ga0501080_0061803_1896_2450 183
329 3300049744 Ga0501083_0055132 Ga0501083_0055132_83_661 183
330 3300049744 Ga0501083_0158146 Ga0501083_0158146_231_785 183
331 3300049776 Ga0501280_034538 Ga0501280_034538_219_782 183
332 3300049823 Ga0501044_0059150 Ga0501044_0059150_650_1204 183
333 3300049824 Ga0501045_0434370 Ga0501045_0434370_158_721 183
334 3300050491 nmdc:mga00v17_5164_c1 nmdc:mga00v17_5164_c1_187_753 183
335 3300050492 nmdc:mga0yw44_169553_c1 nmdc:mga0yw44_169553_c1_233_799 183
336 3300050494 nmdc:mga06z11_209579_c1 nmdc:mga06z11_209579_c1_406_966 183
337 3300050507 nmdc:mga05p37_113980_c1 nmdc:mga05p37_113980_c1_2572_3135 183
338 3300050507 nmdc:mga05p37_476466_c1 nmdc:mga05p37_476466_c1_723_1286 183
339 3300050507 nmdc:mga05p37_5413_c1 nmdc:mga05p37_5413_c1_14208_14771 183
340 3300050508 nmdc:mga09592_128383_c1 nmdc:mga09592_128383_c1_1596_2159 183
341 3300050508 nmdc:mga09592_152810_c1 nmdc:mga09592_152810_c1_636_1199 183
342 3300050509 nmdc:mga0qj67_134523_c1 nmdc:mga0qj67_134523_c1_379_942 183
343 3300050509 nmdc:mga0qj67_9899_c1 nmdc:mga0qj67_9899_c1_5442_6005 183
344 3300050510 nmdc:mga06r32_182227_c1 nmdc:mga06r32_182227_c1_1053_1616 183
345 3300050510 nmdc:mga06r32_3479_c1 nmdc:mga06r32_3479_c1_11994_12557 183
346 3300050510 nmdc:mga06r32_39763_c1 nmdc:mga06r32_39763_c1_834_1397 183
347 3300050510 nmdc:mga06r32_673013_c1 nmdc:mga06r32_673013_c1_71_634 183
348 3300050510 nmdc:mga06r32_735404_c1 nmdc:mga06r32_735404_c1_278_841 183
349 3300050510 nmdc:mga06r32_89654_c1 nmdc:mga06r32_89654_c1_1736_2299 183
350 3300050511 nmdc:mga08y16_194511_c1 nmdc:mga08y16_194511_c1_415_978 183
351 3300050511 nmdc:mga08y16_441672_c1 nmdc:mga08y16_441672_c1_156_719 183
352 3300050511 nmdc:mga08y16_492988_c1 nmdc:mga08y16_492988_c1_534_1109 183
353 3300050512 nmdc:mga0n895_110735_c1 nmdc:mga0n895_110735_c1_1059_1622 183
354 3300050512 nmdc:mga0n895_194966_c1 nmdc:mga0n895_194966_c1_620_1183 183
355 3300050513 nmdc:mga0rr50_277486_c1 nmdc:mga0rr50_277486_c1_195_764 183
356 3300050515 nmdc:mga0a205_10975_c1 nmdc:mga0a205_10975_c1_5356_5919 183
357 3300050515 nmdc:mga0a205_32149_c1 nmdc:mga0a205_32149_c1_685_1248 183
358 3300050515 nmdc:mga0a205_397599_c1 nmdc:mga0a205_397599_c1_303_872 183
359 3300053078 Ga0495612_0016469 Ga0495612_0016469_73_771 183
360 3300053083 Ga0495655_0032864 Ga0495655_0032864_403_966 183
361 3300053085 Ga0495619_0124820 Ga0495619_0124820_576_1274 183
362 3300054114 Ga0501084_0011572 Ga0501084_0011572_6435_7067 183
363 3300054114 Ga0501084_0092329 Ga0501084_0092329_28_606 183
364 3300054114 Ga0501084_0231541 Ga0501084_0231541_676_1230 183
365 3300054114 Ga0501084_0773366 Ga0501084_0773366_189_746 183
366 3300059424 Ga0590075_015474 Ga0590075_015474_725_1288 183
367 3300060353 Ga0501082_0917145 Ga0501082_0917145_62_625 183
368 3300061719 Ga0466962_0034863 Ga0466962_0034863_1627_2190 183
369 3300061719 Ga0466962_0314491 Ga0466962_0314491_103_702 183
370 3300061734 Ga0530510_0119447 Ga0530510_0119447_411_974 183
371 3300002067 JGI24735J21928_10017961 JGI24735J21928_100179613 184
372 3300005530 Ga0070679_100790467 Ga0070679_1007904671 184
373 3300005614 Ga0068856_100475953 Ga0068856_1004759532 184
374 3300009148 Ga0105243_11735822 Ga0105243_117358221 184
375 3300009177 Ga0105248_10702412 Ga0105248_107024122 184
376 3300013104 Ga0157370_10146515 Ga0157370_101465154 184
377 3300014325 Ga0163163_10161406 Ga0163163_101614063 184
378 3300021388 Ga0213875_10128419 Ga0213875_101284193 184
379 3300026078 Ga0207702_10364513 Ga0207702_103645132 184
380 3300037853 Ga0436364_0048882 Ga0436364_0048882_825_1379 184
381 3300044694 Ga0466963_0039188 Ga0466963_0039188_646_1209 184
382 3300044694 Ga0466963_0520892 Ga0466963_0520892_109_672 184
383 3300044842 Ga0466957_0304191 Ga0466957_0304191_71_634 184
384 3300045049 Ga0466959_0356401 Ga0466959_0356401_171_737 184
385 3300045836 Ga0466958_0094116 Ga0466958_0094116_543_1109 184
386 3300046459 Ga0495629_0405982 Ga0495629_0405982_312_887 184
387 3300048907 Ga0496104_0010691 Ga0496104_0010691_1238_1813 184
388 3300048908 Ga0496105_0032643 Ga0496105_0032643_1754_2329 184
389 3300048911 Ga0496108_0446077 Ga0496108_0446077_434_1009 184
390 3300048912 Ga0496109_0065351 Ga0496109_0065351_261_836 184
391 3300048912 Ga0496109_0422024 Ga0496109_0422024_99_674 184
392 3300048915 Ga0496112_0160278 Ga0496112_0160278_1248_1823 184
393 3300048915 Ga0496112_0160943 Ga0496112_0160943_850_1425 184
394 3300049571 Ga0501034_0115313 Ga0501034_0115313_1637_2191 184
395 3300049573 Ga0501037_0362656 Ga0501037_0362656_341_895 184
396 3300049574 Ga0501038_0047471 Ga0501038_0047471_2375_2929 184
397 3300049579 Ga0501043_0108587 Ga0501043_0108587_1393_1947 184
398 3300049581 Ga0501047_0004906 Ga0501047_0004906_9622_10176 184
399 3300049822 Ga0501035_0002282 Ga0501035_0002282_3482_4036 184
400 3300049823 Ga0501044_0031849 Ga0501044_0031849_4787_5341 184

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

1

177

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.808 2 180
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.8058 2 181
3ky8-assembly1.cif.gz_B crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution 0.7968 2 181
2gd9-assembly1.cif.gz_A crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.7946 2 180
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.7905 1 180
ID Description Score Start End Superfamily
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.807 2 179 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8057 1 181 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8014 1 181 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7932 2 179 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7851 2 184 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A537Z678-F1-model_v4 Dihydrofolate reductase 0.9519 1 115 GO:0008703
GO:0009231
AF-A0A537Z678-F1-model_v4 Dihydrofolate reductase 0.944 1 115 GO:0008703
GO:0009231
AF-A0A173LMJ6-F1-model_v4 Uncharacterized protein YyaP 0.9319 2 181 GO:0008703
GO:0009231
AF-A0A1A0QBW4-F1-model_v4 Deaminase 0.9295 2 181 GO:0008703
GO:0009231
AF-A0A3N1HZN0-F1-model_v4 Dihydrofolate reductase 0.9224 2 184 GO:0008703
GO:0009231

Feature Viewer

pLDDT pTM Quality
91.48 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map