F434407

General Info

Members Datasets Scaffolds Average Seq Length
399 220 399 134

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0033122|Ga0501034_0033122_4021_4422
Length 117
Sequence MTDASALDGLVPDNLRPHTRKVVLEDYELQLDIGFHEFEVGSPQRLLVSVEVWLDAAAFPSDDDAAATWDYDFLRREIGRLVAGRRFNLQETRLRVATRKPDIYADCAGVGVELASF

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
165 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
166 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
167 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
168 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
169 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
170 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
171 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
172 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
173 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
174 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
193 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
194 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
206 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
207 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
214 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
215 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
216 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
219 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
220 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.51
Nodule 0
Rhizoplane 3.76
Rhizosphere 87.72
Stem 0
Stem Tuber 0
Unclassified 5.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000004 3300001904 Bacteria 55308
2 JGI24752J21851_1000287 3300001976 Bacteria 7040
3 JGI24740J21852_10001685 3300001979 Bacteria 10151
4 JGI24739J22299_10019745 3300001989 Bacteria 2410
5 JGI24739J22299_10054543 3300001989 Bacteria 1280
6 JGI24737J22298_10020333 3300001990 Bacteria 2119
7 JGI24735J21928_10014365 3300002067 Unclassified 2481
8 JGI24750J21931_1004592 3300002070 Bacteria 1678
9 JGI24748J21848_1000032 3300002074 Bacteria 79791
10 JGI24738J21930_10002312 3300002075 Bacteria 5031
11 JGI24738J21930_10025179 3300002075 Bacteria 1223
12 JGI24749J21850_1002070 3300002076 Unclassified 2829
13 JGI24034J26672_10000022 3300002239 Bacteria 116342
14 JGI24034J26672_10026220 3300002239 Bacteria 934
15 JGI24742J22300_10006270 3300002244 Bacteria 1964
16 JGI24751J29686_10016038 3300002459 Bacteria 1546
17 Ga0065707_10140914 3300005295 Bacteria 1774
18 Ga0065707_10222871 3300005295 Bacteria 1218
19 Ga0070658_10000040 3300005327 Bacteria 136073
20 Ga0070658_10049461 3300005327 Unclassified 3406
21 Ga0070658_11055547 3300005327 Bacteria 707
22 Ga0070676_11124364 3300005328 Unclassified 594
23 Ga0070690_100000038 3300005330 Bacteria 60092
24 Ga0070670_100049065 3300005331 Bacteria 3631
25 Ga0070670_100109359 3300005331 Bacteria 2382
26 Ga0070670_101093550 3300005331 Bacteria 727
27 Ga0070677_10010721 3300005333 Bacteria 3142
28 Ga0070677_10408205 3300005333 Unclassified 717
29 Ga0068869_100465896 3300005334 Bacteria 1050
30 Ga0068869_101941988 3300005334 Bacteria 528
31 Ga0070666_10000002 3300005335 Bacteria 478684
32 Ga0070680_100000397 3300005336 Bacteria 29604
33 Ga0068868_100000107 3300005338 Bacteria 51516
34 Ga0070660_100003071 3300005339 Bacteria 11479
35 Ga0070660_100004905 3300005339 Bacteria 9253
36 Ga0070660_100006630 3300005339 Bacteria 8033
37 Ga0070660_100072098 3300005339 Bacteria 2698
38 Ga0070660_100670590 3300005339 Bacteria 869
39 Ga0070660_100756353 3300005339 Bacteria 816
40 Ga0070689_100016528 3300005340 Bacteria 5400
41 Ga0070661_100000011 3300005344 Bacteria 175355
42 Ga0070661_100313312 3300005344 Bacteria 1224
43 Ga0070661_101070774 3300005344 Bacteria 671
44 Ga0070692_10031768 3300005345 Bacteria 2649
45 Ga0070668_100000048 3300005347 Bacteria 75276
46 Ga0070668_100024562 3300005347 Unclassified 4567
47 Ga0070668_100048878 3300005347 Bacteria 3254
48 Ga0070668_101054416 3300005347 Unclassified 732
49 Ga0070668_101903685 3300005347 Bacteria 548
50 Ga0070669_100000237 3300005353 Bacteria 45913
51 Ga0070671_100014222 3300005355 Bacteria 6426
52 Ga0070671_100035172 3300005355 Bacteria 4150
53 Ga0070671_100178563 3300005355 Bacteria 1797
54 Ga0070673_100756587 3300005364 Bacteria 895
55 Ga0070688_100002371 3300005365 Bacteria 9510
56 Ga0070688_100962541 3300005365 Bacteria 676
57 Ga0070659_100000021 3300005366 Bacteria 154212
58 Ga0070659_100005532 3300005366 Bacteria 9077
59 Ga0070659_100065781 3300005366 Bacteria 2871
60 Ga0070659_100709567 3300005366 Bacteria 870
61 Ga0070667_100112266 3300005367 Unclassified 2364
62 Ga0070667_100330442 3300005367 Bacteria 1377
63 Ga0070701_10174101 3300005438 Bacteria 1255
64 Ga0070705_101876121 3300005440 Unclassified 509
65 Ga0070700_100386995 3300005441 Unclassified 1048
66 Ga0070708_100781011 3300005445 Bacteria 898
67 Ga0070663_100626182 3300005455 Bacteria 907
68 Ga0070678_100715990 3300005456 Bacteria 903
69 Ga0070678_100716831 3300005456 Bacteria 902
70 Ga0070662_100107762 3300005457 Unclassified 2118
71 Ga0070662_100958403 3300005457 Unclassified 731
72 Ga0070662_101107149 3300005457 Bacteria 680
73 Ga0070681_10938943 3300005458 Bacteria 784
74 Ga0070685_10000425 3300005466 Bacteria 24783
75 Ga0070679_100000008 3300005530 Bacteria 194672
76 Ga0070679_100559786 3300005530 Bacteria 1087
77 Ga0068853_100032016 3300005539 Bacteria 4452
78 Ga0068853_100259781 3300005539 Bacteria 1596
79 Ga0068853_101695928 3300005539 Unclassified 612
80 Ga0070672_101536032 3300005543 Bacteria 597
81 Ga0070686_100000003 3300005544 Bacteria 308397
82 Ga0070686_100000458 3300005544 Bacteria 24928
83 Ga0070696_102029131 3300005546 Bacteria 500
84 Ga0070665_100000036 3300005548 Bacteria 314603
85 Ga0070665_100000207 3300005548 Bacteria 102416
86 Ga0070665_100000773 3300005548 Bacteria 42151
87 Ga0070665_100021852 3300005548 Bacteria 6435
88 Ga0068855_100378817 3300005563 Bacteria 1554
89 Ga0068855_101362188 3300005563 Unclassified 732
90 Ga0070664_100155518 3300005564 Bacteria 2020
91 Ga0070664_101801247 3300005564 Bacteria 581
92 Ga0068857_100215778 3300005577 Bacteria 1751
93 Ga0068857_101184824 3300005577 Bacteria 739
94 Ga0068857_102505190 3300005577 Unclassified 506
95 Ga0068854_101020212 3300005578 Unclassified 733
96 Ga0068856_101591249 3300005614 Bacteria 667
97 Ga0068856_102568833 3300005614 Unclassified 515
98 Ga0068852_102257239 3300005616 Unclassified 565
99 Ga0068859_100002979 3300005617 Bacteria 17164
100 Ga0068859_100010149 3300005617 Bacteria 9485
101 Ga0068859_100045749 3300005617 Bacteria 4397
102 Ga0068859_100235061 3300005617 Bacteria 1921
103 Ga0068864_100001120 3300005618 Bacteria 22422
104 Ga0068864_100005456 3300005618 Bacteria 10426
105 Ga0068861_100065549 3300005719 Unclassified 2798
106 Ga0068851_10012671 3300005834 Bacteria 3980
107 Ga0068851_10394461 3300005834 Bacteria 813
108 Ga0068863_100000017 3300005841 Bacteria 207950
109 Ga0068863_100000095 3300005841 Bacteria 96080
110 Ga0068863_100024498 3300005841 Bacteria 5756
111 Ga0068863_100072501 3300005841 Bacteria 3258
112 Ga0068858_100000953 3300005842 Bacteria 29927
113 Ga0068860_100000001 3300005843 Bacteria 703043
114 Ga0068860_100001110 3300005843 Bacteria 29623
115 Ga0068862_100000125 3300005844 Bacteria 89536
116 Ga0068862_100000752 3300005844 Bacteria 32470
117 Ga0068862_100040729 3300005844 Bacteria 3949
118 Ga0068862_100320655 3300005844 Unclassified 1430
119 Ga0068862_101611065 3300005844 Bacteria 656
120 Ga0081539_10054088 3300005985 Bacteria 2243
121 Ga0075362_10509205 3300006177 Bacteria 616
122 Ga0075366_10148116 3300006195 Bacteria 1421
123 Ga0068871_100534355 3300006358 Unclassified 1060
124 Ga0075430_100250729 3300006846 Bacteria 1467
125 Ga0075434_100300200 3300006871 Bacteria 1626
126 Ga0097620_100002979 3300006931 Bacteria 17164
127 Ga0097620_100010149 3300006931 Bacteria 9485
128 Ga0097620_100045749 3300006931 Bacteria 4397
129 Ga0097620_100235066 3300006931 Bacteria 1921
130 Ga0105251_10488246 3300009011 Unclassified 574
131 Ga0105240_10281120 3300009093 Bacteria 1911
132 Ga0105240_10894284 3300009093 Unclassified 956
133 Ga0111539_11935170 3300009094 Bacteria 684
134 Ga0105245_10011830 3300009098 Bacteria 7590
135 Ga0105245_10119368 3300009098 Bacteria 2462
136 Ga0105245_11422023 3300009098 Bacteria 744
137 Ga0105247_10006116 3300009101 Bacteria 7475
138 Ga0105247_10037619 3300009101 Unclassified 2952
139 Ga0105243_12111424 3300009148 Bacteria 599
140 Ga0105241_10862999 3300009174 Unclassified 838
141 Ga0105242_12136774 3300009176 Bacteria 604
142 Ga0105248_10001494 3300009177 Bacteria 26021
143 Ga0105248_10036961 3300009177 Bacteria 5461
144 Ga0105248_10847329 3300009177 Bacteria 1032
145 Ga0105238_10105922 3300009551 Bacteria 2794
146 Ga0105238_10766300 3300009551 Bacteria 979
147 Ga0105238_11864241 3300009551 Unclassified 634
148 Ga0105249_10000015 3300009553 Bacteria 282138
149 Ga0105249_10000026 3300009553 Bacteria 232053
150 Ga0105249_10048389 3300009553 Bacteria 3876
151 Ga0105239_11569159 3300010375 Bacteria 761
152 Ga0105239_12861468 3300010375 Unclassified 563
153 Ga0105246_10411063 3300011119 Bacteria 1126
154 Ga0157326_1000156 3300012513 Bacteria 7474
155 Ga0157373_10045257 3300013100 Bacteria 3142
156 Ga0157371_10080730 3300013102 Bacteria 2303
157 Ga0157370_10024543 3300013104 Bacteria 5970
158 Ga0157369_10067922 3300013105 Bacteria 3830
159 Ga0157369_10175383 3300013105 Bacteria 2257
160 Ga0157369_10189121 3300013105 Bacteria 2164
161 Ga0157369_11457228 3300013105 Unclassified 697
162 Ga0163162_10022495 3300013306 Bacteria 6212
163 Ga0163162_10372282 3300013306 Bacteria 1562
164 Ga0157372_10047131 3300013307 Bacteria 4787
165 Ga0157372_10826454 3300013307 Bacteria 1076
166 Ga0157372_11137696 3300013307 Bacteria 903
167 Ga0157372_11396930 3300013307 Unclassified 807
168 Ga0157372_12229308 3300013307 Bacteria 629
169 Ga0157375_10181247 3300013308 Bacteria 2258
170 Ga0163163_10024725 3300014325 Bacteria 5719
171 Ga0163163_10523040 3300014325 Bacteria 1249
172 Ga0157380_10002341 3300014326 Bacteria 12732
173 Ga0157380_10032461 3300014326 Bacteria 4016
174 Ga0157380_10241211 3300014326 Bacteria 1630
175 Ga0157379_10057490 3300014968 Bacteria 3476
176 Ga0157376_10616844 3300014969 Bacteria 1081
177 Ga0163161_10000008 3300017792 Bacteria 294642
178 Ga0206356_10993937 3300020070 Bacteria 1718
179 Ga0206354_11109695 3300020081 Bacteria 7304
180 Ga0206353_11073733 3300020082 Bacteria 7999
181 Ga0213873_10000012 3300021358 Bacteria 210531
182 Ga0213876_10000021 3300021384 Bacteria 260105
183 Ga0213876_10000261 3300021384 Bacteria 48782
184 Ga0213876_10024769 3300021384 Bacteria 3168
185 Ga0213876_10033240 3300021384 Bacteria 2719
186 Ga0213875_10309503 3300021388 Bacteria 748
187 Ga0207672_1000709 3300025223 Bacteria 3786
188 Ga0207682_10013706 3300025893 Bacteria 3156
189 Ga0207682_10148956 3300025893 Bacteria 1054
190 Ga0207642_11037042 3300025899 Bacteria 529
191 Ga0207710_10006260 3300025900 Bacteria 5087
192 Ga0207680_10000004 3300025903 Bacteria 827324
193 Ga0207647_10000952 3300025904 Bacteria 22408
194 Ga0207705_10000002 3300025909 Bacteria 2046852
195 Ga0207705_10144493 3300025909 Unclassified 1779
196 Ga0207705_10742274 3300025909 Bacteria 763
197 Ga0207654_10000698 3300025911 Bacteria 18736
198 Ga0207654_10902662 3300025911 Unclassified 641
199 Ga0207695_10003217 3300025913 Bacteria 23248
200 Ga0207695_10312278 3300025913 Bacteria 1462
201 Ga0207671_10002254 3300025914 Bacteria 20881
202 Ga0207660_10000259 3300025917 Bacteria 34453
203 Ga0207657_10001293 3300025919 Bacteria 26594
204 Ga0207657_10004920 3300025919 Bacteria 14047
205 Ga0207657_10021190 3300025919 Bacteria 6123
206 Ga0207657_10029482 3300025919 Bacteria 4993
207 Ga0207657_10565778 3300025919 Bacteria 888
208 Ga0207657_10833696 3300025919 Bacteria 712
209 Ga0207649_10000221 3300025920 Bacteria 46316
210 Ga0207649_10304336 3300025920 Bacteria 1166
211 Ga0207649_10320002 3300025920 Bacteria 1139
212 Ga0207649_11116432 3300025920 Bacteria 622
213 Ga0207652_10000008 3300025921 Bacteria 286698
214 Ga0207652_11084947 3300025921 Bacteria 701
215 Ga0207681_10001005 3300025923 Bacteria 18414
216 Ga0207681_10169117 3300025923 Bacteria 1656
217 Ga0207694_10001423 3300025924 Bacteria 20509
218 Ga0207694_10223534 3300025924 Bacteria 1536
219 Ga0207694_11237711 3300025924 Bacteria 631
220 Ga0207650_10057164 3300025925 Bacteria 2900
221 Ga0207650_10183759 3300025925 Bacteria 1667
222 Ga0207650_10355935 3300025925 Bacteria 1205
223 Ga0207659_10109474 3300025926 Bacteria 2097
224 Ga0207687_10009112 3300025927 Bacteria 6490
225 Ga0207644_10000010 3300025931 Bacteria 226989
226 Ga0207644_10000522 3300025931 Bacteria 24894
227 Ga0207644_10018659 3300025931 Bacteria 4695
228 Ga0207644_10171303 3300025931 Bacteria 1695
229 Ga0207690_10000030 3300025932 Bacteria 156832
230 Ga0207690_10003661 3300025932 Bacteria 9154
231 Ga0207690_10044707 3300025932 Bacteria 2921
232 Ga0207690_10172301 3300025932 Bacteria 1622
233 Ga0207706_10035095 3300025933 Bacteria 4461
234 Ga0207706_10849266 3300025933 Bacteria 773
235 Ga0207670_10007078 3300025936 Bacteria 6247
236 Ga0207711_10009501 3300025941 Bacteria 8113
237 Ga0207711_10035890 3300025941 Bacteria 4204
238 Ga0207689_10227496 3300025942 Bacteria 1542
239 Ga0207679_10560304 3300025945 Unclassified 1026
240 Ga0207667_10003138 3300025949 Bacteria 20458
241 Ga0207651_10364733 3300025960 Bacteria 1220
242 Ga0207712_10000001 3300025961 Bacteria 750309
243 Ga0207712_10000023 3300025961 Bacteria 282081
244 Ga0207712_10087120 3300025961 Bacteria 2289
245 Ga0207668_10000075 3300025972 Bacteria 75329
246 Ga0207668_10016105 3300025972 Bacteria 4659
247 Ga0207668_10026633 3300025972 Unclassified 3756
248 Ga0207668_11669214 3300025972 Bacteria 575
249 Ga0207640_10014896 3300025981 Bacteria 4487
250 Ga0207640_10098126 3300025981 Unclassified 2047
251 Ga0207640_10367790 3300025981 Bacteria 1161
252 Ga0207640_11008149 3300025981 Bacteria 733
253 Ga0207658_10000832 3300025986 Bacteria 25782
254 Ga0207677_10000027 3300026023 Bacteria 125785
255 Ga0207677_10716766 3300026023 Bacteria 889
256 Ga0207703_10005736 3300026035 Bacteria 9949
257 Ga0207678_10004471 3300026067 Bacteria 12567
258 Ga0207702_10001800 3300026078 Bacteria 21115
259 Ga0207702_11111894 3300026078 Bacteria 784
260 Ga0207641_10000036 3300026088 Bacteria 213165
261 Ga0207641_10000148 3300026088 Bacteria 99601
262 Ga0207641_10017706 3300026088 Bacteria 5836
263 Ga0207676_10000479 3300026095 Bacteria 33652
264 Ga0207676_10027605 3300026095 Bacteria 4230
265 Ga0207674_10010906 3300026116 Bacteria 10233
266 Ga0207675_100006136 3300026118 Bacteria 11423
267 Ga0207675_100383719 3300026118 Unclassified 1382
268 Ga0207683_10048245 3300026121 Bacteria 3729
269 Ga0207683_10783474 3300026121 Bacteria 885
270 Ga0268266_10000042 3300028379 Bacteria 316826
271 Ga0268266_10000171 3300028379 Bacteria 118317
272 Ga0268266_10000432 3300028379 Bacteria 62927
273 Ga0268266_10035944 3300028379 Bacteria 4214
274 Ga0268265_10000049 3300028380 Bacteria 177242
275 Ga0268265_10001122 3300028380 Bacteria 23704
276 Ga0268265_10175032 3300028380 Bacteria 1838
277 Ga0268265_10200475 3300028380 Bacteria 1731
278 Ga0268265_11503446 3300028380 Bacteria 677
279 Ga0268264_10000006 3300028381 Bacteria 827324
280 Ga0268264_10000682 3300028381 Bacteria 39550
281 Ga0268264_10015313 3300028381 Bacteria 6289
282 Ga0307408_100041810 3300031548 Bacteria 3251
283 Ga0307408_100053893 3300031548 Bacteria 2907
284 Ga0307408_100544442 3300031548 Bacteria 1023
285 Ga0307408_100903494 3300031548 Bacteria 808
286 Ga0307408_100966609 3300031548 Bacteria 783
287 Ga0307405_10001326 3300031731 Bacteria 10369
288 Ga0307413_10087631 3300031824 Bacteria 2017
289 Ga0307413_10090807 3300031824 Bacteria 1988
290 Ga0307413_10139012 3300031824 Bacteria 1675
291 Ga0307413_10693680 3300031824 Bacteria 845
292 Ga0307410_10663083 3300031852 Bacteria 876
293 Ga0307410_10864771 3300031852 Bacteria 773
294 Ga0307410_11375745 3300031852 Bacteria 619
295 Ga0307406_10003999 3300031901 Bacteria 8015
296 Ga0307406_10344903 3300031901 Bacteria 1161
297 Ga0307406_10351818 3300031901 Bacteria 1152
298 Ga0307407_10309422 3300031903 Bacteria 1105
299 Ga0307412_10225390 3300031911 Bacteria 1440
300 Ga0307412_10539765 3300031911 Bacteria 978
301 Ga0307416_100008107 3300032002 Bacteria 6743
302 Ga0307416_100099748 3300032002 Bacteria 2523
303 Ga0307416_100332421 3300032002 Unclassified 1528
304 Ga0307416_100685514 3300032002 Bacteria 1113
305 Ga0307416_101405501 3300032002 Bacteria 804
306 Ga0307414_10158449 3300032004 Bacteria 1795
307 Ga0307414_10457355 3300032004 Bacteria 1121
308 Ga0307414_10729991 3300032004 Bacteria 899
309 Ga0307414_11532352 3300032004 Bacteria 621
310 Ga0307411_10104319 3300032005 Bacteria 2013
311 Ga0307411_10401793 3300032005 Bacteria 1133
312 Ga0307411_10721785 3300032005 Bacteria 870
313 Ga0307411_11286129 3300032005 Unclassified 666
314 Ga0307415_100503624 3300032126 Bacteria 1059
315 Ga0307415_101393336 3300032126 Bacteria 667
316 Ga0307510_10463589 3300033180 Bacteria 708
317 Ga0395905_0035873 3300037471 Bacteria 4657
318 Ga0436364_0080613 3300037853 Bacteria 927
319 Ga0395901_0154053 3300038443 Bacteria 2414
320 Ga0395901_0246844 3300038443 Bacteria 1861
321 Ga0436365_0112797 3300039437 Bacteria 73619
322 Ga0436365_0215406 3300039437 Bacteria 933
323 Ga0436365_0459599 3300039437 Bacteria 3382
324 Ga0436365_1223438 3300039437 Bacteria 1527
325 Ga0436365_1398144 3300039437 Bacteria 6886
326 Ga0436365_1685576 3300039437 Bacteria 49468
327 Ga0436363_0956518 3300039450 Bacteria 2224
328 Ga0436363_1402976 3300039450 Bacteria 632
329 Ga0436363_1566368 3300039450 Bacteria 1350
330 Ga0436362_0126459 3300039453 Bacteria 236400
331 Ga0436362_1248847 3300039453 Bacteria 517
332 Ga0451807_1248980 3300041486 Bacteria 982
333 Ga0439443_013038 3300042003 Bacteria 1238
334 Ga0439445_0016738 3300042004 Unclassified 1807
335 Ga0439445_0026919 3300042004 Bacteria 1475
336 Ga0495590_0183286 3300046457 Bacteria 766
337 Ga0495616_0063576 3300046513 Bacteria 1803
338 Ga0495620_0121604 3300046515 Bacteria 1028
339 Ga0495648_0077254 3300046524 Bacteria 1909
340 Ga0495642_0103349 3300046528 Bacteria 1214
341 Ga0495598_0062885 3300046537 Bacteria 1150
342 Ga0495671_0025524 3300046692 Bacteria 3071
343 Ga0495686_0576284 3300047472 Bacteria 585
344 Ga0495615_0154769 3300048090 Bacteria 685
345 Ga0496101_0307814 3300048904 Bacteria 1242
346 Ga0496102_0008466 3300048905 Bacteria 8819
347 Ga0496103_0001627 3300048906 Bacteria 14740
348 Ga0496103_0179206 3300048906 Bacteria 1362
349 Ga0496104_0431729 3300048907 Bacteria 1229
350 Ga0496107_0031674 3300048910 Bacteria 3776
351 Ga0496107_0117964 3300048910 Bacteria 1954
352 Ga0496108_0060677 3300048911 Bacteria 3182
353 Ga0496109_0017588 3300048912 Bacteria 6269
354 Ga0496109_0435460 3300048912 Bacteria 1239
355 Ga0496110_0119658 3300048913 Bacteria 2372
356 Ga0496111_0050111 3300048914 Bacteria 3011
357 Ga0496112_0073396 3300048915 Bacteria 3382
358 Ga0496113_0063212 3300048916 Bacteria 2797
359 Ga0496116_0014040 3300048919 Bacteria 6416
360 Ga0496117_0030367 3300048920 Bacteria 4149
361 Ga0496118_0046557 3300048921 Bacteria 3372
362 Ga0496126_0897434 3300048929 Bacteria 672
363 Ga0501293_006857 3300049516 Bacteria 936
364 Ga0501298_078828 3300049521 Bacteria 722
365 Ga0501300_034702 3300049523 Bacteria 750
366 Ga0501032_0047340 3300049569 Bacteria 2904
367 Ga0501034_0033122 3300049571 Bacteria 5245
368 Ga0501034_0103951 3300049571 Bacteria 2834
369 Ga0501034_1212531 3300049571 Bacteria 633
370 Ga0501034_1235786 3300049571 Bacteria 625
371 Ga0501039_1487247 3300049575 Bacteria 521
372 Ga0501042_0746001 3300049578 Bacteria 712
373 Ga0501043_0006052 3300049579 Bacteria 9724
374 Ga0501046_0408947 3300049580 Bacteria 979
375 Ga0501047_0006687 3300049581 Bacteria 10839
376 Ga0501047_1177184 3300049581 Bacteria 580
377 Ga0501048_0603065 3300049582 Bacteria 788
378 Ga0501069_0002869 3300049585 Bacteria 8843
379 Ga0501069_1017743 3300049585 Bacteria 506
380 Ga0501070_0019489 3300049586 Bacteria 5689
381 Ga0501223_008362 3300049663 Bacteria 2110
382 Ga0501247_086330 3300049677 Bacteria 512
383 Ga0501257_000127 3300049686 Bacteria 17543
384 Ga0501035_0041633 3300049822 Bacteria 4148
385 nmdc:mga03683_454958_c1 3300050489 Bacteria 616
386 nmdc:mga0k408_15002_c1 3300050493 Bacteria 4280
387 nmdc:mga0qj67_1039531_c1 3300050509 Bacteria 641
388 nmdc:mga0qj67_125612_c1 3300050509 Bacteria 2076
389 nmdc:mga0n895_182183_c1 3300050512 Bacteria 2132
390 Ga0500592_000280 3300053116 Bacteria 9035
391 Ga0500594_0121822 3300053118 Bacteria 819
392 Ga0500573_0100786 3300053140 Bacteria 1625
393 Ga0500604_0000017 3300053151 Bacteria 82010
394 Ga0500604_0149904 3300053151 Unclassified 791
395 Ga0500616_0000711 3300053153 Bacteria 38558
396 Ga0500616_0135005 3300053153 Bacteria 1161
397 Ga0500627_0000199 3300053158 Bacteria 17319
398 Ga0500645_020502 3300053730 Bacteria 2049
399 Ga0500587_001094 3300053739 Bacteria 3712

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0033122 Ga0501034_0033122_4021_4422 114
2 3300049585 Ga0501069_0002869 Ga0501069_0002869_3854_4255 114
3 3300049586 Ga0501070_0019489 Ga0501070_0019489_2907_3308 114
4 3300005328 Ga0070676_11124364 Ga0070676_111243642 116
5 3300049585 Ga0501069_1017743 Ga0501069_1017743_125_496 123
6 3300049516 Ga0501293_006857 Ga0501293_006857_133_534 128
7 3300049521 Ga0501298_078828 Ga0501298_078828_20_421 128
8 3300049523 Ga0501300_034702 Ga0501300_034702_222_623 128
9 3300049677 Ga0501247_086330 Ga0501247_086330_51_452 128
10 3300049686 Ga0501257_000127 Ga0501257_000127_13350_13751 128
11 3300002239 JGI24034J26672_10026220 JGI24034J26672_100262202 129
12 3300005331 Ga0070670_100109359 Ga0070670_1001093593 129
13 3300005347 Ga0070668_100000048 Ga0070668_10000004838 129
14 3300005347 Ga0070668_101054416 Ga0070668_1010544162 129
15 3300005355 Ga0070671_100014222 Ga0070671_1000142222 129
16 3300005548 Ga0070665_100021852 Ga0070665_1000218524 129
17 3300005577 Ga0068857_101184824 Ga0068857_1011848242 129
18 3300005617 Ga0068859_100010149 Ga0068859_1000101496 129
19 3300005617 Ga0068859_100045749 Ga0068859_1000457493 129
20 3300005841 Ga0068863_100000017 Ga0068863_100000017123 129
21 3300005844 Ga0068862_100040729 Ga0068862_1000407295 129
22 3300006931 Ga0097620_100010149 Ga0097620_1000101496 129
23 3300006931 Ga0097620_100045749 Ga0097620_1000457493 129
24 3300009553 Ga0105249_10048389 Ga0105249_100483895 129
25 3300025925 Ga0207650_10183759 Ga0207650_101837592 129
26 3300025931 Ga0207644_10000010 Ga0207644_10000010209 129
27 3300025961 Ga0207712_10087120 Ga0207712_100871203 129
28 3300025972 Ga0207668_10000075 Ga0207668_1000007549 129
29 3300025972 Ga0207668_11669214 Ga0207668_116692142 129
30 3300026088 Ga0207641_10000036 Ga0207641_10000036121 129
31 3300026118 Ga0207675_100383719 Ga0207675_1003837192 129
32 3300028379 Ga0268266_10035944 Ga0268266_100359446 129
33 3300028380 Ga0268265_10175032 Ga0268265_101750322 129
34 3300028381 Ga0268264_10015313 Ga0268264_100153137 129
35 3300049575 Ga0501039_1487247 Ga0501039_1487247_51_452 129
36 3300005295 Ga0065707_10140914 Ga0065707_101409142 130
37 3300005327 Ga0070658_10000040 Ga0070658_1000004036 130
38 3300005331 Ga0070670_101093550 Ga0070670_1010935501 130
39 3300005333 Ga0070677_10010721 Ga0070677_100107212 130
40 3300005333 Ga0070677_10408205 Ga0070677_104082051 130
41 3300005334 Ga0068869_100465896 Ga0068869_1004658962 130
42 3300005334 Ga0068869_101941988 Ga0068869_1019419881 130
43 3300005336 Ga0070680_100000397 Ga0070680_1000003972 130
44 3300005338 Ga0068868_100000107 Ga0068868_10000010726 130
45 3300005339 Ga0070660_100003071 Ga0070660_1000030716 130
46 3300005339 Ga0070660_100004905 Ga0070660_1000049058 130
47 3300005339 Ga0070660_100006630 Ga0070660_1000066302 130
48 3300005339 Ga0070660_100670590 Ga0070660_1006705902 130
49 3300005344 Ga0070661_100000011 Ga0070661_10000001148 130
50 3300005344 Ga0070661_101070774 Ga0070661_1010707742 130
51 3300005345 Ga0070692_10031768 Ga0070692_100317682 130
52 3300005347 Ga0070668_101903685 Ga0070668_1019036851 130
53 3300005355 Ga0070671_100178563 Ga0070671_1001785632 130
54 3300005365 Ga0070688_100962541 Ga0070688_1009625412 130
55 3300005366 Ga0070659_100000021 Ga0070659_10000002129 130
56 3300005366 Ga0070659_100005532 Ga0070659_1000055324 130
57 3300005366 Ga0070659_100065781 Ga0070659_1000657814 130
58 3300005366 Ga0070659_100709567 Ga0070659_1007095672 130
59 3300005438 Ga0070701_10174101 Ga0070701_101741012 130
60 3300005440 Ga0070705_101876121 Ga0070705_1018761211 130
61 3300005441 Ga0070700_100386995 Ga0070700_1003869952 130
62 3300005445 Ga0070708_100781011 Ga0070708_1007810112 130
63 3300005456 Ga0070678_100716831 Ga0070678_1007168311 130
64 3300005458 Ga0070681_10938943 Ga0070681_109389432 130
65 3300005530 Ga0070679_100000008 Ga0070679_100000008151 130
66 3300005539 Ga0068853_100032016 Ga0068853_1000320163 130
67 3300005539 Ga0068853_100259781 Ga0068853_1002597812 130
68 3300005543 Ga0070672_101536032 Ga0070672_1015360321 130
69 3300005544 Ga0070686_100000458 Ga0070686_10000045812 130
70 3300005546 Ga0070696_102029131 Ga0070696_1020291311 130
71 3300005548 Ga0070665_100000207 Ga0070665_10000020714 130
72 3300005563 Ga0068855_100378817 Ga0068855_1003788172 130
73 3300005564 Ga0070664_101801247 Ga0070664_1018012472 130
74 3300005614 Ga0068856_101591249 Ga0068856_1015912492 130
75 3300005844 Ga0068862_100320655 Ga0068862_1003206552 130
76 3300005985 Ga0081539_10054088 Ga0081539_100540883 130
77 3300006177 Ga0075362_10509205 Ga0075362_105092051 130
78 3300006195 Ga0075366_10148116 Ga0075366_101481162 130
79 3300006358 Ga0068871_100534355 Ga0068871_1005343552 130
80 3300006846 Ga0075430_100250729 Ga0075430_1002507292 130
81 3300006871 Ga0075434_100300200 Ga0075434_1003002002 130
82 3300009093 Ga0105240_10281120 Ga0105240_102811202 130
83 3300009094 Ga0111539_11935170 Ga0111539_119351702 130
84 3300009098 Ga0105245_10011830 Ga0105245_100118307 130
85 3300009098 Ga0105245_10119368 Ga0105245_101193681 130
86 3300009098 Ga0105245_11422023 Ga0105245_114220232 130
87 3300009148 Ga0105243_12111424 Ga0105243_121114241 130
88 3300009176 Ga0105242_12136774 Ga0105242_121367741 130
89 3300009177 Ga0105248_10847329 Ga0105248_108473291 130
90 3300009551 Ga0105238_10105922 Ga0105238_101059223 130
91 3300009551 Ga0105238_10766300 Ga0105238_107663002 130
92 3300010375 Ga0105239_11569159 Ga0105239_115691592 130
93 3300011119 Ga0105246_10411063 Ga0105246_104110632 130
94 3300012513 Ga0157326_1000156 Ga0157326_10001566 130
95 3300013105 Ga0157369_10175383 Ga0157369_101753834 130
96 3300013105 Ga0157369_10189121 Ga0157369_101891213 130
97 3300013105 Ga0157369_11457228 Ga0157369_114572281 130
98 3300013307 Ga0157372_10826454 Ga0157372_108264542 130
99 3300013307 Ga0157372_11137696 Ga0157372_111376962 130
100 3300013307 Ga0157372_11396930 Ga0157372_113969302 130
101 3300013308 Ga0157375_10181247 Ga0157375_101812473 130
102 3300014325 Ga0163163_10523040 Ga0163163_105230402 130
103 3300014326 Ga0157380_10032461 Ga0157380_100324614 130
104 3300014969 Ga0157376_10616844 Ga0157376_106168442 130
105 3300020070 Ga0206356_10993937 Ga0206356_109939372 130
106 3300020081 Ga0206354_11109695 Ga0206354_111096955 130
107 3300020082 Ga0206353_11073733 Ga0206353_110737337 130
108 3300021358 Ga0213873_10000012 Ga0213873_1000001245 130
109 3300021384 Ga0213876_10000021 Ga0213876_10000021164 130
110 3300021384 Ga0213876_10000261 Ga0213876_1000026114 130
111 3300021384 Ga0213876_10024769 Ga0213876_100247691 130
112 3300021384 Ga0213876_10033240 Ga0213876_100332405 130
113 3300025893 Ga0207682_10013706 Ga0207682_100137062 130
114 3300025893 Ga0207682_10148956 Ga0207682_101489562 130
115 3300025899 Ga0207642_11037042 Ga0207642_110370421 130
116 3300025909 Ga0207705_10000002 Ga0207705_10000002174 130
117 3300025913 Ga0207695_10312278 Ga0207695_103122782 130
118 3300025917 Ga0207660_10000259 Ga0207660_1000025923 130
119 3300025919 Ga0207657_10001293 Ga0207657_1000129328 130
120 3300025919 Ga0207657_10004920 Ga0207657_100049208 130
121 3300025919 Ga0207657_10029482 Ga0207657_100294826 130
122 3300025919 Ga0207657_10565778 Ga0207657_105657782 130
123 3300025920 Ga0207649_10000221 Ga0207649_1000022147 130
124 3300025920 Ga0207649_10320002 Ga0207649_103200022 130
125 3300025921 Ga0207652_10000008 Ga0207652_10000008145 130
126 3300025923 Ga0207681_10169117 Ga0207681_101691172 130
127 3300025924 Ga0207694_10223534 Ga0207694_102235342 130
128 3300025926 Ga0207659_10109474 Ga0207659_101094744 130
129 3300025927 Ga0207687_10009112 Ga0207687_100091126 130
130 3300025931 Ga0207644_10171303 Ga0207644_101713032 130
131 3300025932 Ga0207690_10000030 Ga0207690_1000003032 130
132 3300025932 Ga0207690_10003661 Ga0207690_100036614 130
133 3300025932 Ga0207690_10044707 Ga0207690_100447072 130
134 3300025932 Ga0207690_10172301 Ga0207690_101723012 130
135 3300025933 Ga0207706_10849266 Ga0207706_108492662 130
136 3300025942 Ga0207689_10227496 Ga0207689_102274962 130
137 3300025981 Ga0207640_10367790 Ga0207640_103677902 130
138 3300026023 Ga0207677_10000027 Ga0207677_1000002732 130
139 3300026023 Ga0207677_10716766 Ga0207677_107167662 130
140 3300026078 Ga0207702_11111894 Ga0207702_111118942 130
141 3300026121 Ga0207683_10783474 Ga0207683_107834741 130
142 3300028379 Ga0268266_10000171 Ga0268266_1000017131 130
143 3300028380 Ga0268265_11503446 Ga0268265_115034462 130
144 3300031548 Ga0307408_100041810 Ga0307408_1000418104 130
145 3300031548 Ga0307408_100544442 Ga0307408_1005444422 130
146 3300031548 Ga0307408_100903494 Ga0307408_1009034942 130
147 3300031548 Ga0307408_100966609 Ga0307408_1009666092 130
148 3300031731 Ga0307405_10001326 Ga0307405_100013264 130
149 3300031824 Ga0307413_10087631 Ga0307413_100876312 130
150 3300031824 Ga0307413_10090807 Ga0307413_100908072 130
151 3300031824 Ga0307413_10139012 Ga0307413_101390122 130
152 3300031824 Ga0307413_10693680 Ga0307413_106936802 130
153 3300031852 Ga0307410_10663083 Ga0307410_106630832 130
154 3300031852 Ga0307410_10864771 Ga0307410_108647711 130
155 3300031852 Ga0307410_11375745 Ga0307410_113757452 130
156 3300031901 Ga0307406_10003999 Ga0307406_100039994 130
157 3300031901 Ga0307406_10344903 Ga0307406_103449032 130
158 3300031901 Ga0307406_10351818 Ga0307406_103518181 130
159 3300031903 Ga0307407_10309422 Ga0307407_103094222 130
160 3300031911 Ga0307412_10225390 Ga0307412_102253902 130
161 3300031911 Ga0307412_10539765 Ga0307412_105397652 130
162 3300032002 Ga0307416_100008107 Ga0307416_1000081078 130
163 3300032002 Ga0307416_100099748 Ga0307416_1000997483 130
164 3300032002 Ga0307416_100685514 Ga0307416_1006855141 130
165 3300032002 Ga0307416_101405501 Ga0307416_1014055012 130
166 3300032004 Ga0307414_10158449 Ga0307414_101584492 130
167 3300032004 Ga0307414_10457355 Ga0307414_104573552 130
168 3300032004 Ga0307414_10729991 Ga0307414_107299912 130
169 3300032005 Ga0307411_10104319 Ga0307411_101043193 130
170 3300032005 Ga0307411_10401793 Ga0307411_104017932 130
171 3300032005 Ga0307411_10721785 Ga0307411_107217852 130
172 3300032126 Ga0307415_100503624 Ga0307415_1005036242 130
173 3300039437 Ga0436365_0112797 Ga0436365_0112797_29771_30172 130
174 3300039437 Ga0436365_0215406 Ga0436365_0215406_467_868 130
175 3300039437 Ga0436365_0459599 Ga0436365_0459599_1068_1472 130
176 3300039437 Ga0436365_1223438 Ga0436365_1223438_294_698 130
177 3300039437 Ga0436365_1398144 Ga0436365_1398144_3466_3867 130
178 3300039437 Ga0436365_1685576 Ga0436365_1685576_14724_15125 130
179 3300039450 Ga0436363_0956518 Ga0436363_0956518_1768_2172 130
180 3300039450 Ga0436363_1402976 Ga0436363_1402976_24_425 130
181 3300039450 Ga0436363_1566368 Ga0436363_1566368_389_790 130
182 3300039453 Ga0436362_0126459 Ga0436362_0126459_163701_164102 130
183 3300039453 Ga0436362_1248847 Ga0436362_1248847_72_476 130
184 3300041486 Ga0451807_1248980 Ga0451807_1248980_324_728 130
185 3300042003 Ga0439443_013038 Ga0439443_013038_783_1184 130
186 3300042004 Ga0439445_0016738 Ga0439445_0016738_827_1231 130
187 3300042004 Ga0439445_0026919 Ga0439445_0026919_489_893 130
188 3300046457 Ga0495590_0183286 Ga0495590_0183286_352_756 130
189 3300046515 Ga0495620_0121604 Ga0495620_0121604_166_570 130
190 3300046528 Ga0495642_0103349 Ga0495642_0103349_15_419 130
191 3300048090 Ga0495615_0154769 Ga0495615_0154769_26_430 130
192 3300049569 Ga0501032_0047340 Ga0501032_0047340_1536_1934 130
193 3300049571 Ga0501034_0103951 Ga0501034_0103951_2299_2703 130
194 3300049571 Ga0501034_1235786 Ga0501034_1235786_157_555 130
195 3300049578 Ga0501042_0746001 Ga0501042_0746001_11_409 130
196 3300049579 Ga0501043_0006052 Ga0501043_0006052_775_1173 130
197 3300049580 Ga0501046_0408947 Ga0501046_0408947_236_634 130
198 3300049581 Ga0501047_0006687 Ga0501047_0006687_8219_8617 130
199 3300049581 Ga0501047_1177184 Ga0501047_1177184_33_437 130
200 3300049582 Ga0501048_0603065 Ga0501048_0603065_74_472 130
201 3300049822 Ga0501035_0041633 Ga0501035_0041633_993_1391 130
202 3300050489 nmdc:mga03683_454958_c1 nmdc:mga03683_454958_c1_16_420 130
203 3300050493 nmdc:mga0k408_15002_c1 nmdc:mga0k408_15002_c1_2385_2783 130
204 3300050509 nmdc:mga0qj67_1039531_c1 nmdc:mga0qj67_1039531_c1_72_476 130
205 3300050509 nmdc:mga0qj67_125612_c1 nmdc:mga0qj67_125612_c1_281_685 130
206 3300050512 nmdc:mga0n895_182183_c1 nmdc:mga0n895_182183_c1_988_1392 130
207 3300053116 Ga0500592_000280 Ga0500592_000280_6011_6409 130
208 3300053140 Ga0500573_0100786 Ga0500573_0100786_1123_1524 130
209 3300053151 Ga0500604_0149904 Ga0500604_0149904_257_655 130
210 3300053153 Ga0500616_0135005 Ga0500616_0135005_157_561 130
211 3300053158 Ga0500627_0000199 Ga0500627_0000199_4055_4453 130
212 3300053730 Ga0500645_020502 Ga0500645_020502_1583_1981 130
213 3300005295 Ga0065707_10222871 Ga0065707_102228712 131
214 3300005327 Ga0070658_11055547 Ga0070658_110555472 131
215 3300005347 Ga0070668_100048878 Ga0070668_1000488782 131
216 3300005456 Ga0070678_100715990 Ga0070678_1007159902 131
217 3300005530 Ga0070679_100559786 Ga0070679_1005597862 131
218 3300005548 Ga0070665_100000773 Ga0070665_10000077332 131
219 3300005617 Ga0068859_100235061 Ga0068859_1002350612 131
220 3300005841 Ga0068863_100024498 Ga0068863_1000244985 131
221 3300005843 Ga0068860_100001110 Ga0068860_10000111025 131
222 3300005844 Ga0068862_100000125 Ga0068862_10000012577 131
223 3300005844 Ga0068862_101611065 Ga0068862_1016110652 131
224 3300006931 Ga0097620_100235066 Ga0097620_1002350662 131
225 3300009101 Ga0105247_10006116 Ga0105247_100061168 131
226 3300009553 Ga0105249_10000015 Ga0105249_10000015192 131
227 3300013102 Ga0157371_10080730 Ga0157371_100807303 131
228 3300013307 Ga0157372_12229308 Ga0157372_122293081 131
229 3300014326 Ga0157380_10241211 Ga0157380_102412112 131
230 3300021388 Ga0213875_10309503 Ga0213875_103095031 131
231 3300025900 Ga0207710_10006260 Ga0207710_100062603 131
232 3300025909 Ga0207705_10742274 Ga0207705_107422742 131
233 3300025921 Ga0207652_11084947 Ga0207652_110849472 131
234 3300025961 Ga0207712_10000023 Ga0207712_1000002393 131
235 3300025972 Ga0207668_10016105 Ga0207668_100161052 131
236 3300025981 Ga0207640_11008149 Ga0207640_110081492 131
237 3300026088 Ga0207641_10017706 Ga0207641_100177065 131
238 3300026121 Ga0207683_10048245 Ga0207683_100482452 131
239 3300028379 Ga0268266_10000432 Ga0268266_1000043222 131
240 3300028380 Ga0268265_10000049 Ga0268265_10000049172 131
241 3300028380 Ga0268265_10200475 Ga0268265_102004752 131
242 3300028381 Ga0268264_10000682 Ga0268264_1000068214 131
243 3300031548 Ga0307408_100053893 Ga0307408_1000538933 131
244 3300033180 Ga0307510_10463589 Ga0307510_104635892 131
245 3300037471 Ga0395905_0035873 Ga0395905_0035873_528_929 131
246 3300037853 Ga0436364_0080613 Ga0436364_0080613_134_538 131
247 3300038443 Ga0395901_0154053 Ga0395901_0154053_130_531 131
248 3300038443 Ga0395901_0246844 Ga0395901_0246844_550_978 131
249 3300046513 Ga0495616_0063576 Ga0495616_0063576_460_867 131
250 3300046524 Ga0495648_0077254 Ga0495648_0077254_1265_1666 131
251 3300046692 Ga0495671_0025524 Ga0495671_0025524_255_656 131
252 3300047472 Ga0495686_0576284 Ga0495686_0576284_109_510 131
253 3300048912 Ga0496109_0435460 Ga0496109_0435460_469_870 131
254 3300048929 Ga0496126_0897434 Ga0496126_0897434_177_584 131
255 3300049571 Ga0501034_1212531 Ga0501034_1212531_138_539 131
256 3300053118 Ga0500594_0121822 Ga0500594_0121822_369_770 131
257 3300053151 Ga0500604_0000017 Ga0500604_0000017_66684_67091 131
258 3300053153 Ga0500616_0000711 Ga0500616_0000711_24469_24891 131
259 3300053739 Ga0500587_001094 Ga0500587_001094_2412_2819 131
260 3300001904 JGI24736J21556_1000004 JGI24736J21556_100000436 132
261 3300001976 JGI24752J21851_1000287 JGI24752J21851_10002872 132
262 3300001979 JGI24740J21852_10001685 JGI24740J21852_100016853 132
263 3300001989 JGI24739J22299_10019745 JGI24739J22299_100197453 132
264 3300001989 JGI24739J22299_10054543 JGI24739J22299_100545432 132
265 3300001990 JGI24737J22298_10020333 JGI24737J22298_100203333 132
266 3300002067 JGI24735J21928_10014365 JGI24735J21928_100143655 132
267 3300002070 JGI24750J21931_1004592 JGI24750J21931_10045922 132
268 3300002074 JGI24748J21848_1000032 JGI24748J21848_100003211 132
269 3300002075 JGI24738J21930_10002312 JGI24738J21930_100023127 132
270 3300002075 JGI24738J21930_10025179 JGI24738J21930_100251792 132
271 3300002076 JGI24749J21850_1002070 JGI24749J21850_10020703 132
272 3300002239 JGI24034J26672_10000022 JGI24034J26672_1000002252 132
273 3300002244 JGI24742J22300_10006270 JGI24742J22300_100062702 132
274 3300002459 JGI24751J29686_10016038 JGI24751J29686_100160382 132
275 3300005327 Ga0070658_10049461 Ga0070658_100494613 132
276 3300005330 Ga0070690_100000038 Ga0070690_10000003811 132
277 3300005331 Ga0070670_100049065 Ga0070670_1000490656 132
278 3300005335 Ga0070666_10000002 Ga0070666_1000000267 132
279 3300005339 Ga0070660_100072098 Ga0070660_1000720982 132
280 3300005339 Ga0070660_100756353 Ga0070660_1007563531 132
281 3300005340 Ga0070689_100016528 Ga0070689_1000165286 132
282 3300005344 Ga0070661_100313312 Ga0070661_1003133121 132
283 3300005347 Ga0070668_100024562 Ga0070668_1000245624 132
284 3300005353 Ga0070669_100000237 Ga0070669_10000023744 132
285 3300005355 Ga0070671_100035172 Ga0070671_1000351724 132
286 3300005364 Ga0070673_100756587 Ga0070673_1007565872 132
287 3300005365 Ga0070688_100002371 Ga0070688_1000023718 132
288 3300005367 Ga0070667_100112266 Ga0070667_1001122662 132
289 3300005367 Ga0070667_100330442 Ga0070667_1003304422 132
290 3300005455 Ga0070663_100626182 Ga0070663_1006261821 132
291 3300005457 Ga0070662_100107762 Ga0070662_1001077623 132
292 3300005457 Ga0070662_100958403 Ga0070662_1009584032 132
293 3300005457 Ga0070662_101107149 Ga0070662_1011071492 132
294 3300005466 Ga0070685_10000425 Ga0070685_1000042513 132
295 3300005539 Ga0068853_101695928 Ga0068853_1016959281 132
296 3300005544 Ga0070686_100000003 Ga0070686_100000003300 132
297 3300005548 Ga0070665_100000036 Ga0070665_100000036271 132
298 3300005563 Ga0068855_101362188 Ga0068855_1013621882 132
299 3300005564 Ga0070664_100155518 Ga0070664_1001555182 132
300 3300005577 Ga0068857_100215778 Ga0068857_1002157783 132
301 3300005577 Ga0068857_102505190 Ga0068857_1025051901 132
302 3300005578 Ga0068854_101020212 Ga0068854_1010202122 132
303 3300005614 Ga0068856_102568833 Ga0068856_1025688331 132
304 3300005616 Ga0068852_102257239 Ga0068852_1022572392 132
305 3300005617 Ga0068859_100002979 Ga0068859_1000029799 132
306 3300005618 Ga0068864_100001120 Ga0068864_10000112011 132
307 3300005618 Ga0068864_100005456 Ga0068864_1000054565 132
308 3300005719 Ga0068861_100065549 Ga0068861_1000655493 132
309 3300005834 Ga0068851_10012671 Ga0068851_100126714 132
310 3300005834 Ga0068851_10394461 Ga0068851_103944611 132
311 3300005841 Ga0068863_100000095 Ga0068863_10000009531 132
312 3300005841 Ga0068863_100072501 Ga0068863_1000725013 132
313 3300005842 Ga0068858_100000953 Ga0068858_10000095326 132
314 3300005843 Ga0068860_100000001 Ga0068860_10000000167 132
315 3300005844 Ga0068862_100000752 Ga0068862_1000007528 132
316 3300006931 Ga0097620_100002979 Ga0097620_1000029799 132
317 3300009011 Ga0105251_10488246 Ga0105251_104882461 132
318 3300009093 Ga0105240_10894284 Ga0105240_108942842 132
319 3300009101 Ga0105247_10037619 Ga0105247_100376193 132
320 3300009174 Ga0105241_10862999 Ga0105241_108629991 132
321 3300009177 Ga0105248_10001494 Ga0105248_1000149428 132
322 3300009177 Ga0105248_10036961 Ga0105248_100369615 132
323 3300009551 Ga0105238_11864241 Ga0105238_118642411 132
324 3300009553 Ga0105249_10000026 Ga0105249_1000002666 132
325 3300010375 Ga0105239_12861468 Ga0105239_128614682 132
326 3300013100 Ga0157373_10045257 Ga0157373_100452574 132
327 3300013104 Ga0157370_10024543 Ga0157370_100245436 132
328 3300013105 Ga0157369_10067922 Ga0157369_100679226 132
329 3300013306 Ga0163162_10022495 Ga0163162_100224954 132
330 3300013306 Ga0163162_10372282 Ga0163162_103722822 132
331 3300013307 Ga0157372_10047131 Ga0157372_100471314 132
332 3300014325 Ga0163163_10024725 Ga0163163_100247256 132
333 3300014326 Ga0157380_10002341 Ga0157380_100023418 132
334 3300014968 Ga0157379_10057490 Ga0157379_100574902 132
335 3300017792 Ga0163161_10000008 Ga0163161_10000008241 132
336 3300025223 Ga0207672_1000709 Ga0207672_10007094 132
337 3300025903 Ga0207680_10000004 Ga0207680_10000004793 132
338 3300025904 Ga0207647_10000952 Ga0207647_100009522 132
339 3300025909 Ga0207705_10144493 Ga0207705_101444932 132
340 3300025911 Ga0207654_10000698 Ga0207654_100006988 132
341 3300025911 Ga0207654_10902662 Ga0207654_109026622 132
342 3300025913 Ga0207695_10003217 Ga0207695_100032173 132
343 3300025914 Ga0207671_10002254 Ga0207671_1000225423 132
344 3300025919 Ga0207657_10021190 Ga0207657_100211908 132
345 3300025919 Ga0207657_10833696 Ga0207657_108336961 132
346 3300025920 Ga0207649_10304336 Ga0207649_103043361 132
347 3300025920 Ga0207649_11116432 Ga0207649_111164321 132
348 3300025923 Ga0207681_10001005 Ga0207681_1000100517 132
349 3300025924 Ga0207694_10001423 Ga0207694_100014239 132
350 3300025924 Ga0207694_11237711 Ga0207694_112377111 132
351 3300025925 Ga0207650_10057164 Ga0207650_100571642 132
352 3300025925 Ga0207650_10355935 Ga0207650_103559351 132
353 3300025931 Ga0207644_10000522 Ga0207644_1000052226 132
354 3300025931 Ga0207644_10018659 Ga0207644_100186593 132
355 3300025933 Ga0207706_10035095 Ga0207706_100350951 132
356 3300025936 Ga0207670_10007078 Ga0207670_100070783 132
357 3300025941 Ga0207711_10009501 Ga0207711_100095013 132
358 3300025941 Ga0207711_10035890 Ga0207711_100358903 132
359 3300025945 Ga0207679_10560304 Ga0207679_105603041 132
360 3300025949 Ga0207667_10003138 Ga0207667_1000313819 132
361 3300025960 Ga0207651_10364733 Ga0207651_103647332 132
362 3300025961 Ga0207712_10000001 Ga0207712_10000001667 132
363 3300025972 Ga0207668_10026633 Ga0207668_100266333 132
364 3300025981 Ga0207640_10014896 Ga0207640_100148962 132
365 3300025981 Ga0207640_10098126 Ga0207640_100981263 132
366 3300025986 Ga0207658_10000832 Ga0207658_1000083218 132
367 3300026035 Ga0207703_10005736 Ga0207703_100057369 132
368 3300026067 Ga0207678_10004471 Ga0207678_100044713 132
369 3300026078 Ga0207702_10001800 Ga0207702_100018003 132
370 3300026088 Ga0207641_10000148 Ga0207641_1000014832 132
371 3300026095 Ga0207676_10000479 Ga0207676_100004798 132
372 3300026095 Ga0207676_10027605 Ga0207676_100276056 132
373 3300026116 Ga0207674_10010906 Ga0207674_100109065 132
374 3300026118 Ga0207675_100006136 Ga0207675_1000061369 132
375 3300028379 Ga0268266_10000042 Ga0268266_1000004268 132
376 3300028380 Ga0268265_10001122 Ga0268265_100011229 132
377 3300028381 Ga0268264_10000006 Ga0268264_10000006793 132
378 3300032002 Ga0307416_100332421 Ga0307416_1003324212 132
379 3300032004 Ga0307414_11532352 Ga0307414_115323521 132
380 3300032005 Ga0307411_11286129 Ga0307411_112861292 132
381 3300032126 Ga0307415_101393336 Ga0307415_1013933362 132
382 3300046537 Ga0495598_0062885 Ga0495598_0062885_216_626 132
383 3300048904 Ga0496101_0307814 Ga0496101_0307814_152_577 132
384 3300048905 Ga0496102_0008466 Ga0496102_0008466_2476_2874 132
385 3300048906 Ga0496103_0001627 Ga0496103_0001627_4069_4467 132
386 3300048906 Ga0496103_0179206 Ga0496103_0179206_457_882 132
387 3300048907 Ga0496104_0431729 Ga0496104_0431729_227_625 132
388 3300048910 Ga0496107_0031674 Ga0496107_0031674_2349_2747 132
389 3300048910 Ga0496107_0117964 Ga0496107_0117964_538_963 132
390 3300048911 Ga0496108_0060677 Ga0496108_0060677_1425_1850 132
391 3300048912 Ga0496109_0017588 Ga0496109_0017588_2263_2688 132
392 3300048913 Ga0496110_0119658 Ga0496110_0119658_56_481 132
393 3300048914 Ga0496111_0050111 Ga0496111_0050111_153_578 132
394 3300048915 Ga0496112_0073396 Ga0496112_0073396_2155_2580 132
395 3300048916 Ga0496113_0063212 Ga0496113_0063212_1561_1986 132
396 3300048919 Ga0496116_0014040 Ga0496116_0014040_2447_2845 132
397 3300048920 Ga0496117_0030367 Ga0496117_0030367_3219_3617 132
398 3300048921 Ga0496118_0046557 Ga0496118_0046557_2631_3029 132
399 3300049663 Ga0501223_008362 Ga0501223_008362_1447_1863 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02152

FolB

Dihydroneopterin aldolase

22

95

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v9o-assembly1.cif.gz_A crystal structure of dihydroneopterin aldolase (bth_i0291) from burkholderia thailendensis bound to guanine. 0.898 17 131
1nbu-assembly1.cif.gz_G 7,8-dihydroneopterin aldolase complexed with product from mycobacterium tuberculosis 0.892 19 131
1nbu-assembly1.cif.gz_D 7,8-dihydroneopterin aldolase complexed with product from mycobacterium tuberculosis 0.8888 19 131
7su6-assembly1.cif.gz_C dihydroneopterin aldolase (dhna) lys98ala from yersinia pestis co-crystallized with 7,8-dihydroneopterin 0.8844 19 131
1nbu-assembly1.cif.gz_C 7,8-dihydroneopterin aldolase complexed with product from mycobacterium tuberculosis 0.8843 19 131
ID Description Score Start End Superfamily
3v9oA00 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8981 17 131 3.30.1130.10
af_Q54YD9_1_116_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8961 19 131 3.30.1130.10
4aeyA00 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8836 19 132 3.30.1130.10
1b9lH00 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8792 15 131 3.30.1130.10
2o9mC00 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8751 19 131 3.30.1130.10
ID Description Score Start End GO Terms
AF-A0A520NG01-F1-model_v4 dihydroneopterin aldolase (EC 4.1.2.25) (7,8-dihydroneopterin aldolase) 0.9549 18 132 GO:0004150
GO:0005737
GO:0046656
AF-A0A520NC72-F1-model_v4 dihydroneopterin aldolase (EC 4.1.2.25) (7,8-dihydroneopterin aldolase) 0.9545 18 132 GO:0004150
GO:0005737
GO:0046656
AF-A0A7G5IL40-F1-model_v4 Dihydroneopterin aldolase 0.9427 15 132 GO:0004150
GO:0006760
AF-A0A2D9MVA2-F1-model_v4 Dihydroneopterin aldolase 0.9382 18 131 GO:0004150
GO:0006760
AF-A0A520W8D1-F1-model_v4 dihydroneopterin aldolase (EC 4.1.2.25) (7,8-dihydroneopterin aldolase) 0.937 18 132 GO:0004150
GO:0005737
GO:0046656

Feature Viewer

pLDDT pTM Quality
87.88 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map