metagRoot

F434374

General Info

Members	Datasets	Scaffolds	Average Seq Length
399	252	392	175

Family's Representative Sequence

Representative Sequence	3300046499\|Ga0495594_0450215\|Ga0495594_0450215_60_647
Length	195
Sequence	LIAYTMFVLAVGAERLVELAVSKRNLAWAFAHGGKEYGRGHYPAMVLLHFSLLVGCVVEVWVLDRPFLPVLGWTMVAVVLATQALRWWCIGTLGRRWNTLIVVVPGMPLVNRGPYRWLRHPNYVAVVLEGIALPMVHTAWITAVTFTVLNAVLLRVRIRAEEDALAQATAAPVTEEGARSRTAADSENESALPRP

Samples

	Sample ID	Description	Type	Environment
1	2758568621	Promicromonospora sukumoe SAI-064	Isolate	Unclassified
2	2808606365	Phycicoccus sp. SLBN-51	Isolate	Unclassified
3	2811994880	Cellulomonas sp. SLBN-39	Isolate	Unclassified
4	2818991472	Kitasatospora viridis DSM 44826	Isolate	Rhizosphere
5	2928153084	Leifsonia sp. 563	Isolate	Unclassified
6	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
7	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
8	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
9	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
10	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
11	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
12	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
13	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
14	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
15	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
16	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
17	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
18	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
19	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
20	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
21	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
22	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
23	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
24	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
25	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
26	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
27	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
28	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
29	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
30	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
31	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
32	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
33	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
34	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
35	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
36	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
37	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
38	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
39	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
40	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
41	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
42	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
43	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
44	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
45	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
46	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
47	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
48	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
49	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
50	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
51	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
52	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
53	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
54	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
55	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
56	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
57	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
58	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
59	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
60	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
61	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
62	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
63	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
64	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
65	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
66	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
67	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
68	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
69	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
70	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
71	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
72	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
73	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
74	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
75	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
76	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
77	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
78	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
79	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
80	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
81	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
82	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
83	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
84	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
85	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
86	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
87	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
88	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
89	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
90	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
91	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
92	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
93	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
94	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
95	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
96	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
97	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
98	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
99	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
135	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
138	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
139	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
140	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
141	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
142	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
143	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
144	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
145	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
146	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
147	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
148	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
149	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
150	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
151	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
152	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
153	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
154	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
155	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
156	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
157	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
158	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
159	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
160	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
161	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
162	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
163	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
164	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
165	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
166	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
167	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
168	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
169	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
170	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
171	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
172	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
173	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
174	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
175	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
176	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
177	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
178	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
179	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
180	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
181	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
182	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
183	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
184	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
185	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
186	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
187	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
188	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
189	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
190	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
191	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
192	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
193	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
194	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
195	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
196	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
197	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
198	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
199	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
200	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
201	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
202	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
203	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
204	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
205	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
206	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
207	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
208	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
209	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
210	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
211	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
212	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
213	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
214	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
215	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
216	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
217	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
218	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
219	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
220	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
221	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
222	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
223	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
224	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
225	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
226	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
227	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
228	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
229	3300049683	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control	Metagenome	Rhizosphere
230	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
231	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
232	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
233	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
234	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
235	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
236	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
237	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
238	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
239	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
240	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
241	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
242	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
243	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
244	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
245	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
246	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
247	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
248	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
249	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
250	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
251	8001781756	Catellatospora tritici NEAU-YM18	Isolate	Rhizosphere
252	8054609563	Nocardioides astragali CGMCC 4.7327	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	97.49
Metatranscriptomes	0.75
Isolates	1.75

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	2.76
Nodule	0.25
Rhizoplane	14.29
Rhizosphere	77.44
Stem	0
Stem Tuber	0
Unclassified	5.26

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24735J21928_10013330	3300002067	Bacteria	2586
2	Ga0006562J51391_1023425	3300003578	Bacteria	4976
3	Ga0006562J51391_1023426	3300003578	Bacteria	4780
4	Ga0055527_1000004	3300003760	Bacteria	570634
5	Ga0055542_1000019	3300003762	Bacteria	341174
6	Ga0055529_1000008	3300003763	Bacteria	394786
7	Ga0070683_100047870	3300005329	Bacteria	3952
8	Ga0070683_100315353	3300005329	Bacteria	1488
9	Ga0070690_100497937	3300005330	Bacteria	911
10	Ga0070666_10007272	3300005335	Bacteria	6825
11	Ga0070680_100408133	3300005336	Bacteria	1158
12	Ga0068868_100006134	3300005338	Bacteria	8493
13	Ga0068868_100215346	3300005338	Bacteria	1607
14	Ga0070660_100136378	3300005339	Bacteria	1966
15	Ga0070689_100351618	3300005340	Bacteria	1236
16	Ga0070689_100370388	3300005340	Bacteria	1205
17	Ga0070661_100192229	3300005344	Bacteria	1557
18	Ga0070692_10100310	3300005345	Bacteria	1586
19	Ga0070668_100002331	3300005347	Bacteria	13963
20	Ga0070668_100018449	3300005347	Bacteria	5237
21	Ga0070669_100084962	3300005353	Bacteria	2363
22	Ga0070669_100720625	3300005353	Bacteria	843
23	Ga0070675_100381941	3300005354	Bacteria	1254
24	Ga0070675_100480631	3300005354	Bacteria	1117
25	Ga0070671_100001055	3300005355	Bacteria	20319
26	Ga0070671_100034015	3300005355	Bacteria	4218
27	Ga0070674_100009572	3300005356	Bacteria	5805
28	Ga0070674_100324026	3300005356	Bacteria	1236
29	Ga0070674_100427801	3300005356	Bacteria	1088
30	Ga0070673_100970473	3300005364	Unclassified	790
31	Ga0070688_100742789	3300005365	Bacteria	763
32	Ga0070667_100027204	3300005367	Bacteria	4758
33	Ga0070667_100946080	3300005367	Bacteria	803
34	Ga0070709_10164964	3300005434	Bacteria	1543
35	Ga0070713_100358956	3300005436	Bacteria	1353
36	Ga0070701_10066255	3300005438	Bacteria	1918
37	Ga0070663_100374908	3300005455	Bacteria	1157
38	Ga0070678_100013428	3300005456	Bacteria	5135
39	Ga0070678_100016264	3300005456	Bacteria	4753
40	Ga0070678_100490054	3300005456	Bacteria	1083
41	Ga0070678_100548264	3300005456	Bacteria	1026
42	Ga0070678_100571236	3300005456	Bacteria	1006
43	Ga0070678_100930456	3300005456	Bacteria	796
44	Ga0070662_100282843	3300005457	Bacteria	1343
45	Ga0070662_101075173	3300005457	Unclassified	690
46	Ga0068867_100155670	3300005459	Bacteria	1799
47	Ga0068867_100269064	3300005459	Unclassified	1392
48	Ga0068867_100378298	3300005459	Bacteria	1189
49	Ga0068867_100961257	3300005459	Bacteria	772
50	Ga0070684_100240711	3300005535	Bacteria	1653
51	Ga0070697_100114137	3300005536	Bacteria	2254
52	Ga0068853_100069036	3300005539	Bacteria	3073
53	Ga0070686_100010441	3300005544	Bacteria	5236
54	Ga0070686_100111132	3300005544	Bacteria	1867
55	Ga0070695_100031358	3300005545	Bacteria	3315
56	Ga0070695_100454750	3300005545	Bacteria	982
57	Ga0070696_100175102	3300005546	Bacteria	1589
58	Ga0070693_100047013	3300005547	Bacteria	2453
59	Ga0070665_100005088	3300005548	Bacteria	13638
60	Ga0070665_100017104	3300005548	Bacteria	7274
61	Ga0070665_100394933	3300005548	Bacteria	1391
62	Ga0068855_100320171	3300005563	Bacteria	1714
63	Ga0068854_100020897	3300005578	Bacteria	4436
64	Ga0068854_100811138	3300005578	Bacteria	816
65	Ga0070702_100032281	3300005615	Bacteria	2872
66	Ga0070702_100337799	3300005615	Bacteria	1056
67	Ga0068852_100237927	3300005616	Bacteria	1739
68	Ga0068852_101118866	3300005616	Bacteria	808
69	Ga0068852_101586446	3300005616	Bacteria	677
70	Ga0068859_100242236	3300005617	Bacteria	1893
71	Ga0068864_100056334	3300005618	Bacteria	3396
72	Ga0068864_101342658	3300005618	Bacteria	716
73	Ga0068861_100261445	3300005719	Bacteria	1482
74	Ga0068863_100000996	3300005841	Bacteria	28410
75	Ga0068858_100031457	3300005842	Bacteria	4929
76	Ga0068858_100064629	3300005842	Bacteria	3387
77	Ga0068858_100605627	3300005842	Bacteria	1063
78	Ga0068858_101415807	3300005842	Bacteria	685
79	Ga0068860_100000102	3300005843	Bacteria	140115
80	Ga0068860_100756882	3300005843	Unclassified	983
81	Ga0068862_100090764	3300005844	Bacteria	2660
82	Ga0081455_10000376	3300005937	Bacteria	59249
83	Ga0081540_1008068	3300005983	Bacteria	7401
84	Ga0070716_100279951	3300006173	Bacteria	1150
85	Ga0097621_100006127	3300006237	Bacteria	8516
86	Ga0097621_100021594	3300006237	Bacteria	4984
87	Ga0068871_100307549	3300006358	Unclassified	1393
88	Ga0075433_10002932	3300006852	Bacteria	13092
89	Ga0075434_100016449	3300006871	Bacteria	7110
90	Ga0068865_100021668	3300006881	Bacteria	4183
91	Ga0068865_100119680	3300006881	Bacteria	1955
92	Ga0068865_100295670	3300006881	Bacteria	1294
93	Ga0075436_100013637	3300006914	Bacteria	5568
94	Ga0075436_100188360	3300006914	Bacteria	1459
95	Ga0075436_100384281	3300006914	Bacteria	1015
96	Ga0097620_100242239	3300006931	Bacteria	1893
97	Ga0075435_100007953	3300007076	Bacteria	7587
98	Ga0105250_10128104	3300009092	Bacteria	1047
99	Ga0105240_10517408	3300009093	Bacteria	1325
100	Ga0111539_10069515	3300009094	Bacteria	4158
101	Ga0105245_10011784	3300009098	Bacteria	7606
102	Ga0105245_10130451	3300009098	Bacteria	2357
103	Ga0105245_10392884	3300009098	Bacteria	1384
104	Ga0105245_10436649	3300009098	Bacteria	1315
105	Ga0105247_10145198	3300009101	Bacteria	1559
106	Ga0114129_10097466	3300009147	Bacteria	4071
107	Ga0105243_10026061	3300009148	Bacteria	4473
108	Ga0105243_10426129	3300009148	Bacteria	1239
109	Ga0105243_10942727	3300009148	Bacteria	862
110	Ga0105242_10003291	3300009176	Bacteria	12588
111	Ga0105242_10037775	3300009176	Bacteria	3881
112	Ga0105242_10193854	3300009176	Bacteria	1801
113	Ga0105237_10620092	3300009545	Bacteria	1088
114	Ga0105238_10256840	3300009551	Bacteria	1727
115	Ga0105238_10691243	3300009551	Bacteria	1032
116	Ga0105238_11748302	3300009551	Bacteria	653
117	Ga0105249_10414832	3300009553	Bacteria	1379
118	Ga0105249_11372365	3300009553	Bacteria	779
119	Ga0105239_10502313	3300010375	Bacteria	1379
120	Ga0105239_11508693	3300010375	Bacteria	777
121	Ga0105246_10546301	3300011119	Bacteria	992
122	Ga0105246_10554149	3300011119	Bacteria	986
123	Ga0157371_10261420	3300013102	Bacteria	1248
124	Ga0157370_10194821	3300013104	Bacteria	1881
125	Ga0157370_10418306	3300013104	Bacteria	1233
126	Ga0157369_10193823	3300013105	Bacteria	2134
127	Ga0157369_10252386	3300013105	Bacteria	1841
128	Ga0157369_10439033	3300013105	Bacteria	1352
129	Ga0157369_11064751	3300013105	Bacteria	827
130	Ga0157374_10176276	3300013296	Bacteria	2087
131	Ga0163162_10611702	3300013306	Bacteria	1215
132	Ga0163162_10738204	3300013306	Bacteria	1104
133	Ga0157372_10138825	3300013307	Bacteria	2800
134	Ga0157372_10142265	3300013307	Bacteria	2765
135	Ga0157372_10367854	3300013307	Bacteria	1675
136	Ga0157372_11054820	3300013307	Bacteria	941
137	Ga0157372_11482247	3300013307	Bacteria	782
138	Ga0157375_10045106	3300013308	Bacteria	4289
139	Ga0157375_12570305	3300013308	Bacteria	608
140	Ga0163163_10048266	3300014325	Bacteria	4186
141	Ga0163163_10074061	3300014325	Bacteria	3396
142	Ga0157380_10078134	3300014326	Bacteria	2699
143	Ga0157380_11013934	3300014326	Bacteria	864
144	Ga0182008_10335971	3300014497	Bacteria	798
145	Ga0157377_10023139	3300014745	Bacteria	3290
146	Ga0157377_10208511	3300014745	Bacteria	1245
147	Ga0157376_10058963	3300014969	Bacteria	3217
148	Ga0163161_10006047	3300017792	Bacteria	8389
149	Ga0163161_10408986	3300017792	Bacteria	1089
150	Ga0206356_11466549	3300020070	Bacteria	1091
151	Ga0213876_10269324	3300021384	Bacteria	905
152	Ga0209672_100011	3300025228	Bacteria	856297
153	Ga0209147_100595	3300025229	Bacteria	19920
154	Ga0209563_100165	3300025230	Bacteria	50808
155	Ga0209258_103735	3300025242	Bacteria	3154
156	Ga0209148_1000023	3300025254	Bacteria	680511
157	Ga0209455_1000023	3300025272	Bacteria	680449
158	Ga0207692_10049379	3300025898	Bacteria	2123
159	Ga0207680_10019845	3300025903	Bacteria	3604
160	Ga0207647_10059000	3300025904	Bacteria	2349
161	Ga0207699_10261592	3300025906	Bacteria	1196
162	Ga0207671_10274126	3300025914	Bacteria	1330
163	Ga0207660_10224585	3300025917	Bacteria	1475
164	Ga0207657_10008669	3300025919	Bacteria	10296
165	Ga0207681_10624054	3300025923	Bacteria	892
166	Ga0207659_10375299	3300025926	Bacteria	1185
167	Ga0207687_10064909	3300025927	Bacteria	2591
168	Ga0207687_10537687	3300025927	Bacteria	979
169	Ga0207700_10311746	3300025928	Bacteria	1361
170	Ga0207706_10138894	3300025933	Bacteria	2137
171	Ga0207706_10326017	3300025933	Bacteria	1336
172	Ga0207686_10082553	3300025934	Unclassified	2101
173	Ga0207709_10042159	3300025935	Bacteria	2744
174	Ga0207670_10572501	3300025936	Bacteria	925
175	Ga0207669_10921101	3300025937	Bacteria	731
176	Ga0207704_10004440	3300025938	Bacteria	6414
177	Ga0207704_10559524	3300025938	Bacteria	931
178	Ga0207665_10000643	3300025939	Bacteria	23553
179	Ga0207691_10087175	3300025940	Bacteria	2800
180	Ga0207691_10414350	3300025940	Bacteria	1148
181	Ga0207711_10035256	3300025941	Bacteria	4240
182	Ga0207661_10268150	3300025944	Bacteria	1523
183	Ga0207667_10170046	3300025949	Bacteria	2240
184	Ga0207712_10044358	3300025961	Bacteria	3073
185	Ga0207712_10233256	3300025961	Bacteria	1478
186	Ga0207668_10001896	3300025972	Bacteria	12250
187	Ga0207668_10049167	3300025972	Bacteria	2897
188	Ga0207640_10027677	3300025981	Bacteria	3457
189	Ga0207640_10804813	3300025981	Bacteria	814
190	Ga0207677_10045153	3300026023	Unclassified	2941
191	Ga0207677_10201479	3300026023	Bacteria	1582
192	Ga0207703_10005332	3300026035	Bacteria	10359
193	Ga0207703_10263428	3300026035	Bacteria	1559
194	Ga0207703_10754011	3300026035	Bacteria	928
195	Ga0207639_10066684	3300026041	Bacteria	2798
196	Ga0207678_10027882	3300026067	Bacteria	4931
197	Ga0207678_10500448	3300026067	Bacteria	1059
198	Ga0207708_10025655	3300026075	Bacteria	4460
199	Ga0207708_10590804	3300026075	Bacteria	940
200	Ga0207641_10001531	3300026088	Bacteria	22653
201	Ga0207648_10108652	3300026089	Unclassified	2435
202	Ga0207648_10333243	3300026089	Bacteria	1365
203	Ga0207676_10014282	3300026095	Bacteria	5710
204	Ga0207675_100001020	3300026118	Bacteria	27757
205	Ga0207675_100306593	3300026118	Bacteria	1547
206	Ga0207675_100522359	3300026118	Bacteria	1184
207	Ga0207683_10011853	3300026121	Bacteria	7438
208	Ga0207683_10480484	3300026121	Bacteria	1147
209	Ga0207428_10311072	3300027907	Bacteria	1165
210	Ga0268266_10007800	3300028379	Bacteria	9599
211	Ga0268264_10000171	3300028381	Bacteria	141050
212	Ga0314311_1141977	3300030733	Bacteria	1969
213	Ga0307410_10196774	3300031852	Bacteria	1536
214	Ga0307410_10341126	3300031852	Bacteria	1194
215	Ga0307409_101080008	3300031995	Bacteria	823
216	Ga0307414_10512413	3300032004	Bacteria	1063
217	Ga0307411_10015742	3300032005	Bacteria	4259
218	Ga0307411_10300006	3300032005	Bacteria	1288
219	Ga0373938_0003738	3300034957	Bacteria	2507
220	Ga0373932_0002556	3300035112	Bacteria	4557
221	Ga0373939_0009161	3300035114	Bacteria	2449
222	Ga0373941_0173095	3300035115	Bacteria	806
223	Ga0373960_0005704	3300035121	Bacteria	2892
224	Ga0373961_0059125	3300035241	Bacteria	1158
225	Ga0373962_0010054	3300035242	Bacteria	2353
226	Ga0373931_0063402	3300035691	Bacteria	1997
227	Ga0373931_0789750	3300035691	Bacteria	632
228	Ga0373925_0210762	3300037068	Bacteria	1548
229	Ga0395899_0037821	3300037312	Bacteria	3617
230	Ga0395899_0071424	3300037312	Bacteria	2540
231	Ga0395900_0002511	3300037418	Bacteria	20146
232	Ga0395898_0000270	3300037466	Bacteria	127152
233	Ga0395901_1849383	3300038443	Bacteria	552
234	Ga0436365_0416644	3300039437	Bacteria	905
235	Ga0451789_0096529	3300041443	Bacteria	4481
236	Ga0451791_1810703	3300041451	Bacteria	4178
237	Ga0451793_0526721	3300041452	Bacteria	13250
238	Ga0451797_0892238	3300041453	Bacteria	2992
239	Ga0451795_0688428	3300041456	Bacteria	7966
240	Ga0451802_0901948	3300041460	Bacteria	2003
241	Ga0451833_0152494	3300041491	Bacteria	962
242	Ga0451837_1787670	3300041494	Bacteria	877
243	Ga0451841_0979208	3300041498	Bacteria	3316
244	Ga0451843_0654136	3300041509	Bacteria	8380
245	Ga0451855_1931790	3300041511	Bacteria	1384
246	Ga0451853_0412072	3300041512	Bacteria	5084
247	Ga0466961_0091331	3300044693	Bacteria	1922
248	Ga0466970_0370772	3300044765	Bacteria	814
249	Ga0466960_0197458	3300044901	Bacteria	1098
250	Ga0466959_0285132	3300045049	Bacteria	1133
251	Ga0466958_0534654	3300045836	Bacteria	761
252	Ga0466958_0596055	3300045836	Bacteria	719
253	Ga0466967_0234886	3300045976	Bacteria	1747
254	Ga0495627_054517	3300046453	Bacteria	1195
255	Ga0495638_0000745	3300046460	Bacteria	34919
256	Ga0495580_0546537	3300046472	Bacteria	769
257	Ga0495664_0086515	3300046477	Bacteria	1883
258	Ga0495594_0450215	3300046499	Bacteria	732
259	Ga0495608_0015421	3300046511	Bacteria	5299
260	Ga0495631_0153064	3300046518	Bacteria	990
261	Ga0495665_0184785	3300046531	Bacteria	1083
262	Ga0495665_0209870	3300046531	Bacteria	1008
263	Ga0495667_0322697	3300046559	Bacteria	977
264	Ga0495657_0202456	3300046675	Bacteria	1209
265	Ga0495657_0480539	3300046675	Bacteria	726
266	Ga0495658_0106068	3300046683	Bacteria	1684
267	Ga0495624_0393487	3300046690	Bacteria	832
268	Ga0495600_0275512	3300046809	Bacteria	1066
269	Ga0495600_0299506	3300046809	Bacteria	1015
270	Ga0495581_0198983	3300047315	Bacteria	1172
271	Ga0495581_0201528	3300047315	Bacteria	1164
272	Ga0495604_0394278	3300047317	Bacteria	913
273	Ga0495674_0183125	3300047319	Bacteria	1744
274	Ga0495676_0123896	3300047321	Bacteria	1876
275	Ga0495676_0139635	3300047321	Bacteria	1738
276	Ga0495680_0135286	3300047322	Bacteria	1808
277	Ga0495593_0158113	3300047673	Bacteria	1145
278	Ga0495614_0124279	3300048089	Bacteria	1139
279	Ga0496100_1162205	3300048903	Bacteria	608
280	Ga0496101_0038099	3300048904	Bacteria	3413
281	Ga0496101_0129992	3300048904	Bacteria	1912
282	Ga0496101_0433131	3300048904	Bacteria	1037
283	Ga0496101_0664656	3300048904	Bacteria	823
284	Ga0496101_0823796	3300048904	Bacteria	732
285	Ga0496102_0018838	3300048905	Bacteria	6071
286	Ga0496102_0190399	3300048905	Bacteria	1933
287	Ga0496103_0024707	3300048906	Bacteria	3626
288	Ga0496104_0003581	3300048907	Bacteria	13413
289	Ga0496104_0733169	3300048907	Bacteria	895
290	Ga0496105_0019149	3300048908	Bacteria	5518
291	Ga0496105_0072934	3300048908	Bacteria	2836
292	Ga0496106_0598391	3300048909	Bacteria	883
293	Ga0496107_0325894	3300048910	Bacteria	1143
294	Ga0496107_0474709	3300048910	Bacteria	928
295	Ga0496108_0013807	3300048911	Bacteria	6589
296	Ga0496108_0035148	3300048911	Bacteria	4165
297	Ga0496108_0048600	3300048911	Bacteria	3547
298	Ga0496108_0901098	3300048911	Bacteria	759
299	Ga0496109_0004921	3300048912	Bacteria	11150
300	Ga0496109_0011240	3300048912	Bacteria	7687
301	Ga0496109_0330938	3300048912	Bacteria	1438
302	Ga0496109_0365160	3300048912	Bacteria	1364
303	Ga0496109_0674474	3300048912	Bacteria	971
304	Ga0496109_1594466	3300048912	Bacteria	587
305	Ga0496110_0006519	3300048913	Bacteria	9258
306	Ga0496110_0009172	3300048913	Bacteria	7990
307	Ga0496110_0117049	3300048913	Bacteria	2400
308	Ga0496110_0223920	3300048913	Bacteria	1711
309	Ga0496110_0745961	3300048913	Bacteria	882
310	Ga0496111_0000488	3300048914	Bacteria	20385
311	Ga0496111_0064454	3300048914	Bacteria	2658
312	Ga0496111_0443483	3300048914	Bacteria	958
313	Ga0496112_0020019	3300048915	Bacteria	6335
314	Ga0496113_0300756	3300048916	Bacteria	1285
315	Ga0496113_0331896	3300048916	Bacteria	1219
316	Ga0496114_0016221	3300048917	Bacteria	5998
317	Ga0496114_0045371	3300048917	Unclassified	3651
318	Ga0496114_0045932	3300048917	Bacteria	3629
319	Ga0496114_0055366	3300048917	Bacteria	3308
320	Ga0496114_0099027	3300048917	Bacteria	2486
321	Ga0496114_0129336	3300048917	Bacteria	2179
322	Ga0496114_0144896	3300048917	Bacteria	2059
323	Ga0496114_0217427	3300048917	Bacteria	1677
324	Ga0496114_0236161	3300048917	Bacteria	1607
325	Ga0496114_0346120	3300048917	Bacteria	1315
326	Ga0496114_0423286	3300048917	Bacteria	1180
327	Ga0496115_0012885	3300048918	Bacteria	6305
328	Ga0496115_0114207	3300048918	Bacteria	2219
329	Ga0496115_0613143	3300048918	Bacteria	864
330	Ga0496117_0022532	3300048920	Bacteria	5049
331	Ga0496117_0186860	3300048920	Bacteria	1185
332	Ga0496118_0518655	3300048921	Bacteria	588
333	Ga0496119_0060316	3300048922	Bacteria	2272
334	Ga0496124_0044918	3300048927	Bacteria	3789
335	Ga0496124_0564018	3300048927	Bacteria	749
336	Ga0496126_0036174	3300048929	Bacteria	4619
337	Ga0501031_0062577	3300049568	Bacteria	2425
338	Ga0501031_0365523	3300049568	Bacteria	934
339	Ga0501032_0449838	3300049569	Bacteria	825
340	Ga0501036_0128685	3300049572	Bacteria	2138
341	Ga0501036_0594618	3300049572	Bacteria	918
342	Ga0501039_0053368	3300049575	Bacteria	3128
343	Ga0501039_0363099	3300049575	Bacteria	1138
344	Ga0501040_0065878	3300049576	Bacteria	2496
345	Ga0501040_0342373	3300049576	Bacteria	1071
346	Ga0501040_0368446	3300049576	Bacteria	1030
347	Ga0501041_0156836	3300049577	Bacteria	1422
348	Ga0501041_0272423	3300049577	Bacteria	1065
349	Ga0501042_0155530	3300049578	Bacteria	1649
350	Ga0501046_0138051	3300049580	Bacteria	1846
351	Ga0501048_0038635	3300049582	Bacteria	3425
352	Ga0501048_0205447	3300049582	Bacteria	1397
353	Ga0501048_0220660	3300049582	Bacteria	1345
354	Ga0501048_0381391	3300049582	Bacteria	1007
355	Ga0501070_0231183	3300049586	Bacteria	1515
356	Ga0501071_0071201	3300049587	Bacteria	2534
357	Ga0501071_1102842	3300049587	Bacteria	613
358	Ga0501074_0061394	3300049590	Bacteria	2708
359	Ga0501074_0289654	3300049590	Bacteria	1164
360	Ga0501076_0047126	3300049592	Bacteria	3407
361	Ga0501076_0539150	3300049592	Bacteria	962
362	Ga0501077_0022239	3300049593	Bacteria	4017
363	Ga0501253_096007	3300049683	Bacteria	689
364	Ga0501079_0065642	3300049741	Bacteria	2800
365	Ga0501079_0717824	3300049741	Bacteria	787
366	Ga0501080_0065718	3300049742	Bacteria	3374
367	Ga0501081_0065405	3300049743	Bacteria	2527
368	Ga0501083_0079669	3300049744	Bacteria	2172
369	Ga0501035_0051059	3300049822	Bacteria	3704
370	Ga0501035_0119740	3300049822	Bacteria	2302
371	Ga0501044_0377448	3300049823	Bacteria	1333
372	Ga0501045_0014466	3300049824	Bacteria	5592
373	Ga0501045_0127291	3300049824	Bacteria	1893
374	Ga0501045_0479632	3300049824	Bacteria	924
375	nmdc:mga05p37_528559_c1	3300050507	Bacteria	1347
376	nmdc:mga09592_218217_c1	3300050508	Bacteria	1653
377	nmdc:mga0qj67_341601_c1	3300050509	Bacteria	1211
378	nmdc:mga06r32_187314_c1	3300050510	Bacteria	2056
379	nmdc:mga08y16_270851_c1	3300050511	Bacteria	1753
380	nmdc:mga0n895_184937_c1	3300050512	Bacteria	2115
381	nmdc:mga0n895_847642_c1	3300050512	Bacteria	902
382	nmdc:mga0n895_90440_c1	3300050512	Bacteria	3063
383	nmdc:mga0rr50_544965_c1	3300050513	Bacteria	988
384	nmdc:mga0rr50_75171_c1	3300050513	Bacteria	2589
385	nmdc:mga08x19_105897_c1	3300050514	Bacteria	1871
386	nmdc:mga08x19_71847_c1	3300050514	Bacteria	2257
387	Ga0500610_0114136	3300053079	Bacteria	1386
388	Ga0500643_000213	3300053087	Bacteria	54707
389	Ga0501084_0028409	3300054114	Bacteria	4675
390	Ga0501082_0684524	3300060353	Bacteria	897
391	Ga0466962_0332370	3300061719	Bacteria	755
392	Ga0530510_0071021	3300061734	Bacteria	2527

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300048912	Ga0496109_1594466	Ga0496109_1594466_17_523	149
2	3300005338	Ga0068868_100215346	Ga0068868_1002153462	150
3	3300005356	Ga0070674_100427801	Ga0070674_1004278012	150
4	3300005459	Ga0068867_100269064	Ga0068867_1002690642	150
5	3300005548	Ga0070665_100005088	Ga0070665_1000050887	150
6	3300005578	Ga0068854_100811138	Ga0068854_1008111382	150
7	3300006237	Ga0097621_100006127	Ga0097621_1000061276	150
8	3300006358	Ga0068871_100307549	Ga0068871_1003075492	150
9	3300006881	Ga0068865_100021668	Ga0068865_1000216681	150
10	3300025934	Ga0207686_10082553	Ga0207686_100825532	150
11	3300025938	Ga0207704_10004440	Ga0207704_100044402	150
12	3300025981	Ga0207640_10804813	Ga0207640_108048132	150
13	3300026023	Ga0207677_10045153	Ga0207677_100451532	150
14	3300026089	Ga0207648_10108652	Ga0207648_101086522	150
15	3300048918	Ga0496115_0613143	Ga0496115_0613143_22_582	151
16	3300048912	Ga0496109_0674474	Ga0496109_0674474_200_760	153
17	3300006881	Ga0068865_100295670	Ga0068865_1002956702	154
18	3300009148	Ga0105243_10426129	Ga0105243_104261292	154
19	3300025938	Ga0207704_10559524	Ga0207704_105595242	154
20	3300044693	Ga0466961_0091331	Ga0466961_0091331_357_905	154
21	3300046477	Ga0495664_0086515	Ga0495664_0086515_1276_1836	154
22	3300048917	Ga0496114_0055366	Ga0496114_0055366_1197_1751	154
23	3300005545	Ga0070695_100454750	Ga0070695_1004547501	155
24	3300048917	Ga0496114_0423286	Ga0496114_0423286_199_759	155
25	3300049587	Ga0501071_1102842	Ga0501071_1102842_118_603	155
26	3300048917	Ga0496114_0217427	Ga0496114_0217427_47_613	156
27	iso_pu_bacteria	2808606365	2808874112	158
28	3300006914	Ga0075436_100188360	Ga0075436_1001883602	161
29	3300050512	nmdc:mga0n895_847642_c1	nmdc:mga0n895_847642_c1_111_644	161
30	3300050514	nmdc:mga08x19_71847_c1	nmdc:mga08x19_71847_c1_1608_2141	161
31	3300035691	Ga0373931_0789750	Ga0373931_0789750_85_606	162
32	3300006914	Ga0075436_100384281	Ga0075436_1003842812	163
33	3300007076	Ga0075435_100007953	Ga0075435_1000079532	163
34	3300009176	Ga0105242_10003291	Ga0105242_100032914	163
35	3300014969	Ga0157376_10058963	Ga0157376_100589632	163
36	3300048917	Ga0496114_0045371	Ga0496114_0045371_542_1048	163
37	3300050512	nmdc:mga0n895_184937_c1	nmdc:mga0n895_184937_c1_883_1419	163
38	3300050513	nmdc:mga0rr50_75171_c1	nmdc:mga0rr50_75171_c1_809_1345	163
39	iso_pu_bacteria	2818991472	2819743669	163
40	iso_pu_bacteria	2928153084	2928155182	163
41	iso_pu_bacteria	8001781756	8001785962	163
42	3300005336	Ga0070680_100408133	Ga0070680_1004081332	164
43	3300005364	Ga0070673_100970473	Ga0070673_1009704732	164
44	3300005618	Ga0068864_100056334	Ga0068864_1000563344	164
45	3300005842	Ga0068858_101415807	Ga0068858_1014158071	164
46	3300005843	Ga0068860_100756882	Ga0068860_1007568821	164
47	3300025917	Ga0207660_10224585	Ga0207660_102245852	164
48	3300026035	Ga0207703_10754011	Ga0207703_107540112	164
49	3300026095	Ga0207676_10014282	Ga0207676_100142823	164
50	3300050509	nmdc:mga0qj67_341601_c1	nmdc:mga0qj67_341601_c1_194_694	164
51	3300050510	nmdc:mga06r32_187314_c1	nmdc:mga06r32_187314_c1_582_1082	164
52	iso_pu_bacteria	2758568621	2760623696	164
53	iso_pu_bacteria	2811994880	2812362128	164
54	3300005330	Ga0070690_100497937	Ga0070690_1004979372	165
55	3300005340	Ga0070689_100370388	Ga0070689_1003703882	165
56	3300005354	Ga0070675_100480631	Ga0070675_1004806312	165
57	3300005456	Ga0070678_100013428	Ga0070678_1000134284	165
58	3300005617	Ga0068859_100242236	Ga0068859_1002422361	165
59	3300005844	Ga0068862_100090764	Ga0068862_1000907642	165
60	3300006931	Ga0097620_100242239	Ga0097620_1002422393	165
61	3300009098	Ga0105245_10130451	Ga0105245_101304512	165
62	3300025926	Ga0207659_10375299	Ga0207659_103752992	165
63	3300025927	Ga0207687_10537687	Ga0207687_105376871	165
64	3300026067	Ga0207678_10500448	Ga0207678_105004482	165
65	3300026075	Ga0207708_10590804	Ga0207708_105908042	165
66	3300041443	Ga0451789_0096529	Ga0451789_0096529_3095_3697	165
67	3300041451	Ga0451791_1810703	Ga0451791_1810703_1115_1717	165
68	3300041452	Ga0451793_0526721	Ga0451793_0526721_5763_6365	165
69	3300041453	Ga0451797_0892238	Ga0451797_0892238_1798_2400	165
70	3300041456	Ga0451795_0688428	Ga0451795_0688428_6556_7158	165
71	3300041460	Ga0451802_0901948	Ga0451802_0901948_319_921	165
72	3300041491	Ga0451833_0152494	Ga0451833_0152494_280_882	165
73	3300041494	Ga0451837_1787670	Ga0451837_1787670_96_698	165
74	3300041498	Ga0451841_0979208	Ga0451841_0979208_321_923	165
75	3300041509	Ga0451843_0654136	Ga0451843_0654136_1492_2094	165
76	3300041511	Ga0451855_1931790	Ga0451855_1931790_221_823	165
77	3300041512	Ga0451853_0412072	Ga0451853_0412072_39_641	165
78	3300005329	Ga0070683_100315353	Ga0070683_1003153532	166
79	3300005335	Ga0070666_10007272	Ga0070666_100072723	166
80	3300005353	Ga0070669_100720625	Ga0070669_1007206252	166
81	3300005355	Ga0070671_100001055	Ga0070671_10000105514	166
82	3300005355	Ga0070671_100034015	Ga0070671_1000340153	166
83	3300005367	Ga0070667_100027204	Ga0070667_1000272042	166
84	3300005548	Ga0070665_100017104	Ga0070665_1000171046	166
85	3300005616	Ga0068852_101118866	Ga0068852_1011188662	166
86	3300005616	Ga0068852_101586446	Ga0068852_1015864461	166
87	3300005841	Ga0068863_100000996	Ga0068863_10000099616	166
88	3300005842	Ga0068858_100031457	Ga0068858_1000314574	166
89	3300005843	Ga0068860_100000102	Ga0068860_10000010248	166
90	3300005937	Ga0081455_10000376	Ga0081455_1000037627	166
91	3300009101	Ga0105247_10145198	Ga0105247_101451982	166
92	3300009551	Ga0105238_10691243	Ga0105238_106912431	166
93	3300013307	Ga0157372_10367854	Ga0157372_103678542	166
94	3300013307	Ga0157372_11054820	Ga0157372_110548202	166
95	3300025903	Ga0207680_10019845	Ga0207680_100198453	166
96	3300025923	Ga0207681_10624054	Ga0207681_106240542	166
97	3300026035	Ga0207703_10005332	Ga0207703_1000533212	166
98	3300026088	Ga0207641_10001531	Ga0207641_1000153125	166
99	3300028379	Ga0268266_10007800	Ga0268266_100078007	166
100	3300028381	Ga0268264_10000171	Ga0268264_1000017189	166
101	3300031852	Ga0307410_10341126	Ga0307410_103411262	166
102	3300035114	Ga0373939_0009161	Ga0373939_0009161_947_1465	166
103	3300048911	Ga0496108_0048600	Ga0496108_0048600_1976_2479	166
104	3300048912	Ga0496109_0330938	Ga0496109_0330938_404_1006	166
105	3300048914	Ga0496111_0064454	Ga0496111_0064454_1549_2052	166
106	3300048916	Ga0496113_0300756	Ga0496113_0300756_70_573	166
107	3300048917	Ga0496114_0144896	Ga0496114_0144896_1071_1673	166
108	3300053087	Ga0500643_000213	Ga0500643_000213_1322_1834	166
109	iso_pu_bacteria	8054609563	8054610725	166
110	3300002067	JGI24735J21928_10013330	JGI24735J21928_100133303	167
111	3300003578	Ga0006562J51391_1023425	Ga0006562J51391_10234254	167
112	3300003578	Ga0006562J51391_1023426	Ga0006562J51391_10234264	167
113	3300003760	Ga0055527_1000004	Ga0055527_1000004235	167
114	3300003762	Ga0055542_1000019	Ga0055542_100001923	167
115	3300003763	Ga0055529_1000008	Ga0055529_1000008342	167
116	3300005329	Ga0070683_100047870	Ga0070683_1000478704	167
117	3300005338	Ga0068868_100006134	Ga0068868_1000061344	167
118	3300005339	Ga0070660_100136378	Ga0070660_1001363782	167
119	3300005340	Ga0070689_100351618	Ga0070689_1003516182	167
120	3300005344	Ga0070661_100192229	Ga0070661_1001922291	167
121	3300005345	Ga0070692_10100310	Ga0070692_101003102	167
122	3300005347	Ga0070668_100002331	Ga0070668_10000233111	167
123	3300005347	Ga0070668_100018449	Ga0070668_1000184493	167
124	3300005353	Ga0070669_100084962	Ga0070669_1000849622	167
125	3300005354	Ga0070675_100381941	Ga0070675_1003819412	167
126	3300005356	Ga0070674_100009572	Ga0070674_1000095726	167
127	3300005356	Ga0070674_100324026	Ga0070674_1003240261	167
128	3300005365	Ga0070688_100742789	Ga0070688_1007427891	167
129	3300005367	Ga0070667_100946080	Ga0070667_1009460802	167
130	3300005434	Ga0070709_10164964	Ga0070709_101649642	167
131	3300005436	Ga0070713_100358956	Ga0070713_1003589562	167
132	3300005438	Ga0070701_10066255	Ga0070701_100662552	167
133	3300005455	Ga0070663_100374908	Ga0070663_1003749082	167
134	3300005456	Ga0070678_100016264	Ga0070678_1000162644	167
135	3300005456	Ga0070678_100490054	Ga0070678_1004900541	167
136	3300005456	Ga0070678_100548264	Ga0070678_1005482642	167
137	3300005456	Ga0070678_100571236	Ga0070678_1005712361	167
138	3300005456	Ga0070678_100930456	Ga0070678_1009304562	167
139	3300005457	Ga0070662_100282843	Ga0070662_1002828432	167
140	3300005457	Ga0070662_101075173	Ga0070662_1010751732	167
141	3300005459	Ga0068867_100155670	Ga0068867_1001556702	167
142	3300005459	Ga0068867_100378298	Ga0068867_1003782982	167
143	3300005459	Ga0068867_100961257	Ga0068867_1009612571	167
144	3300005535	Ga0070684_100240711	Ga0070684_1002407112	167
145	3300005536	Ga0070697_100114137	Ga0070697_1001141372	167
146	3300005539	Ga0068853_100069036	Ga0068853_1000690362	167
147	3300005544	Ga0070686_100010441	Ga0070686_1000104415	167
148	3300005544	Ga0070686_100111132	Ga0070686_1001111322	167
149	3300005545	Ga0070695_100031358	Ga0070695_1000313582	167
150	3300005546	Ga0070696_100175102	Ga0070696_1001751022	167
151	3300005547	Ga0070693_100047013	Ga0070693_1000470132	167
152	3300005548	Ga0070665_100394933	Ga0070665_1003949332	167
153	3300005563	Ga0068855_100320171	Ga0068855_1003201712	167
154	3300005578	Ga0068854_100020897	Ga0068854_1000208974	167
155	3300005615	Ga0070702_100032281	Ga0070702_1000322813	167
156	3300005615	Ga0070702_100337799	Ga0070702_1003377992	167
157	3300005616	Ga0068852_100237927	Ga0068852_1002379272	167
158	3300005618	Ga0068864_101342658	Ga0068864_1013426581	167
159	3300005719	Ga0068861_100261445	Ga0068861_1002614452	167
160	3300005842	Ga0068858_100064629	Ga0068858_1000646292	167
161	3300005842	Ga0068858_100605627	Ga0068858_1006056272	167
162	3300005983	Ga0081540_1008068	Ga0081540_10080687	167
163	3300006173	Ga0070716_100279951	Ga0070716_1002799512	167
164	3300006237	Ga0097621_100021594	Ga0097621_1000215942	167
165	3300006852	Ga0075433_10002932	Ga0075433_100029321	167
166	3300006871	Ga0075434_100016449	Ga0075434_1000164497	167
167	3300006881	Ga0068865_100119680	Ga0068865_1001196802	167
168	3300006914	Ga0075436_100013637	Ga0075436_1000136374	167
169	3300009092	Ga0105250_10128104	Ga0105250_101281042	167
170	3300009093	Ga0105240_10517408	Ga0105240_105174082	167
171	3300009094	Ga0111539_10069515	Ga0111539_100695152	167
172	3300009098	Ga0105245_10011784	Ga0105245_100117844	167
173	3300009098	Ga0105245_10392884	Ga0105245_103928842	167
174	3300009098	Ga0105245_10436649	Ga0105245_104366492	167
175	3300009147	Ga0114129_10097466	Ga0114129_100974663	167
176	3300009148	Ga0105243_10026061	Ga0105243_100260614	167
177	3300009148	Ga0105243_10942727	Ga0105243_109427271	167
178	3300009176	Ga0105242_10037775	Ga0105242_100377752	167
179	3300009176	Ga0105242_10193854	Ga0105242_101938542	167
180	3300009545	Ga0105237_10620092	Ga0105237_106200922	167
181	3300009551	Ga0105238_10256840	Ga0105238_102568402	167
182	3300009551	Ga0105238_11748302	Ga0105238_117483021	167
183	3300009553	Ga0105249_10414832	Ga0105249_104148322	167
184	3300009553	Ga0105249_11372365	Ga0105249_113723652	167
185	3300010375	Ga0105239_10502313	Ga0105239_105023132	167
186	3300010375	Ga0105239_11508693	Ga0105239_115086932	167
187	3300011119	Ga0105246_10546301	Ga0105246_105463012	167
188	3300011119	Ga0105246_10554149	Ga0105246_105541492	167
189	3300013102	Ga0157371_10261420	Ga0157371_102614202	167
190	3300013104	Ga0157370_10194821	Ga0157370_101948212	167
191	3300013104	Ga0157370_10418306	Ga0157370_104183062	167
192	3300013105	Ga0157369_10193823	Ga0157369_101938233	167
193	3300013105	Ga0157369_10252386	Ga0157369_102523862	167
194	3300013105	Ga0157369_10439033	Ga0157369_104390332	167
195	3300013105	Ga0157369_11064751	Ga0157369_110647512	167
196	3300013296	Ga0157374_10176276	Ga0157374_101762763	167
197	3300013306	Ga0163162_10611702	Ga0163162_106117022	167
198	3300013306	Ga0163162_10738204	Ga0163162_107382042	167
199	3300013307	Ga0157372_10138825	Ga0157372_101388252	167
200	3300013307	Ga0157372_10142265	Ga0157372_101422652	167
201	3300013307	Ga0157372_11482247	Ga0157372_114822472	167
202	3300013308	Ga0157375_10045106	Ga0157375_100451062	167
203	3300013308	Ga0157375_12570305	Ga0157375_125703051	167
204	3300014325	Ga0163163_10048266	Ga0163163_100482665	167
205	3300014325	Ga0163163_10074061	Ga0163163_100740614	167
206	3300014326	Ga0157380_10078134	Ga0157380_100781342	167
207	3300014326	Ga0157380_11013934	Ga0157380_110139342	167
208	3300014497	Ga0182008_10335971	Ga0182008_103359712	167
209	3300014745	Ga0157377_10023139	Ga0157377_100231393	167
210	3300014745	Ga0157377_10208511	Ga0157377_102085112	167
211	3300017792	Ga0163161_10006047	Ga0163161_1000604711	167
212	3300017792	Ga0163161_10408986	Ga0163161_104089862	167
213	3300020070	Ga0206356_11466549	Ga0206356_114665492	167
214	3300021384	Ga0213876_10269324	Ga0213876_102693242	167
215	3300025228	Ga0209672_100011	Ga0209672_100011235	167
216	3300025229	Ga0209147_100595	Ga0209147_1005958	167
217	3300025230	Ga0209563_100165	Ga0209563_1001655	167
218	3300025242	Ga0209258_103735	Ga0209258_1037352	167
219	3300025254	Ga0209148_1000023	Ga0209148_100002373	167
220	3300025272	Ga0209455_1000023	Ga0209455_100002373	167
221	3300025898	Ga0207692_10049379	Ga0207692_100493793	167
222	3300025904	Ga0207647_10059000	Ga0207647_100590002	167
223	3300025906	Ga0207699_10261592	Ga0207699_102615922	167
224	3300025914	Ga0207671_10274126	Ga0207671_102741261	167
225	3300025919	Ga0207657_10008669	Ga0207657_100086694	167
226	3300025927	Ga0207687_10064909	Ga0207687_100649092	167
227	3300025928	Ga0207700_10311746	Ga0207700_103117462	167
228	3300025933	Ga0207706_10138894	Ga0207706_101388942	167
229	3300025933	Ga0207706_10326017	Ga0207706_103260172	167
230	3300025935	Ga0207709_10042159	Ga0207709_100421593	167
231	3300025936	Ga0207670_10572501	Ga0207670_105725012	167
232	3300025937	Ga0207669_10921101	Ga0207669_109211011	167
233	3300025939	Ga0207665_10000643	Ga0207665_1000064311	167
234	3300025940	Ga0207691_10087175	Ga0207691_100871753	167
235	3300025940	Ga0207691_10414350	Ga0207691_104143502	167
236	3300025941	Ga0207711_10035256	Ga0207711_100352565	167
237	3300025944	Ga0207661_10268150	Ga0207661_102681502	167
238	3300025949	Ga0207667_10170046	Ga0207667_101700462	167
239	3300025961	Ga0207712_10044358	Ga0207712_100443582	167
240	3300025961	Ga0207712_10233256	Ga0207712_102332562	167
241	3300025972	Ga0207668_10001896	Ga0207668_100018964	167
242	3300025972	Ga0207668_10049167	Ga0207668_100491673	167
243	3300025981	Ga0207640_10027677	Ga0207640_100276775	167
244	3300026023	Ga0207677_10201479	Ga0207677_102014792	167
245	3300026035	Ga0207703_10263428	Ga0207703_102634282	167
246	3300026041	Ga0207639_10066684	Ga0207639_100666843	167
247	3300026067	Ga0207678_10027882	Ga0207678_100278822	167
248	3300026075	Ga0207708_10025655	Ga0207708_100256553	167
249	3300026089	Ga0207648_10333243	Ga0207648_103332432	167
250	3300026118	Ga0207675_100001020	Ga0207675_10000102022	167
251	3300026118	Ga0207675_100306593	Ga0207675_1003065932	167
252	3300026118	Ga0207675_100522359	Ga0207675_1005223592	167
253	3300026121	Ga0207683_10011853	Ga0207683_1001185310	167
254	3300026121	Ga0207683_10480484	Ga0207683_104804842	167
255	3300027907	Ga0207428_10311072	Ga0207428_103110722	167
256	3300030733	Ga0314311_1141977	Ga0314311_11419772	167
257	3300031852	Ga0307410_10196774	Ga0307410_101967742	167
258	3300031995	Ga0307409_101080008	Ga0307409_1010800082	167
259	3300032004	Ga0307414_10512413	Ga0307414_105124132	167
260	3300032005	Ga0307411_10015742	Ga0307411_100157422	167
261	3300032005	Ga0307411_10300006	Ga0307411_103000062	167
262	3300034957	Ga0373938_0003738	Ga0373938_0003738_455_976	167
263	3300035112	Ga0373932_0002556	Ga0373932_0002556_2505_3026	167
264	3300035115	Ga0373941_0173095	Ga0373941_0173095_37_558	167
265	3300035121	Ga0373960_0005704	Ga0373960_0005704_158_679	167
266	3300035241	Ga0373961_0059125	Ga0373961_0059125_79_600	167
267	3300035242	Ga0373962_0010054	Ga0373962_0010054_522_1043	167
268	3300035691	Ga0373931_0063402	Ga0373931_0063402_516_1037	167
269	3300037068	Ga0373925_0210762	Ga0373925_0210762_842_1363	167
270	3300037312	Ga0395899_0037821	Ga0395899_0037821_2800_3336	167
271	3300037312	Ga0395899_0071424	Ga0395899_0071424_346_876	167
272	3300037418	Ga0395900_0002511	Ga0395900_0002511_19313_19843	167
273	3300037466	Ga0395898_0000270	Ga0395898_0000270_92381_92911	167
274	3300038443	Ga0395901_1849383	Ga0395901_1849383_11_538	167
275	3300039437	Ga0436365_0416644	Ga0436365_0416644_194_712	167
276	3300044765	Ga0466970_0370772	Ga0466970_0370772_129_656	167
277	3300044901	Ga0466960_0197458	Ga0466960_0197458_368_907	167
278	3300045049	Ga0466959_0285132	Ga0466959_0285132_316_825	167
279	3300045836	Ga0466958_0534654	Ga0466958_0534654_11_526	167
280	3300045836	Ga0466958_0596055	Ga0466958_0596055_123_662	167
281	3300045976	Ga0466967_0234886	Ga0466967_0234886_877_1416	167
282	3300046453	Ga0495627_054517	Ga0495627_054517_526_1053	167
283	3300046460	Ga0495638_0000745	Ga0495638_0000745_13575_14084	167
284	3300046472	Ga0495580_0546537	Ga0495580_0546537_60_581	167
285	3300046499	Ga0495594_0450215	Ga0495594_0450215_60_647	167
286	3300046511	Ga0495608_0015421	Ga0495608_0015421_1348_1908	167
287	3300046518	Ga0495631_0153064	Ga0495631_0153064_39_611	167
288	3300046531	Ga0495665_0184785	Ga0495665_0184785_276_836	167
289	3300046531	Ga0495665_0209870	Ga0495665_0209870_277_864	167
290	3300046559	Ga0495667_0322697	Ga0495667_0322697_246_806	167
291	3300046675	Ga0495657_0202456	Ga0495657_0202456_208_768	167
292	3300046675	Ga0495657_0480539	Ga0495657_0480539_176_691	167
293	3300046683	Ga0495658_0106068	Ga0495658_0106068_724_1290	167
294	3300046690	Ga0495624_0393487	Ga0495624_0393487_161_682	167
295	3300046809	Ga0495600_0275512	Ga0495600_0275512_438_998	167
296	3300046809	Ga0495600_0299506	Ga0495600_0299506_369_941	167
297	3300047315	Ga0495581_0198983	Ga0495581_0198983_204_791	167
298	3300047315	Ga0495581_0201528	Ga0495581_0201528_311_871	167
299	3300047317	Ga0495604_0394278	Ga0495604_0394278_314_829	167
300	3300047319	Ga0495674_0183125	Ga0495674_0183125_827_1384	167
301	3300047321	Ga0495676_0123896	Ga0495676_0123896_288_875	167
302	3300047321	Ga0495676_0139635	Ga0495676_0139635_760_1281	167
303	3300047322	Ga0495680_0135286	Ga0495680_0135286_419_934	167
304	3300047673	Ga0495593_0158113	Ga0495593_0158113_113_670	167
305	3300048089	Ga0495614_0124279	Ga0495614_0124279_453_1040	167
306	3300048903	Ga0496100_1162205	Ga0496100_1162205_53_580	167
307	3300048904	Ga0496101_0038099	Ga0496101_0038099_1024_1551	167
308	3300048904	Ga0496101_0129992	Ga0496101_0129992_304_861	167
309	3300048904	Ga0496101_0433131	Ga0496101_0433131_265_825	167
310	3300048904	Ga0496101_0664656	Ga0496101_0664656_138_653	167
311	3300048904	Ga0496101_0823796	Ga0496101_0823796_23_583	167
312	3300048905	Ga0496102_0018838	Ga0496102_0018838_5157_5714	167
313	3300048905	Ga0496102_0190399	Ga0496102_0190399_258_773	167
314	3300048906	Ga0496103_0024707	Ga0496103_0024707_723_1250	167
315	3300048907	Ga0496104_0003581	Ga0496104_0003581_7709_8266	167
316	3300048907	Ga0496104_0733169	Ga0496104_0733169_242_769	167
317	3300048908	Ga0496105_0019149	Ga0496105_0019149_2853_3374	167
318	3300048908	Ga0496105_0072934	Ga0496105_0072934_268_825	167
319	3300048909	Ga0496106_0598391	Ga0496106_0598391_167_682	167
320	3300048910	Ga0496107_0325894	Ga0496107_0325894_276_791	167
321	3300048910	Ga0496107_0474709	Ga0496107_0474709_36_563	167
322	3300048911	Ga0496108_0013807	Ga0496108_0013807_2549_3097	167
323	3300048911	Ga0496108_0035148	Ga0496108_0035148_1039_1599	167
324	3300048911	Ga0496108_0901098	Ga0496108_0901098_43_603	167
325	3300048912	Ga0496109_0004921	Ga0496109_0004921_262_819	167
326	3300048912	Ga0496109_0011240	Ga0496109_0011240_2610_3131	167
327	3300048912	Ga0496109_0365160	Ga0496109_0365160_794_1324	167
328	3300048913	Ga0496110_0006519	Ga0496110_0006519_5234_5791	167
329	3300048913	Ga0496110_0009172	Ga0496110_0009172_5144_5665	167
330	3300048913	Ga0496110_0117049	Ga0496110_0117049_1180_1740	167
331	3300048913	Ga0496110_0223920	Ga0496110_0223920_17_565	167
332	3300048913	Ga0496110_0745961	Ga0496110_0745961_274_792	167
333	3300048914	Ga0496111_0000488	Ga0496111_0000488_5153_5710	167
334	3300048914	Ga0496111_0443483	Ga0496111_0443483_191_751	167
335	3300048915	Ga0496112_0020019	Ga0496112_0020019_4151_4672	167
336	3300048916	Ga0496113_0331896	Ga0496113_0331896_172_729	167
337	3300048917	Ga0496114_0016221	Ga0496114_0016221_1612_2169	167
338	3300048917	Ga0496114_0045932	Ga0496114_0045932_3002_3550	167
339	3300048917	Ga0496114_0099027	Ga0496114_0099027_193_720	167
340	3300048917	Ga0496114_0129336	Ga0496114_0129336_286_846	167
341	3300048917	Ga0496114_0236161	Ga0496114_0236161_396_962	167
342	3300048917	Ga0496114_0346120	Ga0496114_0346120_460_1020	167
343	3300048918	Ga0496115_0012885	Ga0496115_0012885_3524_4045	167
344	3300048918	Ga0496115_0114207	Ga0496115_0114207_104_631	167
345	3300048920	Ga0496117_0022532	Ga0496117_0022532_1187_1714	167
346	3300048920	Ga0496117_0186860	Ga0496117_0186860_256_783	167
347	3300048921	Ga0496118_0518655	Ga0496118_0518655_39_566	167
348	3300048922	Ga0496119_0060316	Ga0496119_0060316_118_645	167
349	3300048927	Ga0496124_0044918	Ga0496124_0044918_342_878	167
350	3300048927	Ga0496124_0564018	Ga0496124_0564018_188_715	167
351	3300048929	Ga0496126_0036174	Ga0496126_0036174_57_584	167
352	3300049568	Ga0501031_0062577	Ga0501031_0062577_1605_2168	167
353	3300049568	Ga0501031_0365523	Ga0501031_0365523_295_858	167
354	3300049569	Ga0501032_0449838	Ga0501032_0449838_272_793	167
355	3300049572	Ga0501036_0128685	Ga0501036_0128685_808_1371	167
356	3300049572	Ga0501036_0594618	Ga0501036_0594618_170_721	167
357	3300049575	Ga0501039_0053368	Ga0501039_0053368_1662_2183	167
358	3300049575	Ga0501039_0363099	Ga0501039_0363099_453_1004	167
359	3300049576	Ga0501040_0065878	Ga0501040_0065878_1740_2261	167
360	3300049576	Ga0501040_0342373	Ga0501040_0342373_115_678	167
361	3300049576	Ga0501040_0368446	Ga0501040_0368446_21_572	167
362	3300049577	Ga0501041_0156836	Ga0501041_0156836_283_846	167
363	3300049577	Ga0501041_0272423	Ga0501041_0272423_219_770	167
364	3300049578	Ga0501042_0155530	Ga0501042_0155530_609_1172	167
365	3300049580	Ga0501046_0138051	Ga0501046_0138051_891_1454	167
366	3300049582	Ga0501048_0038635	Ga0501048_0038635_1029_1592	167
367	3300049582	Ga0501048_0205447	Ga0501048_0205447_561_1112	167
368	3300049582	Ga0501048_0220660	Ga0501048_0220660_794_1315	167
369	3300049582	Ga0501048_0381391	Ga0501048_0381391_310_831	167
370	3300049586	Ga0501070_0231183	Ga0501070_0231183_59_589	167
371	3300049587	Ga0501071_0071201	Ga0501071_0071201_25_588	167
372	3300049590	Ga0501074_0061394	Ga0501074_0061394_1064_1627	167
373	3300049590	Ga0501074_0289654	Ga0501074_0289654_310_831	167
374	3300049592	Ga0501076_0047126	Ga0501076_0047126_2810_3373	167
375	3300049592	Ga0501076_0539150	Ga0501076_0539150_110_661	167
376	3300049593	Ga0501077_0022239	Ga0501077_0022239_641_1204	167
377	3300049683	Ga0501253_096007	Ga0501253_096007_102_638	167
378	3300049741	Ga0501079_0065642	Ga0501079_0065642_328_891	167
379	3300049741	Ga0501079_0717824	Ga0501079_0717824_241_762	167
380	3300049742	Ga0501080_0065718	Ga0501080_0065718_2251_2814	167
381	3300049743	Ga0501081_0065405	Ga0501081_0065405_461_1024	167
382	3300049744	Ga0501083_0079669	Ga0501083_0079669_1067_1630	167
383	3300049822	Ga0501035_0051059	Ga0501035_0051059_2054_2617	167
384	3300049822	Ga0501035_0119740	Ga0501035_0119740_1563_2096	167
385	3300049823	Ga0501044_0377448	Ga0501044_0377448_727_1287	167
386	3300049824	Ga0501045_0014466	Ga0501045_0014466_3185_3748	167
387	3300049824	Ga0501045_0127291	Ga0501045_0127291_1321_1842	167
388	3300049824	Ga0501045_0479632	Ga0501045_0479632_54_605	167
389	3300050507	nmdc:mga05p37_528559_c1	nmdc:mga05p37_528559_c1_114_668	167
390	3300050508	nmdc:mga09592_218217_c1	nmdc:mga09592_218217_c1_840_1352	167
391	3300050511	nmdc:mga08y16_270851_c1	nmdc:mga08y16_270851_c1_302_823	167
392	3300050512	nmdc:mga0n895_90440_c1	nmdc:mga0n895_90440_c1_1596_2117	167
393	3300050513	nmdc:mga0rr50_544965_c1	nmdc:mga0rr50_544965_c1_158_679	167
394	3300050514	nmdc:mga08x19_105897_c1	nmdc:mga08x19_105897_c1_590_1111	167
395	3300053079	Ga0500610_0114136	Ga0500610_0114136_397_906	167
396	3300054114	Ga0501084_0028409	Ga0501084_0028409_3535_4098	167
397	3300060353	Ga0501082_0684524	Ga0501082_0684524_49_612	167
398	3300061719	Ga0466962_0332370	Ga0466962_0332370_162_710	167
399	3300061734	Ga0530510_0071021	Ga0530510_0071021_486_1049	167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04140

ICMT

Isoprenylcysteine carboxyl methyltransferase (ICMT) family

75

167

0.96 PF04191

PEMT

Phospholipid methyltransferase

69

169

0.64 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4a2n-assembly1.cif.gz_B	crystal structure of ma-icmt	0.8094	2	165
5v7p-assembly1.cif.gz_A	atomic structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody	0.8057	43	165
5vg9-assembly1.cif.gz_A	structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase) without a monobody	0.7928	43	165
4a2n-assembly1.cif.gz_B	crystal structure of ma-icmt	0.7922	2	165
7bw1-assembly1.cif.gz_A	crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride	0.7483	70	165

ID	Description	Score	Start	End	Superfamily
af_O06539_1_164_1.20.120.1630	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);	0.9981	4	163	1.20.120.1630
af_O06539_1_164_1.20.120.1630	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);	0.9679	4	163	1.20.120.1630
af_Q8I555_347_506_1.20.120.1630	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);	0.9396	69	166	1.20.120.1630
af_Q2G1E3_21_189_1.20.120.1630	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);	0.9164	2	161	1.20.120.1630
af_P71912_2_135_1.20.120.1630	Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);	0.8794	66	166	1.20.120.1630

ID	Description	Score	Start	End	GO Terms
AF-A0A1G5LSL8-F1-model_v4	Alkylresorcinol O-methyltransferase	0.9998	1	164	GO:0004671 GO:0016020 GO:0032259
AF-A0A2N0GPK3-F1-model_v4	deleted	0.9996	3	166
AF-A0A1Q5ANG1-F1-model_v4	deleted	0.9987	3	164
AF-A0A1Q5EJ80-F1-model_v4	Isoprenylcysteine carboxyl methyltransferase	0.9985	1	166	GO:0004671 GO:0016020
AF-A0A841DSV0-F1-model_v4	Methyltransferase	0.9984	3	167	GO:0004671 GO:0016020 GO:0032259

Feature Viewer

pLDDT	pTM	Quality
94.4	0.87	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F434374

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF04140

ICMT

Isoprenylcysteine carboxyl methyltransferase (ICMT) family

75

167

0.96

PF04191

PEMT

Phospholipid methyltransferase

69

169

0.64

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map