F434311

General Info

Members Datasets Scaffolds Average Seq Length
399 239 798 98

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10402963|Ga0207665_104029632
Length 112
Sequence MVDFNKLDRTIHEKGRLAIMTLLATRSRWPFRELKNALQMSDGNLVTHLRTLHQAGYVAVTKEVLDRPLTSYSMTERGRTAFKLYIEMLEEIVKLGRGYKFNLKLCSTKPTT

Samples

Sample ID Description Type Environment
1 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
98 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
114 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
162 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
192 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
193 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
194 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
197 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
198 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
199 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
200 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
224 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
225 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
226 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
227 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
228 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
229 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
237 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
238 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
239 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0
Rhizoplane 5.26
Rhizosphere 91.73
Stem 0
Stem Tuber 0
Unclassified 22.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207665_10402963 3300025939 Unclassified 1042
2 SwRhRL2b_contig_1140804 2162886007 Bacteria 2246
3 CNXas_1002250 3300000545 Unclassified 1332
4 JGI24738J21930_10098202 3300002075 Bacteria 624
5 JGI24744J21845_10033594 3300002077 Unclassified 976
6 JGI24034J26672_10047734 3300002239 Bacteria 730
7 JGI24742J22300_10047027 3300002244 Unclassified 777
8 rootH2_10288176 3300003320 Bacteria 1869
9 rootH1_10342336 3300003323 Bacteria 2331
10 Ga0065704_10008070 3300005289 Bacteria 2333
11 Ga0065704_10031406 3300005289 Bacteria 844
12 Ga0065704_10084492 3300005289 Bacteria 3329
13 Ga0065715_10000369 3300005293 Bacteria 14151
14 Ga0065715_10298100 3300005293 Bacteria 1044
15 Ga0065715_10347753 3300005293 Bacteria 956
16 Ga0065707_10005435 3300005295 Bacteria 3169
17 Ga0065707_10023581 3300005295 Bacteria 1123
18 Ga0070676_10013841 3300005328 Bacteria 4425
19 Ga0070676_10015307 3300005328 Unclassified 4231
20 Ga0070690_100008714 3300005330 Bacteria 5852
21 Ga0070690_100500400 3300005330 Bacteria 909
22 Ga0070670_100428185 3300005331 Bacteria 1170
23 Ga0070677_10827426 3300005333 Unclassified 530
24 Ga0068869_100529953 3300005334 Bacteria 987
25 Ga0070666_10034904 3300005335 Bacteria 3334
26 Ga0070666_10443965 3300005335 Bacteria 936
27 Ga0070666_11123549 3300005335 Unclassified 584
28 Ga0070680_100935565 3300005336 Bacteria 748
29 Ga0068868_100067989 3300005338 Bacteria 2836
30 Ga0068868_100996990 3300005338 Bacteria 766
31 Ga0068868_101250578 3300005338 Bacteria 688
32 Ga0070660_100113581 3300005339 Bacteria 2157
33 Ga0070660_101372664 3300005339 Bacteria 600
34 Ga0070689_101044122 3300005340 Bacteria 729
35 Ga0070689_101461374 3300005340 Bacteria 618
36 Ga0070691_10364100 3300005341 Bacteria 806
37 Ga0070687_100045016 3300005343 Bacteria 2251
38 Ga0070668_100001187 3300005347 Bacteria 18465
39 Ga0070668_100056530 3300005347 Bacteria 3031
40 Ga0070668_101222004 3300005347 Unclassified 681
41 Ga0070668_101507238 3300005347 Bacteria 615
42 Ga0070668_102266401 3300005347 Unclassified 502
43 Ga0070669_100025156 3300005353 Bacteria 4274
44 Ga0070669_100028087 3300005353 Unclassified 4050
45 Ga0070669_100326123 3300005353 Bacteria 1241
46 Ga0070675_100005404 3300005354 Bacteria 9769
47 Ga0070675_100812820 3300005354 Bacteria 855
48 Ga0070671_100275997 3300005355 Bacteria 1429
49 Ga0070674_100003179 3300005356 Bacteria 9154
50 Ga0070673_100056773 3300005364 Bacteria 3090
51 Ga0070673_100277925 3300005364 Bacteria 1468
52 Ga0070688_100114636 3300005365 Bacteria 1797
53 Ga0070688_100193341 3300005365 Bacteria 1419
54 Ga0070667_100011264 3300005367 Bacteria 7396
55 Ga0070667_100241735 3300005367 Unclassified 1612
56 Ga0070667_100372267 3300005367 Bacteria 1296
57 Ga0070667_100544960 3300005367 Bacteria 1066
58 Ga0070709_10053596 3300005434 Bacteria 2540
59 Ga0070709_10115929 3300005434 Bacteria 1808
60 Ga0070709_10246015 3300005434 Bacteria 1286
61 Ga0070709_10314576 3300005434 Unclassified 1147
62 Ga0070714_100070423 3300005435 Bacteria 3023
63 Ga0070713_100095774 3300005436 Bacteria 2561
64 Ga0070713_100168959 3300005436 Bacteria 1958
65 Ga0070710_10181770 3300005437 Unclassified 1317
66 Ga0070701_10672760 3300005438 Bacteria 693
67 Ga0070705_100088154 3300005440 Bacteria 1925
68 Ga0070705_101615327 3300005440 Unclassified 546
69 Ga0070700_100104419 3300005441 Bacteria 1872
70 Ga0070700_100349121 3300005441 Bacteria 1096
71 Ga0070694_100940799 3300005444 Bacteria 715
72 Ga0070708_100341250 3300005445 Bacteria 1412
73 Ga0070708_101125237 3300005445 Bacteria 735
74 Ga0070663_100714547 3300005455 Bacteria 853
75 Ga0070678_100073822 3300005456 Bacteria 2561
76 Ga0070678_100317278 3300005456 Bacteria 1330
77 Ga0070678_100384563 3300005456 Unclassified 1215
78 Ga0070662_100020598 3300005457 Unclassified 4495
79 Ga0070662_100068909 3300005457 Bacteria 2602
80 Ga0070662_100075337 3300005457 Bacteria 2499
81 Ga0070662_100517324 3300005457 Unclassified 997
82 Ga0070681_10551701 3300005458 Bacteria 1066
83 Ga0068867_100393845 3300005459 Bacteria 1167
84 Ga0068867_100666779 3300005459 Unclassified 914
85 Ga0068867_100798626 3300005459 Unclassified 841
86 Ga0070706_100000011 3300005467 Bacteria 198585
87 Ga0070706_100002679 3300005467 Bacteria 17841
88 Ga0070706_100076772 3300005467 Bacteria 3092
89 Ga0070706_100616541 3300005467 Bacteria 1008
90 Ga0070707_101240409 3300005468 Unclassified 712
91 Ga0070707_101983053 3300005468 Unclassified 550
92 Ga0070698_100046517 3300005471 Bacteria 4437
93 Ga0070697_100006699 3300005536 Bacteria 8939
94 Ga0070697_100103779 3300005536 Bacteria 2363
95 Ga0070697_100304325 3300005536 Bacteria 1371
96 Ga0068853_100755136 3300005539 Bacteria 930
97 Ga0070672_100000553 3300005543 Bacteria 22012
98 Ga0070672_101182573 3300005543 Bacteria 681
99 Ga0070695_100526737 3300005545 Bacteria 918
100 Ga0070696_100050231 3300005546 Bacteria 2898
101 Ga0070696_100668240 3300005546 Bacteria 844
102 Ga0070693_100186187 3300005547 Bacteria 1340
103 Ga0070693_101061852 3300005547 Unclassified 616
104 Ga0070665_100000030 3300005548 Bacteria 335245
105 Ga0070704_100435884 3300005549 Unclassified 1125
106 Ga0070704_100519454 3300005549 Bacteria 1036
107 Ga0070704_101445470 3300005549 Unclassified 631
108 Ga0068855_100523660 3300005563 Bacteria 1286
109 Ga0070664_100773687 3300005564 Bacteria 897
110 Ga0068854_100231001 3300005578 Bacteria 1468
111 Ga0068856_100028874 3300005614 Bacteria 5420
112 Ga0068852_100324920 3300005616 Bacteria 1495
113 Ga0068852_101665518 3300005616 Bacteria 660
114 Ga0068852_101728638 3300005616 Bacteria 648
115 Ga0068859_100461616 3300005617 Bacteria 1366
116 Ga0068859_100948049 3300005617 Bacteria 944
117 Ga0068864_100605433 3300005618 Bacteria 1064
118 Ga0068864_101659563 3300005618 Unclassified 644
119 Ga0068866_10270970 3300005718 Unclassified 1048
120 Ga0068866_11302979 3300005718 Bacteria 528
121 Ga0068861_101184728 3300005719 Unclassified 738
122 Ga0068861_101377239 3300005719 Unclassified 688
123 Ga0068851_11046131 3300005834 Bacteria 516
124 Ga0068863_100013116 3300005841 Bacteria 7996
125 Ga0068863_100157320 3300005841 Bacteria 2176
126 Ga0068858_100047217 3300005842 Bacteria 3992
127 Ga0068858_100250770 3300005842 Bacteria 1681
128 Ga0068860_100145315 3300005843 Bacteria 2282
129 Ga0068860_100865756 3300005843 Bacteria 919
130 Ga0068862_101866067 3300005844 Unclassified 611
131 Ga0070717_10000633 3300006028 Bacteria 22619
132 Ga0070717_10393981 3300006028 Bacteria 1243
133 Ga0075363_100493891 3300006048 Unclassified 726
134 Ga0070715_10017833 3300006163 Bacteria 2694
135 Ga0070716_100026076 3300006173 Bacteria 3126
136 Ga0070716_100150402 3300006173 Bacteria 1496
137 Ga0070716_100377353 3300006173 Unclassified 1012
138 Ga0070716_100570576 3300006173 Unclassified 847
139 Ga0070712_100309737 3300006175 Bacteria 1281
140 Ga0068871_100347047 3300006358 Bacteria 1312
141 Ga0068871_101539484 3300006358 Unclassified 629
142 Ga0068871_101678545 3300006358 Unclassified 602
143 Ga0075431_100034686 3300006847 Bacteria 5198
144 Ga0075434_100116346 3300006871 Bacteria 2687
145 Ga0075434_100999423 3300006871 Bacteria 850
146 Ga0068865_100011827 3300006881 Bacteria 5474
147 Ga0075436_100254596 3300006914 Unclassified 1251
148 Ga0097620_100461636 3300006931 Bacteria 1366
149 Ga0097620_100948005 3300006931 Bacteria 944
150 Ga0075435_101360905 3300007076 Bacteria 622
151 Ga0105240_10005308 3300009093 Bacteria 19224
152 Ga0105240_10304051 3300009093 Bacteria 1824
153 Ga0111539_11361415 3300009094 Bacteria 823
154 Ga0105245_10264625 3300009098 Bacteria 1675
155 Ga0105245_10482499 3300009098 Unclassified 1253
156 Ga0105247_10083460 3300009101 Bacteria 2018
157 Ga0114129_11406059 3300009147 Unclassified 861
158 Ga0114129_11507809 3300009147 Bacteria 826
159 Ga0105243_12553019 3300009148 Bacteria 550
160 Ga0105242_10302442 3300009176 Bacteria 1461
161 Ga0105242_11496291 3300009176 Unclassified 706
162 Ga0105248_11788705 3300009177 Bacteria 697
163 Ga0105237_10005104 3300009545 Bacteria 14901
164 Ga0105237_10841309 3300009545 Bacteria 924
165 Ga0105249_13270101 3300009553 Bacteria 521
166 Ga0099796_10035109 3300010159 Bacteria 1661
167 Ga0105239_10062922 3300010375 Bacteria 4073
168 Ga0105239_11662434 3300010375 Bacteria 739
169 Ga0105246_10984520 3300011119 Bacteria 762
170 Ga0157344_1000664 3300012476 Unclassified 1409
171 Ga0157326_1073721 3300012513 Bacteria 546
172 Ga0157373_10488840 3300013100 Bacteria 888
173 Ga0157371_10237099 3300013102 Unclassified 1312
174 Ga0157369_10973293 3300013105 Bacteria 869
175 Ga0157374_10240806 3300013296 Bacteria 1779
176 Ga0157374_10363047 3300013296 Bacteria 1440
177 Ga0157374_10473342 3300013296 Bacteria 1255
178 Ga0157378_10015440 3300013297 Bacteria 6689
179 Ga0157378_10169478 3300013297 Unclassified 2047
180 Ga0157378_10222372 3300013297 Bacteria 1795
181 Ga0157378_10604893 3300013297 Bacteria 1108
182 Ga0157378_10934855 3300013297 Unclassified 899
183 Ga0157378_11520329 3300013297 Unclassified 714
184 Ga0163162_10007939 3300013306 Bacteria 10348
185 Ga0163162_10084820 3300013306 Bacteria 3244
186 Ga0163162_10529193 3300013306 Unclassified 1308
187 Ga0163162_11182756 3300013306 Bacteria 867
188 Ga0163162_11354839 3300013306 Unclassified 809
189 Ga0163162_11966508 3300013306 Bacteria 670
190 Ga0157372_10027683 3300013307 Bacteria 6177
191 Ga0157372_10101807 3300013307 Bacteria 3280
192 Ga0157372_10193402 3300013307 Bacteria 2356
193 Ga0157375_10038584 3300013308 Bacteria 4586
194 Ga0157375_10183457 3300013308 Bacteria 2245
195 Ga0157375_10422102 3300013308 Unclassified 1500
196 Ga0157375_10449456 3300013308 Bacteria 1454
197 Ga0163163_12201200 3300014325 Unclassified 610
198 Ga0157377_10148824 3300014745 Bacteria 1446
199 Ga0157376_12362452 3300014969 Bacteria 571
200 Ga0163161_10002741 3300017792 Bacteria 12533
201 Ga0163161_10159987 3300017792 Bacteria 1717
202 Ga0163161_10817986 3300017792 Unclassified 784
203 Ga0163161_11177238 3300017792 Bacteria 662
204 Ga0163161_11438849 3300017792 Unclassified 603
205 Ga0213872_10074178 3300021361 Unclassified 1531
206 Ga0213872_10180219 3300021361 Unclassified 913
207 Ga0213872_10236977 3300021361 Unclassified 772
208 Ga0213876_10014314 3300021384 Bacteria 4205
209 Ga0213871_10001973 3300021441 Bacteria 3646
210 Ga0207666_1001802 3300025271 Bacteria 2545
211 Ga0207673_1007886 3300025290 Bacteria 1342
212 Ga0207697_10000999 3300025315 Bacteria 15837
213 Ga0207697_10018306 3300025315 Bacteria 2874
214 Ga0207682_10062630 3300025893 Bacteria 1560
215 Ga0207692_10146489 3300025898 Bacteria 1348
216 Ga0207692_10641640 3300025898 Bacteria 685
217 Ga0207688_10003699 3300025901 Bacteria 8354
218 Ga0207680_10016654 3300025903 Bacteria 3865
219 Ga0207685_10311048 3300025905 Bacteria 783
220 Ga0207699_10092448 3300025906 Bacteria 1902
221 Ga0207699_10278642 3300025906 Bacteria 1161
222 Ga0207699_10282161 3300025906 Unclassified 1154
223 Ga0207645_10008726 3300025907 Bacteria 7059
224 Ga0207645_10081832 3300025907 Bacteria 2070
225 Ga0207645_10177573 3300025907 Bacteria 1397
226 Ga0207684_10000052 3300025910 Bacteria 228510
227 Ga0207684_11424386 3300025910 Unclassified 566
228 Ga0207695_10010694 3300025913 Bacteria 11205
229 Ga0207671_10025248 3300025914 Bacteria 4463
230 Ga0207693_10000989 3300025915 Bacteria 25526
231 Ga0207693_10598409 3300025915 Unclassified 858
232 Ga0207663_10001511 3300025916 Bacteria 10863
233 Ga0207663_11101240 3300025916 Bacteria 638
234 Ga0207662_10054344 3300025918 Bacteria 2388
235 Ga0207657_10128473 3300025919 Bacteria 2079
236 Ga0207657_11431229 3300025919 Bacteria 518
237 Ga0207681_10011487 3300025923 Bacteria 5442
238 Ga0207681_10330480 3300025923 Bacteria 1215
239 Ga0207681_10514619 3300025923 Bacteria 981
240 Ga0207650_10073650 3300025925 Bacteria 2573
241 Ga0207659_10005327 3300025926 Bacteria 7796
242 Ga0207687_10814311 3300025927 Unclassified 797
243 Ga0207687_10824403 3300025927 Bacteria 792
244 Ga0207700_10068786 3300025928 Bacteria 2715
245 Ga0207664_10283826 3300025929 Bacteria 1453
246 Ga0207644_10061224 3300025931 Bacteria 2725
247 Ga0207644_10124538 3300025931 Bacteria 1966
248 Ga0207706_10025642 3300025933 Bacteria 5281
249 Ga0207706_10035056 3300025933 Unclassified 4464
250 Ga0207706_10160915 3300025933 Bacteria 1973
251 Ga0207706_11408635 3300025933 Unclassified 572
252 Ga0207686_10144159 3300025934 Bacteria 1650
253 Ga0207670_10059202 3300025936 Bacteria 2605
254 Ga0207669_10034866 3300025937 Bacteria 2856
255 Ga0207669_11146598 3300025937 Bacteria 657
256 Ga0207704_10176237 3300025938 Bacteria 1540
257 Ga0207665_10055422 3300025939 Bacteria 2675
258 Ga0207691_10256059 3300025940 Bacteria 1509
259 Ga0207679_10613759 3300025945 Bacteria 981
260 Ga0207667_10370524 3300025949 Bacteria 1459
261 Ga0207651_10120898 3300025960 Bacteria 1986
262 Ga0207651_10242218 3300025960 Bacteria 1470
263 Ga0207668_10278586 3300025972 Bacteria 1370
264 Ga0207668_10822857 3300025972 Bacteria 823
265 Ga0207668_11561893 3300025972 Unclassified 596
266 Ga0207668_11766452 3300025972 Unclassified 558
267 Ga0207640_10811048 3300025981 Bacteria 811
268 Ga0207658_10017228 3300025986 Bacteria 4977
269 Ga0207658_10222533 3300025986 Bacteria 1589
270 Ga0207658_10341792 3300025986 Bacteria 1301
271 Ga0207658_11819049 3300025986 Bacteria 556
272 Ga0207677_10018198 3300026023 Bacteria 4212
273 Ga0207703_10058957 3300026035 Bacteria 3135
274 Ga0207639_10645888 3300026041 Bacteria 978
275 Ga0207708_10812915 3300026075 Bacteria 805
276 Ga0207702_10055094 3300026078 Bacteria 3372
277 Ga0207641_10009001 3300026088 Bacteria 8249
278 Ga0207641_10433738 3300026088 Bacteria 1267
279 Ga0207648_10162646 3300026089 Bacteria 1971
280 Ga0207648_10546686 3300026089 Unclassified 1063
281 Ga0207648_11075393 3300026089 Unclassified 754
282 Ga0207675_100560427 3300026118 Unclassified 1142
283 Ga0207675_100799120 3300026118 Bacteria 957
284 Ga0207683_10068058 3300026121 Bacteria 3142
285 Ga0207683_10384369 3300026121 Unclassified 1291
286 Ga0268266_10000031 3300028379 Bacteria 406292
287 Ga0268266_10878526 3300028379 Bacteria 867
288 Ga0268264_10032976 3300028381 Bacteria 4251
289 Ga0307511_10008044 3300030521 Bacteria 10571
290 Ga0265327_10000601 3300031251 Bacteria 59701
291 Ga0307408_100011366 3300031548 Bacteria 5881
292 Ga0307408_100014482 3300031548 Bacteria 5239
293 Ga0307408_101205693 3300031548 Bacteria 706
294 Ga0307413_10011716 3300031824 Bacteria 4329
295 Ga0307413_11118596 3300031824 Bacteria 681
296 Ga0307410_10722976 3300031852 Bacteria 841
297 Ga0307406_10000288 3300031901 Bacteria 29585
298 Ga0307412_11463374 3300031911 Unclassified 620
299 Ga0307409_100044726 3300031995 Bacteria 3337
300 Ga0307416_100291384 3300032002 Unclassified 1616
301 Ga0307414_10000034 3300032004 Bacteria 177560
302 Ga0307414_10063820 3300032004 Bacteria 2620
303 Ga0307414_10116843 3300032004 Bacteria 2043
304 Ga0307414_10182365 3300032004 Bacteria 1690
305 Ga0307414_10267463 3300032004 Bacteria 1430
306 Ga0307414_10318153 3300032004 Bacteria 1323
307 Ga0307414_11057676 3300032004 Bacteria 748
308 Ga0373944_0028929 3300035089 Bacteria 1653
309 Ga0373923_0096902 3300035111 Bacteria 1297
310 Ga0373936_0133053 3300035113 Unclassified 1070
311 Ga0373939_0110740 3300035114 Bacteria 956
312 Ga0373941_0516763 3300035115 Bacteria 510
313 Ga0373945_0260071 3300035116 Bacteria 735
314 Ga0373943_0036690 3300035170 Bacteria 2349
315 Ga0373946_0083396 3300035171 Bacteria 1404
316 Ga0373931_0303914 3300035691 Bacteria 986
317 Ga0373931_1163224 3300035691 Unclassified 527
318 Ga0373935_0080036 3300035692 Unclassified 2122
319 Ga0373927_0049718 3300035695 Unclassified 2711
320 Ga0373947_0030694 3300035725 Unclassified 3160
321 Ga0373947_0065208 3300035725 Unclassified 2221
322 Ga0373947_0367116 3300035725 Bacteria 967
323 Ga0373925_0116107 3300037068 Bacteria 2073
324 Ga0373925_0232764 3300037068 Unclassified 1474
325 Ga0373925_1521377 3300037068 Unclassified 547
326 Ga0395899_0149072 3300037312 Bacteria 1659
327 Ga0395900_0009283 3300037418 Bacteria 10085
328 Ga0395900_0551678 3300037418 Bacteria 1097
329 Ga0395898_0199973 3300037466 Bacteria 1908
330 Ga0395905_0272092 3300037471 Bacteria 1580
331 Ga0436364_1057581 3300037853 Unclassified 1666
332 Ga0395901_0300538 3300038443 Bacteria 1664
333 Ga0436365_1382701 3300039437 Bacteria 65037
334 Ga0436360_0142197 3300039438 Unclassified 886
335 Ga0436360_0532675 3300039438 Unclassified 538
336 Ga0436360_0660916 3300039438 Bacteria 2349
337 Ga0436360_0717428 3300039438 Bacteria 3912
338 Ga0436360_0781234 3300039438 Unclassified 3094
339 Ga0436361_0029411 3300039447 Bacteria 2075
340 Ga0436361_0050147 3300039447 Bacteria 3306
341 Ga0436361_0113295 3300039447 Bacteria 2120
342 Ga0436361_0137827 3300039447 Bacteria 7746
343 Ga0436361_0410291 3300039447 Unclassified 2036
344 Ga0436362_1013061 3300039453 Bacteria 1216
345 Ga0436362_1241409 3300039453 Unclassified 937
346 Ga0450898_147162 3300042134 Unclassified 514
347 Ga0495580_0189680 3300046472 Bacteria 1418
348 Ga0495580_0776407 3300046472 Unclassified 623
349 Ga0495584_0021999 3300046491 Bacteria 3237
350 Ga0495585_0071238 3300046492 Bacteria 1895
351 Ga0495598_0003293 3300046537 Bacteria 3416
352 Ga0495659_0004983 3300046664 Bacteria 4177
353 Ga0495588_0703027 3300046674 Bacteria 529
354 Ga0495588_0755773 3300046674 Bacteria 508
355 Ga0495658_0045777 3300046683 Bacteria 2457
356 Ga0495669_0012613 3300046684 Bacteria 3599
357 Ga0496100_0037107 3300048903 Bacteria 3078
358 Ga0496101_0000817 3300048904 Bacteria 18362
359 Ga0496101_0184951 3300048904 Bacteria 1606
360 Ga0496102_0013263 3300048905 Bacteria 7134
361 Ga0496103_0001756 3300048906 Bacteria 14140
362 Ga0496104_0023267 3300048907 Bacteria 5696
363 Ga0496105_0285249 3300048908 Bacteria 1330
364 Ga0496106_0002779 3300048909 Bacteria 12970
365 Ga0496106_0200039 3300048909 Bacteria 1590
366 Ga0496107_0002115 3300048910 Bacteria 12725
367 Ga0496108_0130297 3300048911 Bacteria 2162
368 Ga0496109_0008530 3300048912 Bacteria 8715
369 Ga0496110_0108545 3300048913 Bacteria 2492
370 Ga0496111_0160008 3300048914 Bacteria 1672
371 Ga0496111_1211674 3300048914 Bacteria 535
372 Ga0496112_0037671 3300048915 Bacteria 4720
373 Ga0496112_1757279 3300048915 Bacteria 532
374 Ga0496113_0403685 3300048916 Bacteria 1097
375 Ga0496113_0613079 3300048916 Bacteria 871
376 Ga0496114_0097571 3300048917 Bacteria 2503
377 Ga0496115_0006858 3300048918 Bacteria 8362
378 Ga0496121_0133352 3300048924 Bacteria 1854
379 Ga0496125_0336860 3300048928 Bacteria 907
380 Ga0501034_0892538 3300049571 Bacteria 777
381 Ga0501073_0247806 3300049589 Unclassified 1230
382 Ga0501216_125170 3300049660 Unclassified 591
383 Ga0501217_102196 3300049661 Bacteria 815
384 Ga0501223_020790 3300049663 Bacteria 1285
385 Ga0501227_000038 3300049665 Bacteria 19215
386 Ga0501238_019317 3300049671 Unclassified 957
387 Ga0501257_192020 3300049686 Unclassified 583
388 Ga0501225_0348155 3300049705 Unclassified 512
389 Ga0501080_0017439 3300049742 Bacteria 6640
390 Ga0501083_0033008 3300049744 Bacteria 3546
391 nmdc:mga08y16_1287079_c1 3300050511 Bacteria 698
392 nmdc:mga08y16_1595964_c1 3300050511 Bacteria 610
393 nmdc:mga0n895_625413_c1 3300050512 Bacteria 1077
394 nmdc:mga0rr50_815294_c1 3300050513 Bacteria 796
395 nmdc:mga08x19_1252516_c1 3300050514 Unclassified 525
396 Ga0495655_0004107 3300053083 Bacteria 2466
397 Ga0500559_0000703 3300053136 Bacteria 21985
398 Ga0500616_0137800 3300053153 Bacteria 1144
399 Ga0500645_125941 3300053730 Unclassified 713
400 Ga0207665_10402963
401 SwRhRL2b_contig_1140804
402 CNXas_1002250
403 JGI24738J21930_10098202
404 JGI24744J21845_10033594
405 JGI24034J26672_10047734
406 JGI24742J22300_10047027
407 rootH2_10288176
408 rootH1_10342336
409 Ga0065704_10008070
410 Ga0065704_10031406
411 Ga0065704_10084492
412 Ga0065715_10000369
413 Ga0065715_10298100
414 Ga0065715_10347753
415 Ga0065707_10005435
416 Ga0065707_10023581
417 Ga0070676_10013841
418 Ga0070676_10015307
419 Ga0070690_100008714
420 Ga0070690_100500400
421 Ga0070670_100428185
422 Ga0070677_10827426
423 Ga0068869_100529953
424 Ga0070666_10034904
425 Ga0070666_10443965
426 Ga0070666_11123549
427 Ga0070680_100935565
428 Ga0068868_100067989
429 Ga0068868_100996990
430 Ga0068868_101250578
431 Ga0070660_100113581
432 Ga0070660_101372664
433 Ga0070689_101044122
434 Ga0070689_101461374
435 Ga0070691_10364100
436 Ga0070687_100045016
437 Ga0070668_100001187
438 Ga0070668_100056530
439 Ga0070668_101222004
440 Ga0070668_101507238
441 Ga0070668_102266401
442 Ga0070669_100025156
443 Ga0070669_100028087
444 Ga0070669_100326123
445 Ga0070675_100005404
446 Ga0070675_100812820
447 Ga0070671_100275997
448 Ga0070674_100003179
449 Ga0070673_100056773
450 Ga0070673_100277925
451 Ga0070688_100114636
452 Ga0070688_100193341
453 Ga0070667_100011264
454 Ga0070667_100241735
455 Ga0070667_100372267
456 Ga0070667_100544960
457 Ga0070709_10053596
458 Ga0070709_10115929
459 Ga0070709_10246015
460 Ga0070709_10314576
461 Ga0070714_100070423
462 Ga0070713_100095774
463 Ga0070713_100168959
464 Ga0070710_10181770
465 Ga0070701_10672760
466 Ga0070705_100088154
467 Ga0070705_101615327
468 Ga0070700_100104419
469 Ga0070700_100349121
470 Ga0070694_100940799
471 Ga0070708_100341250
472 Ga0070708_101125237
473 Ga0070663_100714547
474 Ga0070678_100073822
475 Ga0070678_100317278
476 Ga0070678_100384563
477 Ga0070662_100020598
478 Ga0070662_100068909
479 Ga0070662_100075337
480 Ga0070662_100517324
481 Ga0070681_10551701
482 Ga0068867_100393845
483 Ga0068867_100666779
484 Ga0068867_100798626
485 Ga0070706_100000011
486 Ga0070706_100002679
487 Ga0070706_100076772
488 Ga0070706_100616541
489 Ga0070707_101240409
490 Ga0070707_101983053
491 Ga0070698_100046517
492 Ga0070697_100006699
493 Ga0070697_100103779
494 Ga0070697_100304325
495 Ga0068853_100755136
496 Ga0070672_100000553
497 Ga0070672_101182573
498 Ga0070695_100526737
499 Ga0070696_100050231
500 Ga0070696_100668240
501 Ga0070693_100186187
502 Ga0070693_101061852
503 Ga0070665_100000030
504 Ga0070704_100435884
505 Ga0070704_100519454
506 Ga0070704_101445470
507 Ga0068855_100523660
508 Ga0070664_100773687
509 Ga0068854_100231001
510 Ga0068856_100028874
511 Ga0068852_100324920
512 Ga0068852_101665518
513 Ga0068852_101728638
514 Ga0068859_100461616
515 Ga0068859_100948049
516 Ga0068864_100605433
517 Ga0068864_101659563
518 Ga0068866_10270970
519 Ga0068866_11302979
520 Ga0068861_101184728
521 Ga0068861_101377239
522 Ga0068851_11046131
523 Ga0068863_100013116
524 Ga0068863_100157320
525 Ga0068858_100047217
526 Ga0068858_100250770
527 Ga0068860_100145315
528 Ga0068860_100865756
529 Ga0068862_101866067
530 Ga0070717_10000633
531 Ga0070717_10393981
532 Ga0075363_100493891
533 Ga0070715_10017833
534 Ga0070716_100026076
535 Ga0070716_100150402
536 Ga0070716_100377353
537 Ga0070716_100570576
538 Ga0070712_100309737
539 Ga0068871_100347047
540 Ga0068871_101539484
541 Ga0068871_101678545
542 Ga0075431_100034686
543 Ga0075434_100116346
544 Ga0075434_100999423
545 Ga0068865_100011827
546 Ga0075436_100254596
547 Ga0097620_100461636
548 Ga0097620_100948005
549 Ga0075435_101360905
550 Ga0105240_10005308
551 Ga0105240_10304051
552 Ga0111539_11361415
553 Ga0105245_10264625
554 Ga0105245_10482499
555 Ga0105247_10083460
556 Ga0114129_11406059
557 Ga0114129_11507809
558 Ga0105243_12553019
559 Ga0105242_10302442
560 Ga0105242_11496291
561 Ga0105248_11788705
562 Ga0105237_10005104
563 Ga0105237_10841309
564 Ga0105249_13270101
565 Ga0099796_10035109
566 Ga0105239_10062922
567 Ga0105239_11662434
568 Ga0105246_10984520
569 Ga0157344_1000664
570 Ga0157326_1073721
571 Ga0157373_10488840
572 Ga0157371_10237099
573 Ga0157369_10973293
574 Ga0157374_10240806
575 Ga0157374_10363047
576 Ga0157374_10473342
577 Ga0157378_10015440
578 Ga0157378_10169478
579 Ga0157378_10222372
580 Ga0157378_10604893
581 Ga0157378_10934855
582 Ga0157378_11520329
583 Ga0163162_10007939
584 Ga0163162_10084820
585 Ga0163162_10529193
586 Ga0163162_11182756
587 Ga0163162_11354839
588 Ga0163162_11966508
589 Ga0157372_10027683
590 Ga0157372_10101807
591 Ga0157372_10193402
592 Ga0157375_10038584
593 Ga0157375_10183457
594 Ga0157375_10422102
595 Ga0157375_10449456
596 Ga0163163_12201200
597 Ga0157377_10148824
598 Ga0157376_12362452
599 Ga0163161_10002741
600 Ga0163161_10159987
601 Ga0163161_10817986
602 Ga0163161_11177238
603 Ga0163161_11438849
604 Ga0213872_10074178
605 Ga0213872_10180219
606 Ga0213872_10236977
607 Ga0213876_10014314
608 Ga0213871_10001973
609 Ga0207666_1001802
610 Ga0207673_1007886
611 Ga0207697_10000999
612 Ga0207697_10018306
613 Ga0207682_10062630
614 Ga0207692_10146489
615 Ga0207692_10641640
616 Ga0207688_10003699
617 Ga0207680_10016654
618 Ga0207685_10311048
619 Ga0207699_10092448
620 Ga0207699_10278642
621 Ga0207699_10282161
622 Ga0207645_10008726
623 Ga0207645_10081832
624 Ga0207645_10177573
625 Ga0207684_10000052
626 Ga0207684_11424386
627 Ga0207695_10010694
628 Ga0207671_10025248
629 Ga0207693_10000989
630 Ga0207693_10598409
631 Ga0207663_10001511
632 Ga0207663_11101240
633 Ga0207662_10054344
634 Ga0207657_10128473
635 Ga0207657_11431229
636 Ga0207681_10011487
637 Ga0207681_10330480
638 Ga0207681_10514619
639 Ga0207650_10073650
640 Ga0207659_10005327
641 Ga0207687_10814311
642 Ga0207687_10824403
643 Ga0207700_10068786
644 Ga0207664_10283826
645 Ga0207644_10061224
646 Ga0207644_10124538
647 Ga0207706_10025642
648 Ga0207706_10035056
649 Ga0207706_10160915
650 Ga0207706_11408635
651 Ga0207686_10144159
652 Ga0207670_10059202
653 Ga0207669_10034866
654 Ga0207669_11146598
655 Ga0207704_10176237
656 Ga0207665_10055422
657 Ga0207691_10256059
658 Ga0207679_10613759
659 Ga0207667_10370524
660 Ga0207651_10120898
661 Ga0207651_10242218
662 Ga0207668_10278586
663 Ga0207668_10822857
664 Ga0207668_11561893
665 Ga0207668_11766452
666 Ga0207640_10811048
667 Ga0207658_10017228
668 Ga0207658_10222533
669 Ga0207658_10341792
670 Ga0207658_11819049
671 Ga0207677_10018198
672 Ga0207703_10058957
673 Ga0207639_10645888
674 Ga0207708_10812915
675 Ga0207702_10055094
676 Ga0207641_10009001
677 Ga0207641_10433738
678 Ga0207648_10162646
679 Ga0207648_10546686
680 Ga0207648_11075393
681 Ga0207675_100560427
682 Ga0207675_100799120
683 Ga0207683_10068058
684 Ga0207683_10384369
685 Ga0268266_10000031
686 Ga0268266_10878526
687 Ga0268264_10032976
688 Ga0307511_10008044
689 Ga0265327_10000601
690 Ga0307408_100011366
691 Ga0307408_100014482
692 Ga0307408_101205693
693 Ga0307413_10011716
694 Ga0307413_11118596
695 Ga0307410_10722976
696 Ga0307406_10000288
697 Ga0307412_11463374
698 Ga0307409_100044726
699 Ga0307416_100291384
700 Ga0307414_10000034
701 Ga0307414_10063820
702 Ga0307414_10116843
703 Ga0307414_10182365
704 Ga0307414_10267463
705 Ga0307414_10318153
706 Ga0307414_11057676
707 Ga0373944_0028929
708 Ga0373923_0096902
709 Ga0373936_0133053
710 Ga0373939_0110740
711 Ga0373941_0516763
712 Ga0373945_0260071
713 Ga0373943_0036690
714 Ga0373946_0083396
715 Ga0373931_0303914
716 Ga0373931_1163224
717 Ga0373935_0080036
718 Ga0373927_0049718
719 Ga0373947_0030694
720 Ga0373947_0065208
721 Ga0373947_0367116
722 Ga0373925_0116107
723 Ga0373925_0232764
724 Ga0373925_1521377
725 Ga0395899_0149072
726 Ga0395900_0009283
727 Ga0395900_0551678
728 Ga0395898_0199973
729 Ga0395905_0272092
730 Ga0436364_1057581
731 Ga0395901_0300538
732 Ga0436365_1382701
733 Ga0436360_0142197
734 Ga0436360_0532675
735 Ga0436360_0660916
736 Ga0436360_0717428
737 Ga0436360_0781234
738 Ga0436361_0029411
739 Ga0436361_0050147
740 Ga0436361_0113295
741 Ga0436361_0137827
742 Ga0436361_0410291
743 Ga0436362_1013061
744 Ga0436362_1241409
745 Ga0450898_147162
746 Ga0495580_0189680
747 Ga0495580_0776407
748 Ga0495584_0021999
749 Ga0495585_0071238
750 Ga0495598_0003293
751 Ga0495659_0004983
752 Ga0495588_0703027
753 Ga0495588_0755773
754 Ga0495658_0045777
755 Ga0495669_0012613
756 Ga0496100_0037107
757 Ga0496101_0000817
758 Ga0496101_0184951
759 Ga0496102_0013263
760 Ga0496103_0001756
761 Ga0496104_0023267
762 Ga0496105_0285249
763 Ga0496106_0002779
764 Ga0496106_0200039
765 Ga0496107_0002115
766 Ga0496108_0130297
767 Ga0496109_0008530
768 Ga0496110_0108545
769 Ga0496111_0160008
770 Ga0496111_1211674
771 Ga0496112_0037671
772 Ga0496112_1757279
773 Ga0496113_0403685
774 Ga0496113_0613079
775 Ga0496114_0097571
776 Ga0496115_0006858
777 Ga0496121_0133352
778 Ga0496125_0336860
779 Ga0501034_0892538
780 Ga0501073_0247806
781 Ga0501216_125170
782 Ga0501217_102196
783 Ga0501223_020790
784 Ga0501227_000038
785 Ga0501238_019317
786 Ga0501257_192020
787 Ga0501225_0348155
788 Ga0501080_0017439
789 Ga0501083_0033008
790 nmdc:mga08y16_1287079_c1
791 nmdc:mga08y16_1595964_c1
792 nmdc:mga0n895_625413_c1
793 nmdc:mga0rr50_815294_c1
794 nmdc:mga08x19_1252516_c1
795 Ga0495655_0004107
796 Ga0500559_0000703
797 Ga0500616_0137800
798 Ga0500645_125941

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13601

HTH_34

Winged helix DNA-binding domain

16

93

0.99

PF01022

HTH_5

Bacterial regulatory protein, arsR family

13

60

0.93

PF01638

HxlR

HxlR-like helix-turn-helix

10

100

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ub9-assembly1.cif.gz_A-2 structure of the transcriptional regulator homologue protein from pyrococcus horikoshii ot3 0.9594 8 96
3bdd-assembly1.cif.gz_B crystal structure of a putative multiple antibiotic-resistance repressor (ssu05_1136) from streptococcus suis 89/1591 at 2.20 a resolution 0.9058 9 83
2p4w-assembly1.cif.gz_A crystal structure of heat shock regulator from pyrococcus furiosus 0.8954 10 77
6c2s-assembly2.cif.gz_C transcriptional repressor, cour, bound to a 23-mer dna duplex 0.8942 14 92
1z7u-assembly1.cif.gz_B crystal structure of the putitive transcriptional regulator of marr family from enterococcus faecalis v583 0.8761 10 98
ID Description Score Start End Superfamily
1ub9A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9594 8 96 1.10.10.10
af_P71699_45_188_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9297 13 97 1.10.10.10
af_Q4DKK4_1_75_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9207 15 78 1.10.10.10
af_Q58948_3_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9195 11 93 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9014 9 78 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6L7X213-F1-model_v4 Helix-turn-helix domain-containing protein 0.9806 7 96
AF-A0A1W1W285-F1-model_v4 Transcriptional regulator 0.9789 6 96
AF-A0A1V0U117-F1-model_v4 MarR family transcriptional regulator 0.9775 6 95
AF-A0A1I0YRB3-F1-model_v4 DNA-binding transcriptional regulator, MarR family 0.9773 7 96 GO:0003677
AF-A0A6B0WKP2-F1-model_v4 Helix-turn-helix domain-containing protein 0.9769 11 96

Map