F434285

General Info

Members Datasets Scaffolds Average Seq Length
399 282 798 433

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10126239|Ga0105249_101262392
Length 435
Sequence MSIDLGKAAKDRGIEYFLISYVDLFGTMRAKLVPAAAIAEMQKAGAGFAGFATWLDMTPADSDLFAVPDPDSLIQLPWKPEVGWVAANLVMDGKAVEQAPRFVLKRAIADAAKDGFEMRHGVECEYFIIRPDGESIADGADTQSKPCYDQSALMRRYDLIKEISDAMLGLGWGAYQTDHEDANGQFEMNWSFADALTTADRHAFFKYMVKSLAEKHGLRATFMPKPFANLTGNGCHAHVSLWGGKRKANLFHDPKGELGISGLGYNFIGGLMHNAEGMTAITNPTVNSYKRINAPPTLSGATWSPNTITYAGNNRTHMIRIPDAGRFEFRLADGAANPYLLPAAILVAGLDGIRNQRDPGKRLDINMYTDGDKAKGARRLPLNLLDALRAFEASPVMRAGLGEDFTGAYAKLRHGEWNGYARHLTDWERQTTLDC

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
92 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
93 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
94 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
95 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
96 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
147 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
148 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
149 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
150 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
151 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
152 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
153 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
156 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
157 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
162 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
172 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
182 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
187 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
188 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
189 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
206 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
246 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
247 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
248 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
249 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
250 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
251 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
252 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
253 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
254 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
255 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
256 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
257 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
258 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
259 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
260 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
261 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
262 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
263 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
264 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
265 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
266 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
267 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
268 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
269 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
271 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
272 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
273 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
274 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
275 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
276 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
277 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
278 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
279 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
280 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
281 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
282 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.99
Metatranscriptomes 0
Isolates 3.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.52
Nodule 1.75
Rhizoplane 2.01
Rhizosphere 81.2
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10126239 3300009553 Bacteria 2437
2 JGI24752J21851_1000189 3300001976 Bacteria 8563
3 JGI24739J22299_10008662 3300001989 Bacteria 3796
4 JGI24735J21928_10005028 3300002067 Bacteria 4401
5 JGI24750J21931_1000030 3300002070 Bacteria 18829
6 JGI24748J21848_1000067 3300002074 Bacteria 38412
7 JGI24738J21930_10002794 3300002075 Bacteria 4479
8 JGI24034J26672_10000025 3300002239 Bacteria 110791
9 JGI25160J50197_1000560 3300003354 Bacteria 21094
10 Ga0065165_1003664 3300005262 Bacteria 10485
11 Ga0065707_10097585 3300005295 Bacteria 3161
12 Ga0070690_100003903 3300005330 Bacteria 8223
13 Ga0070690_100094259 3300005330 Bacteria 1975
14 Ga0070670_100000072 3300005331 Bacteria 102029
15 Ga0070666_10000053 3300005335 Bacteria 97883
16 Ga0070666_10012709 3300005335 Bacteria 5320
17 Ga0070682_100001064 3300005337 Bacteria 15818
18 Ga0068868_100008324 3300005338 Bacteria 7423
19 Ga0070689_100003428 3300005340 Bacteria 10548
20 Ga0070689_100012104 3300005340 Bacteria 6203
21 Ga0070661_100002478 3300005344 Bacteria 12649
22 Ga0070668_100000935 3300005347 Bacteria 20348
23 Ga0070668_100000942 3300005347 Bacteria 20272
24 Ga0070668_100024367 3300005347 Bacteria 4584
25 Ga0070669_100000100 3300005353 Bacteria 84206
26 Ga0070671_100000239 3300005355 Bacteria 36959
27 Ga0070674_100002649 3300005356 Bacteria 9911
28 Ga0070673_100042953 3300005364 Bacteria 3489
29 Ga0070688_100001307 3300005365 Bacteria 12419
30 Ga0070659_100014855 3300005366 Bacteria 5822
31 Ga0070667_100001999 3300005367 Bacteria 18068
32 Ga0070667_100008054 3300005367 Bacteria 8742
33 Ga0070709_10001427 3300005434 Bacteria 12923
34 Ga0070714_100002074 3300005435 Bacteria 14673
35 Ga0070714_100066876 3300005435 Bacteria 3098
36 Ga0070713_100002059 3300005436 Bacteria 12996
37 Ga0070713_100003052 3300005436 Bacteria 11001
38 Ga0070710_10005097 3300005437 Bacteria 6216
39 Ga0070700_100041208 3300005441 Bacteria 2830
40 Ga0070678_100009961 3300005456 Bacteria 5781
41 Ga0070685_10002274 3300005466 Bacteria 9903
42 Ga0070685_10109145 3300005466 Bacteria 1702
43 Ga0070707_100245323 3300005468 Bacteria 1743
44 Ga0070684_100005577 3300005535 Bacteria 9665
45 Ga0070697_100021216 3300005536 Bacteria 5146
46 Ga0070672_100024467 3300005543 Bacteria 4464
47 Ga0070686_100000050 3300005544 Bacteria 97879
48 Ga0070686_100092299 3300005544 Bacteria 2027
49 Ga0070693_100004619 3300005547 Bacteria 6536
50 Ga0070665_100000004 3300005548 Bacteria 785500
51 Ga0070665_100001714 3300005548 Bacteria 25147
52 Ga0070665_100011999 3300005548 Bacteria 8745
53 Ga0070665_100039032 3300005548 Bacteria 4775
54 Ga0070665_100044394 3300005548 Bacteria 4463
55 Ga0070704_100155022 3300005549 Bacteria 1805
56 Ga0068855_100006193 3300005563 Bacteria 14587
57 Ga0068855_100241049 3300005563 Bacteria 2020
58 Ga0070664_100002290 3300005564 Bacteria 15389
59 Ga0070664_100086136 3300005564 Bacteria 2714
60 Ga0068857_100034368 3300005577 Bacteria 4485
61 Ga0068854_100001117 3300005578 Bacteria 16124
62 Ga0068854_100039552 3300005578 Bacteria 3323
63 Ga0070702_100001894 3300005615 Bacteria 8770
64 Ga0068852_100004303 3300005616 Bacteria 10050
65 Ga0068859_100048182 3300005617 Bacteria 4281
66 Ga0068864_100000019 3300005618 Bacteria 271650
67 Ga0068864_100012896 3300005618 Bacteria 6915
68 Ga0068864_100217240 3300005618 Bacteria 1762
69 Ga0068866_10002201 3300005718 Bacteria 8119
70 Ga0068861_100002603 3300005719 Bacteria 11807
71 Ga0068861_100015396 3300005719 Bacteria 5388
72 Ga0068851_10050083 3300005834 Bacteria 2120
73 Ga0068870_10144759 3300005840 Bacteria 1394
74 Ga0068863_100000010 3300005841 Bacteria 237758
75 Ga0068863_100000011 3300005841 Bacteria 232287
76 Ga0068863_100000104 3300005841 Bacteria 90766
77 Ga0068863_100003211 3300005841 Bacteria 16180
78 Ga0068858_100001824 3300005842 Bacteria 21680
79 Ga0068858_100006848 3300005842 Bacteria 11077
80 Ga0068860_100000189 3300005843 Bacteria 97880
81 Ga0068862_100000279 3300005844 Bacteria 56941
82 Ga0068862_100001374 3300005844 Bacteria 22607
83 Ga0068862_100001966 3300005844 Bacteria 18637
84 Ga0068862_100077297 3300005844 Bacteria 2882
85 Ga0068862_100272727 3300005844 Bacteria 1548
86 Ga0081455_10001362 3300005937 Bacteria 30193
87 Ga0081455_10007439 3300005937 Bacteria 11537
88 Ga0081455_10126281 3300005937 Bacteria 2007
89 Ga0081540_1037312 3300005983 Bacteria 2578
90 Ga0070717_10062678 3300006028 Bacteria 3084
91 Ga0070712_100002801 3300006175 Bacteria 10779
92 Ga0075428_100065482 3300006844 Bacteria 3980
93 Ga0075434_100095209 3300006871 Bacteria 2983
94 Ga0075436_100056757 3300006914 Bacteria 2704
95 Ga0075436_100068291 3300006914 Bacteria 2455
96 Ga0097620_100048182 3300006931 Bacteria 4281
97 Ga0075435_100010462 3300007076 Bacteria 6788
98 Ga0105250_10010144 3300009092 Bacteria 3932
99 Ga0105240_10001983 3300009093 Bacteria 33814
100 Ga0105240_10123450 3300009093 Bacteria 3116
101 Ga0111539_10029086 3300009094 Bacteria 6737
102 Ga0105245_10005880 3300009098 Bacteria 10777
103 Ga0105247_10004771 3300009101 Bacteria 8634
104 Ga0105247_10014830 3300009101 Bacteria 4671
105 Ga0105243_10005612 3300009148 Bacteria 9774
106 Ga0105241_10015170 3300009174 Bacteria 5643
107 Ga0105248_10000014 3300009177 Bacteria 324729
108 Ga0105248_10041611 3300009177 Bacteria 5152
109 Ga0105248_10049567 3300009177 Bacteria 4710
110 Ga0105237_10012132 3300009545 Bacteria 9091
111 Ga0105238_10004508 3300009551 Bacteria 13805
112 Ga0105238_10045308 3300009551 Bacteria 4443
113 Ga0105238_10135882 3300009551 Bacteria 2436
114 Ga0105249_10000048 3300009553 Bacteria 172137
115 Ga0105249_10000157 3300009553 Bacteria 83216
116 Ga0105249_10007404 3300009553 Bacteria 9575
117 Ga0105249_10020104 3300009553 Bacteria 5965
118 Ga0105239_10027244 3300010375 Bacteria 6291
119 Ga0105239_10054171 3300010375 Bacteria 4399
120 Ga0105246_10004020 3300011119 Bacteria 8930
121 Ga0105246_10020110 3300011119 Bacteria 4279
122 Ga0157373_10040513 3300013100 Bacteria 3333
123 Ga0157371_10010960 3300013102 Bacteria 7026
124 Ga0157369_10002335 3300013105 Bacteria 22829
125 Ga0157378_10009883 3300013297 Bacteria 8315
126 Ga0163162_10021585 3300013306 Bacteria 6343
127 Ga0157372_10002908 3300013307 Bacteria 18528
128 Ga0157375_10028191 3300013308 Bacteria 5259
129 Ga0157380_10000063 3300014326 Bacteria 61666
130 Ga0157380_10000282 3300014326 Bacteria 30559
131 Ga0157377_10042062 3300014745 Bacteria 2537
132 Ga0157379_10016222 3300014968 Bacteria 6554
133 Ga0157379_10058064 3300014968 Bacteria 3459
134 Ga0157379_10102433 3300014968 Bacteria 2570
135 Ga0157376_10016797 3300014969 Bacteria 5567
136 Ga0163161_10000020 3300017792 Bacteria 214642
137 Ga0163161_10008856 3300017792 Bacteria 6958
138 Ga0163161_10134333 3300017792 Bacteria 1869
139 Ga0214544_1000013 3300021320 Bacteria 228947
140 Ga0214542_1000013 3300021321 Bacteria 234019
141 Ga0214545_1000012 3300021324 Bacteria 187898
142 Ga0214543_1000065 3300021327 Bacteria 126516
143 Ga0213871_10021842 3300021441 Bacteria 1599
144 Ga0209677_102470 3300025253 Bacteria 6920
145 Ga0207426_1004145 3300025302 Bacteria 7264
146 Ga0207426_1005040 3300025302 Bacteria 6191
147 Ga0207697_10056532 3300025315 Bacteria 1628
148 Ga0207692_10018793 3300025898 Bacteria 3110
149 Ga0207688_10012254 3300025901 Bacteria 4664
150 Ga0207688_10055289 3300025901 Bacteria 2228
151 Ga0207680_10000017 3300025903 Bacteria 97899
152 Ga0207680_10013702 3300025903 Bacteria 4172
153 Ga0207647_10002850 3300025904 Bacteria 13031
154 Ga0207654_10022624 3300025911 Bacteria 3356
155 Ga0207695_10010826 3300025913 Bacteria 11114
156 Ga0207695_10036588 3300025913 Bacteria 5306
157 Ga0207695_10171646 3300025913 Bacteria 2094
158 Ga0207671_10015540 3300025914 Bacteria 5954
159 Ga0207671_10046897 3300025914 Bacteria 3197
160 Ga0207671_10051480 3300025914 Bacteria 3052
161 Ga0207671_10128955 3300025914 Bacteria 1940
162 Ga0207693_10001289 3300025915 Bacteria 22285
163 Ga0207663_10011493 3300025916 Bacteria 4753
164 Ga0207662_10010534 3300025918 Bacteria 5109
165 Ga0207657_10000034 3300025919 Bacteria 127192
166 Ga0207657_10113605 3300025919 Bacteria 2234
167 Ga0207649_10024961 3300025920 Bacteria 3479
168 Ga0207646_10251638 3300025922 Bacteria 1596
169 Ga0207681_10000374 3300025923 Bacteria 31669
170 Ga0207681_10004492 3300025923 Bacteria 8590
171 Ga0207694_10006528 3300025924 Bacteria 8872
172 Ga0207694_10182414 3300025924 Bacteria 1702
173 Ga0207650_10000116 3300025925 Bacteria 104652
174 Ga0207650_10132311 3300025925 Bacteria 1953
175 Ga0207659_10061905 3300025926 Bacteria 2699
176 Ga0207687_10071642 3300025927 Bacteria 2477
177 Ga0207700_10095724 3300025928 Bacteria 2356
178 Ga0207664_10293982 3300025929 Bacteria 1428
179 Ga0207644_10000010 3300025931 Bacteria 226989
180 Ga0207644_10011854 3300025931 Bacteria 5775
181 Ga0207706_10004333 3300025933 Bacteria 13322
182 Ga0207706_10015735 3300025933 Bacteria 6838
183 Ga0207686_10011328 3300025934 Bacteria 4880
184 Ga0207670_10003902 3300025936 Bacteria 7956
185 Ga0207670_10009103 3300025936 Bacteria 5643
186 Ga0207669_10004759 3300025937 Bacteria 6014
187 Ga0207691_10006606 3300025940 Bacteria 11194
188 Ga0207711_10000021 3300025941 Bacteria 355952
189 Ga0207711_10006350 3300025941 Bacteria 9969
190 Ga0207711_10017795 3300025941 Bacteria 5904
191 Ga0207679_10013237 3300025945 Bacteria 5405
192 Ga0207651_10030259 3300025960 Bacteria 3444
193 Ga0207712_10000099 3300025961 Bacteria 97890
194 Ga0207712_10000148 3300025961 Bacteria 72568
195 Ga0207712_10005787 3300025961 Bacteria 7789
196 Ga0207712_10053849 3300025961 Bacteria 2825
197 Ga0207668_10004757 3300025972 Bacteria 7989
198 Ga0207658_10001242 3300025986 Bacteria 20146
199 Ga0207677_10007378 3300026023 Bacteria 6078
200 Ga0207703_10009994 3300026035 Bacteria 7444
201 Ga0207678_10001569 3300026067 Bacteria 21013
202 Ga0207708_10006529 3300026075 Bacteria 8632
203 Ga0207702_10020342 3300026078 Bacteria 5497
204 Ga0207702_10024675 3300026078 Bacteria 4989
205 Ga0207641_10000008 3300026088 Bacteria 424415
206 Ga0207641_10000028 3300026088 Bacteria 232451
207 Ga0207641_10001657 3300026088 Bacteria 21742
208 Ga0207676_10000019 3300026095 Bacteria 305653
209 Ga0207676_10007143 3300026095 Bacteria 7909
210 Ga0207676_10202864 3300026095 Bacteria 1754
211 Ga0207674_10004245 3300026116 Bacteria 17290
212 Ga0207674_10011503 3300026116 Bacteria 9940
213 Ga0207674_10071090 3300026116 Bacteria 3497
214 Ga0207674_10229968 3300026116 Bacteria 1802
215 Ga0207675_100000129 3300026118 Bacteria 63140
216 Ga0207675_100012958 3300026118 Bacteria 7786
217 Ga0207683_10002259 3300026121 Bacteria 16891
218 Ga0207698_10157649 3300026142 Bacteria 1980
219 Ga0207428_10016396 3300027907 Bacteria 6374
220 Ga0207428_10023709 3300027907 Bacteria 5155
221 Ga0268266_10000009 3300028379 Bacteria 1097737
222 Ga0268266_10009762 3300028379 Bacteria 8442
223 Ga0268266_10027025 3300028379 Bacteria 4883
224 Ga0268266_10041103 3300028379 Bacteria 3943
225 Ga0268265_10000011 3300028380 Bacteria 343832
226 Ga0268265_10000187 3300028380 Bacteria 73568
227 Ga0268265_10001519 3300028380 Bacteria 19349
228 Ga0268265_10041343 3300028380 Bacteria 3411
229 Ga0268265_10064867 3300028380 Bacteria 2815
230 Ga0268264_10000023 3300028381 Bacteria 471408
231 Ga0268264_10040079 3300028381 Bacteria 3870
232 Ga0265337_1003558 3300028556 Bacteria 6715
233 Ga0265326_10000685 3300028558 Bacteria 12555
234 Ga0265319_1003983 3300028563 Bacteria 7493
235 Ga0265334_10003145 3300028573 Bacteria 7535
236 Ga0265318_10001893 3300028577 Bacteria 11737
237 Ga0265323_10000541 3300028653 Bacteria 20951
238 Ga0265322_10004212 3300028654 Bacteria 4306
239 Ga0265336_10000107 3300028666 Bacteria 63528
240 Ga0265338_10000161 3300028800 Bacteria 122364
241 Ga0265324_10000449 3300029957 Bacteria 29197
242 Ga0265330_10026457 3300031235 Bacteria 2624
243 Ga0265342_10056243 3300031712 Bacteria 2332
244 Ga0307405_10047287 3300031731 Bacteria 2648
245 Ga0307406_10105047 3300031901 Bacteria 1932
246 Ga0307412_10128877 3300031911 Bacteria 1834
247 Ga0307510_10039840 3300033180 Bacteria 5169
248 Ga0373957_0007035 3300035120 Bacteria 3579
249 Ga0373937_0007641 3300036401 Bacteria 9367
250 Ga0395900_0055971 3300037418 Bacteria 4060
251 Ga0395905_0005845 3300037471 Bacteria 12505
252 Ga0395901_0167965 3300038443 Bacteria 2302
253 Ga0400483_121504 3300039062 Bacteria 1847
254 Ga0400483_244768 3300039062 Bacteria 4060
255 Ga0436365_1451888 3300039437 Bacteria 2405
256 Ga0436360_0012923 3300039438 Bacteria 2037
257 Ga0436363_1353628 3300039450 Bacteria 5697
258 Ga0439453_0012673 3300041408 Bacteria 1423
259 Ga0495603_0049030 3300046455 Bacteria 2514
260 Ga0495629_0049089 3300046459 Bacteria 2959
261 Ga0495651_0058643 3300046462 Bacteria 2953
262 Ga0495651_0115444 3300046462 Bacteria 1979
263 Ga0495580_0037491 3300046472 Bacteria 3479
264 Ga0495664_0045931 3300046477 Bacteria 2591
265 Ga0495664_0048399 3300046477 Bacteria 2524
266 Ga0495594_0052004 3300046499 Bacteria 2255
267 Ga0495608_0007145 3300046511 Bacteria 7899
268 Ga0495608_0049787 3300046511 Bacteria 2781
269 Ga0495618_0006857 3300046514 Bacteria 6903
270 Ga0495628_0019626 3300046516 Bacteria 5584
271 Ga0495643_0014952 3300046522 Bacteria 4602
272 Ga0495643_0031847 3300046522 Bacteria 2931
273 Ga0495648_0027761 3300046524 Bacteria 3783
274 Ga0495652_0081222 3300046529 Bacteria 2674
275 Ga0495640_0022782 3300046533 Bacteria 4574
276 Ga0495587_0009075 3300046536 Bacteria 6382
277 Ga0495621_0011421 3300046539 Bacteria 2747
278 Ga0495597_0009731 3300046542 Bacteria 4734
279 Ga0495622_0062985 3300046557 Bacteria 1716
280 Ga0495633_0041507 3300046558 Bacteria 2188
281 Ga0495667_0027473 3300046559 Bacteria 3834
282 Ga0495634_0002523 3300046642 Bacteria 15172
283 Ga0495635_0046100 3300046663 Bacteria 3007
284 Ga0495657_0025952 3300046675 Bacteria 4156
285 Ga0495599_0014827 3300046678 Bacteria 4827
286 Ga0495623_0018653 3300046679 Bacteria 4479
287 Ga0495624_0086089 3300046690 Bacteria 1941
288 Ga0495600_0014852 3300046809 Bacteria 4912
289 Ga0495604_0172513 3300047317 Bacteria 1519
290 Ga0495674_0098240 3300047319 Bacteria 2493
291 Ga0495672_0001995 3300047320 Bacteria 19283
292 Ga0495680_0011006 3300047322 Bacteria 8036
293 Ga0495675_0017572 3300047444 Bacteria 4534
294 Ga0495684_0082360 3300047471 Bacteria 2441
295 Ga0495593_0051000 3300047673 Bacteria 2191
296 Ga0495602_0023146 3300048088 Bacteria 6061
297 Ga0495615_0011962 3300048090 Bacteria 1778
298 Ga0496100_0021841 3300048903 Bacteria 3862
299 Ga0496102_0168979 3300048905 Bacteria 2058
300 Ga0496103_0000888 3300048906 Bacteria 21607
301 Ga0496103_0004662 3300048906 Bacteria 8303
302 Ga0496103_0045780 3300048906 Bacteria 2700
303 Ga0496104_0019545 3300048907 Bacteria 6200
304 Ga0496107_0028018 3300048910 Bacteria 4003
305 Ga0496114_0017166 3300048917 Bacteria 5837
306 Ga0496117_0006602 3300048920 Bacteria 11660
307 Ga0496117_0016042 3300048920 Bacteria 6343
308 Ga0496118_0004059 3300048921 Bacteria 17753
309 Ga0496118_0061229 3300048921 Bacteria 2788
310 Ga0496121_0000234 3300048924 Bacteria 119336
311 Ga0496121_0008206 3300048924 Bacteria 12383
312 Ga0496121_0017845 3300048924 Bacteria 7207
313 Ga0496121_0064234 3300048924 Bacteria 2994
314 Ga0496122_0072716 3300048925 Bacteria 2443
315 Ga0496123_0016623 3300048926 Bacteria 5961
316 Ga0496125_0098503 3300048928 Bacteria 2163
317 Ga0496126_0020756 3300048929 Bacteria 6430
318 Ga0496126_0086611 3300048929 Bacteria 2761
319 Ga0501031_0073791 3300049568 Bacteria 2222
320 Ga0501032_0106920 3300049569 Bacteria 1853
321 Ga0501033_0085707 3300049570 Bacteria 2307
322 Ga0501034_0014211 3300049571 Bacteria 8206
323 Ga0501034_0111078 3300049571 Bacteria 2732
324 Ga0501036_0007506 3300049572 Bacteria 8896
325 Ga0501038_0056718 3300049574 Bacteria 3364
326 Ga0501039_0080710 3300049575 Bacteria 2531
327 Ga0501040_0007773 3300049576 Bacteria 6941
328 Ga0501041_0033706 3300049577 Bacteria 3099
329 Ga0501042_0005168 3300049578 Bacteria 8385
330 Ga0501043_0042740 3300049579 Bacteria 3562
331 Ga0501046_0037044 3300049580 Bacteria 3921
332 Ga0501048_0038271 3300049582 Bacteria 3442
333 Ga0501072_0009019 3300049588 Bacteria 7581
334 Ga0501072_0010780 3300049588 Bacteria 6966
335 Ga0501074_0052216 3300049590 Bacteria 2951
336 Ga0501075_0008767 3300049591 Bacteria 7048
337 Ga0501076_0133613 3300049592 Bacteria 2013
338 Ga0501077_0032426 3300049593 Bacteria 3325
339 Ga0501079_0030191 3300049741 Bacteria 4165
340 Ga0501079_0217914 3300049741 Bacteria 1491
341 Ga0501080_0048782 3300049742 Bacteria 3940
342 Ga0501080_0207948 3300049742 Bacteria 1794
343 Ga0501083_0024198 3300049744 Bacteria 4210
344 Ga0501083_0123366 3300049744 Bacteria 1698
345 Ga0501045_0022972 3300049824 Bacteria 4469
346 nmdc:mga08y16_163982_c1 3300050511 Bacteria 2309
347 nmdc:mga08y16_25250_c1 3300050511 Bacteria 6266
348 nmdc:mga0n895_144190_c1 3300050512 Bacteria 2411
349 nmdc:mga0a205_23520_c1 3300050515 Bacteria 5845
350 Ga0495612_0006286 3300053078 Bacteria 4894
351 Ga0500635_0000174 3300053080 Bacteria 33055
352 Ga0500635_0000569 3300053080 Bacteria 9849
353 Ga0495619_0003420 3300053085 Bacteria 10245
354 Ga0500643_001027 3300053087 Bacteria 16977
355 Ga0500643_001465 3300053087 Bacteria 13552
356 Ga0500643_002992 3300053087 Bacteria 8376
357 Ga0500651_0005152 3300053093 Bacteria 7439
358 Ga0500566_0027041 3300053094 Bacteria 3358
359 Ga0500641_0002490 3300053096 Bacteria 6512
360 Ga0500554_001395 3300053102 Bacteria 4677
361 Ga0500555_002087 3300053103 Bacteria 5869
362 Ga0500556_0008516 3300053104 Bacteria 2962
363 Ga0500556_0010382 3300053104 Bacteria 2734
364 Ga0500595_002557 3300053119 Bacteria 8911
365 Ga0500607_000781 3300053121 Bacteria 30691
366 Ga0500608_009286 3300053122 Bacteria 4169
367 Ga0500614_012212 3300053123 Bacteria 1869
368 Ga0500618_009859 3300053125 Bacteria 2590
369 Ga0500655_000278 3300053133 Bacteria 11795
370 Ga0500559_0008966 3300053136 Bacteria 4352
371 Ga0500559_0019430 3300053136 Bacteria 2871
372 Ga0500590_005922 3300053148 Bacteria 5920
373 Ga0500590_057485 3300053148 Bacteria 1962
374 Ga0500603_000244 3300053150 Bacteria 14255
375 Ga0500622_0050167 3300053156 Bacteria 2150
376 Ga0500636_0012590 3300053177 Bacteria 4959
377 Ga0500636_0043211 3300053177 Bacteria 2661
378 Ga0500637_0000419 3300053178 Bacteria 16228
379 Ga0500637_0030488 3300053178 Bacteria 3001
380 Ga0500637_0080185 3300053178 Bacteria 1885
381 Ga0500570_000056 3300053724 Bacteria 28005
382 Ga0500645_008043 3300053730 Bacteria 3629
383 Ga0500645_011056 3300053730 Bacteria 2960
384 Ga0500645_017527 3300053730 Bacteria 2243
385 Ga0501084_0053337 3300054114 Bacteria 3382
386 Ga0501084_0107947 3300054114 Bacteria 2338
387 Ga0530510_0005017 3300061734 Bacteria 9142
388 2511127568 2510917021 Bacteria 5705459
389 2513675219 2513237098 Bacteria 9902361
390 2585262626 2582581305 Bacteria 4895574
391 2829747796 2829745981 Bacteria 5406054
392 2842702082 2842698319 Bacteria 5190321
393 2861691654 2861691609 Bacteria 5628931
394 2885373846 2885366525 Bacteria 8326213
395 2885385508 2885383462 Bacteria 9473874
396 2902408646 2902405164 Bacteria 6784948
397 2908764594 2908756301 Bacteria 8864324
398 2917554861 2917554339 Bacteria 4987857
399 3005482488 3005474847 Bacteria 9259049
400 Ga0105249_10126239
401 JGI24752J21851_1000189
402 JGI24739J22299_10008662
403 JGI24735J21928_10005028
404 JGI24750J21931_1000030
405 JGI24748J21848_1000067
406 JGI24738J21930_10002794
407 JGI24034J26672_10000025
408 JGI25160J50197_1000560
409 Ga0065165_1003664
410 Ga0065707_10097585
411 Ga0070690_100003903
412 Ga0070690_100094259
413 Ga0070670_100000072
414 Ga0070666_10000053
415 Ga0070666_10012709
416 Ga0070682_100001064
417 Ga0068868_100008324
418 Ga0070689_100003428
419 Ga0070689_100012104
420 Ga0070661_100002478
421 Ga0070668_100000935
422 Ga0070668_100000942
423 Ga0070668_100024367
424 Ga0070669_100000100
425 Ga0070671_100000239
426 Ga0070674_100002649
427 Ga0070673_100042953
428 Ga0070688_100001307
429 Ga0070659_100014855
430 Ga0070667_100001999
431 Ga0070667_100008054
432 Ga0070709_10001427
433 Ga0070714_100002074
434 Ga0070714_100066876
435 Ga0070713_100002059
436 Ga0070713_100003052
437 Ga0070710_10005097
438 Ga0070700_100041208
439 Ga0070678_100009961
440 Ga0070685_10002274
441 Ga0070685_10109145
442 Ga0070707_100245323
443 Ga0070684_100005577
444 Ga0070697_100021216
445 Ga0070672_100024467
446 Ga0070686_100000050
447 Ga0070686_100092299
448 Ga0070693_100004619
449 Ga0070665_100000004
450 Ga0070665_100001714
451 Ga0070665_100011999
452 Ga0070665_100039032
453 Ga0070665_100044394
454 Ga0070704_100155022
455 Ga0068855_100006193
456 Ga0068855_100241049
457 Ga0070664_100002290
458 Ga0070664_100086136
459 Ga0068857_100034368
460 Ga0068854_100001117
461 Ga0068854_100039552
462 Ga0070702_100001894
463 Ga0068852_100004303
464 Ga0068859_100048182
465 Ga0068864_100000019
466 Ga0068864_100012896
467 Ga0068864_100217240
468 Ga0068866_10002201
469 Ga0068861_100002603
470 Ga0068861_100015396
471 Ga0068851_10050083
472 Ga0068870_10144759
473 Ga0068863_100000010
474 Ga0068863_100000011
475 Ga0068863_100000104
476 Ga0068863_100003211
477 Ga0068858_100001824
478 Ga0068858_100006848
479 Ga0068860_100000189
480 Ga0068862_100000279
481 Ga0068862_100001374
482 Ga0068862_100001966
483 Ga0068862_100077297
484 Ga0068862_100272727
485 Ga0081455_10001362
486 Ga0081455_10007439
487 Ga0081455_10126281
488 Ga0081540_1037312
489 Ga0070717_10062678
490 Ga0070712_100002801
491 Ga0075428_100065482
492 Ga0075434_100095209
493 Ga0075436_100056757
494 Ga0075436_100068291
495 Ga0097620_100048182
496 Ga0075435_100010462
497 Ga0105250_10010144
498 Ga0105240_10001983
499 Ga0105240_10123450
500 Ga0111539_10029086
501 Ga0105245_10005880
502 Ga0105247_10004771
503 Ga0105247_10014830
504 Ga0105243_10005612
505 Ga0105241_10015170
506 Ga0105248_10000014
507 Ga0105248_10041611
508 Ga0105248_10049567
509 Ga0105237_10012132
510 Ga0105238_10004508
511 Ga0105238_10045308
512 Ga0105238_10135882
513 Ga0105249_10000048
514 Ga0105249_10000157
515 Ga0105249_10007404
516 Ga0105249_10020104
517 Ga0105239_10027244
518 Ga0105239_10054171
519 Ga0105246_10004020
520 Ga0105246_10020110
521 Ga0157373_10040513
522 Ga0157371_10010960
523 Ga0157369_10002335
524 Ga0157378_10009883
525 Ga0163162_10021585
526 Ga0157372_10002908
527 Ga0157375_10028191
528 Ga0157380_10000063
529 Ga0157380_10000282
530 Ga0157377_10042062
531 Ga0157379_10016222
532 Ga0157379_10058064
533 Ga0157379_10102433
534 Ga0157376_10016797
535 Ga0163161_10000020
536 Ga0163161_10008856
537 Ga0163161_10134333
538 Ga0214544_1000013
539 Ga0214542_1000013
540 Ga0214545_1000012
541 Ga0214543_1000065
542 Ga0213871_10021842
543 Ga0209677_102470
544 Ga0207426_1004145
545 Ga0207426_1005040
546 Ga0207697_10056532
547 Ga0207692_10018793
548 Ga0207688_10012254
549 Ga0207688_10055289
550 Ga0207680_10000017
551 Ga0207680_10013702
552 Ga0207647_10002850
553 Ga0207654_10022624
554 Ga0207695_10010826
555 Ga0207695_10036588
556 Ga0207695_10171646
557 Ga0207671_10015540
558 Ga0207671_10046897
559 Ga0207671_10051480
560 Ga0207671_10128955
561 Ga0207693_10001289
562 Ga0207663_10011493
563 Ga0207662_10010534
564 Ga0207657_10000034
565 Ga0207657_10113605
566 Ga0207649_10024961
567 Ga0207646_10251638
568 Ga0207681_10000374
569 Ga0207681_10004492
570 Ga0207694_10006528
571 Ga0207694_10182414
572 Ga0207650_10000116
573 Ga0207650_10132311
574 Ga0207659_10061905
575 Ga0207687_10071642
576 Ga0207700_10095724
577 Ga0207664_10293982
578 Ga0207644_10000010
579 Ga0207644_10011854
580 Ga0207706_10004333
581 Ga0207706_10015735
582 Ga0207686_10011328
583 Ga0207670_10003902
584 Ga0207670_10009103
585 Ga0207669_10004759
586 Ga0207691_10006606
587 Ga0207711_10000021
588 Ga0207711_10006350
589 Ga0207711_10017795
590 Ga0207679_10013237
591 Ga0207651_10030259
592 Ga0207712_10000099
593 Ga0207712_10000148
594 Ga0207712_10005787
595 Ga0207712_10053849
596 Ga0207668_10004757
597 Ga0207658_10001242
598 Ga0207677_10007378
599 Ga0207703_10009994
600 Ga0207678_10001569
601 Ga0207708_10006529
602 Ga0207702_10020342
603 Ga0207702_10024675
604 Ga0207641_10000008
605 Ga0207641_10000028
606 Ga0207641_10001657
607 Ga0207676_10000019
608 Ga0207676_10007143
609 Ga0207676_10202864
610 Ga0207674_10004245
611 Ga0207674_10011503
612 Ga0207674_10071090
613 Ga0207674_10229968
614 Ga0207675_100000129
615 Ga0207675_100012958
616 Ga0207683_10002259
617 Ga0207698_10157649
618 Ga0207428_10016396
619 Ga0207428_10023709
620 Ga0268266_10000009
621 Ga0268266_10009762
622 Ga0268266_10027025
623 Ga0268266_10041103
624 Ga0268265_10000011
625 Ga0268265_10000187
626 Ga0268265_10001519
627 Ga0268265_10041343
628 Ga0268265_10064867
629 Ga0268264_10000023
630 Ga0268264_10040079
631 Ga0265337_1003558
632 Ga0265326_10000685
633 Ga0265319_1003983
634 Ga0265334_10003145
635 Ga0265318_10001893
636 Ga0265323_10000541
637 Ga0265322_10004212
638 Ga0265336_10000107
639 Ga0265338_10000161
640 Ga0265324_10000449
641 Ga0265330_10026457
642 Ga0265342_10056243
643 Ga0307405_10047287
644 Ga0307406_10105047
645 Ga0307412_10128877
646 Ga0307510_10039840
647 Ga0373957_0007035
648 Ga0373937_0007641
649 Ga0395900_0055971
650 Ga0395905_0005845
651 Ga0395901_0167965
652 Ga0400483_121504
653 Ga0400483_244768
654 Ga0436365_1451888
655 Ga0436360_0012923
656 Ga0436363_1353628
657 Ga0439453_0012673
658 Ga0495603_0049030
659 Ga0495629_0049089
660 Ga0495651_0058643
661 Ga0495651_0115444
662 Ga0495580_0037491
663 Ga0495664_0045931
664 Ga0495664_0048399
665 Ga0495594_0052004
666 Ga0495608_0007145
667 Ga0495608_0049787
668 Ga0495618_0006857
669 Ga0495628_0019626
670 Ga0495643_0014952
671 Ga0495643_0031847
672 Ga0495648_0027761
673 Ga0495652_0081222
674 Ga0495640_0022782
675 Ga0495587_0009075
676 Ga0495621_0011421
677 Ga0495597_0009731
678 Ga0495622_0062985
679 Ga0495633_0041507
680 Ga0495667_0027473
681 Ga0495634_0002523
682 Ga0495635_0046100
683 Ga0495657_0025952
684 Ga0495599_0014827
685 Ga0495623_0018653
686 Ga0495624_0086089
687 Ga0495600_0014852
688 Ga0495604_0172513
689 Ga0495674_0098240
690 Ga0495672_0001995
691 Ga0495680_0011006
692 Ga0495675_0017572
693 Ga0495684_0082360
694 Ga0495593_0051000
695 Ga0495602_0023146
696 Ga0495615_0011962
697 Ga0496100_0021841
698 Ga0496102_0168979
699 Ga0496103_0000888
700 Ga0496103_0004662
701 Ga0496103_0045780
702 Ga0496104_0019545
703 Ga0496107_0028018
704 Ga0496114_0017166
705 Ga0496117_0006602
706 Ga0496117_0016042
707 Ga0496118_0004059
708 Ga0496118_0061229
709 Ga0496121_0000234
710 Ga0496121_0008206
711 Ga0496121_0017845
712 Ga0496121_0064234
713 Ga0496122_0072716
714 Ga0496123_0016623
715 Ga0496125_0098503
716 Ga0496126_0020756
717 Ga0496126_0086611
718 Ga0501031_0073791
719 Ga0501032_0106920
720 Ga0501033_0085707
721 Ga0501034_0014211
722 Ga0501034_0111078
723 Ga0501036_0007506
724 Ga0501038_0056718
725 Ga0501039_0080710
726 Ga0501040_0007773
727 Ga0501041_0033706
728 Ga0501042_0005168
729 Ga0501043_0042740
730 Ga0501046_0037044
731 Ga0501048_0038271
732 Ga0501072_0009019
733 Ga0501072_0010780
734 Ga0501074_0052216
735 Ga0501075_0008767
736 Ga0501076_0133613
737 Ga0501077_0032426
738 Ga0501079_0030191
739 Ga0501079_0217914
740 Ga0501080_0048782
741 Ga0501080_0207948
742 Ga0501083_0024198
743 Ga0501083_0123366
744 Ga0501045_0022972
745 nmdc:mga08y16_163982_c1
746 nmdc:mga08y16_25250_c1
747 nmdc:mga0n895_144190_c1
748 nmdc:mga0a205_23520_c1
749 Ga0495612_0006286
750 Ga0500635_0000174
751 Ga0500635_0000569
752 Ga0495619_0003420
753 Ga0500643_001027
754 Ga0500643_001465
755 Ga0500643_002992
756 Ga0500651_0005152
757 Ga0500566_0027041
758 Ga0500641_0002490
759 Ga0500554_001395
760 Ga0500555_002087
761 Ga0500556_0008516
762 Ga0500556_0010382
763 Ga0500595_002557
764 Ga0500607_000781
765 Ga0500608_009286
766 Ga0500614_012212
767 Ga0500618_009859
768 Ga0500655_000278
769 Ga0500559_0008966
770 Ga0500559_0019430
771 Ga0500590_005922
772 Ga0500590_057485
773 Ga0500603_000244
774 Ga0500622_0050167
775 Ga0500636_0012590
776 Ga0500636_0043211
777 Ga0500637_0000419
778 Ga0500637_0030488
779 Ga0500637_0080185
780 Ga0500570_000056
781 Ga0500645_008043
782 Ga0500645_011056
783 Ga0500645_017527
784 Ga0501084_0053337
785 Ga0501084_0107947
786 Ga0530510_0005017
787 2511127568
788 2513675219
789 2585262626
790 2829747796
791 2842702082
792 2861691654
793 2885373846
794 2885385508
795 2902408646
796 2908764594
797 2917554861
798 3005482488

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00120

Gln-synt_C

Glutamine synthetase, catalytic domain

97

432

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cql-assembly1.cif.gz_A apo gmas without ligand 0.9637 1 432
7cql-assembly1.cif.gz_A apo gmas without ligand 0.9615 1 432
7cqw-assembly1.cif.gz_A gmas/adp complex-conformation 1 0.9523 1 432
7cqw-assembly1.cif.gz_A gmas/adp complex-conformation 1 0.9502 1 432
5dm3-assembly10.cif.gz_F-2 crystal structure of glutamine synthetase from chromohalobacter salexigens dsm 3043(csal_0679, target efi-550015) with bound adp 0.9106 3 429
ID Description Score Start End Superfamily
af_P9WN37_2_108_3.10.20.70 Alpha Beta;Roll;Ubiquitin-like (UB roll);Glutamine synthetase, N-terminal domain 0.9316 4 94 3.10.20.70
3qajK01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Glutamine synthetase, N-terminal domain 0.8938 3 94 3.10.20.70
af_I6X5K1_121_455_3.30.590.10 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2;Glutamine synthetase/guanido kinase, catalytic domain 0.8859 97 430 3.30.590.10
3ng0A01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Glutamine synthetase, N-terminal domain 0.882 5 95 3.10.20.70
af_I6X5K1_121_455_3.30.590.10 Alpha Beta;2-Layer Sandwich;Creatine Kinase; Chain A, domain 2;Glutamine synthetase/guanido kinase, catalytic domain 0.8783 97 430 3.30.590.10
ID Description Score Start End GO Terms
AF-A0A1R3WVW8-F1-model_v4 Glutamine synthetase 0.9628 1 432 GO:0004356
GO:0006542
GO:0009399
AF-A0A258NHD4-F1-model_v4 Type III glutamate--ammonia ligase 0.9625 2 223 GO:0004356
GO:0006542
GO:0009399
AF-A0A1R3WVW8-F1-model_v4 Glutamine synthetase 0.9606 1 432 GO:0004356
GO:0006542
GO:0009399
AF-A0A7S4A623-F1-model_v4 Glutamine synthetase 0.9595 4 432 GO:0004356
GO:0006542
AF-A0A529ZHI0-F1-model_v4 Type III glutamate--ammonia ligase 0.9558 208 365 GO:0004356

Map