F434280

General Info

Members Datasets Scaffolds Average Seq Length
399 246 798 143

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10015162|Ga0105241_100151625
Length 162
Sequence MRSGDLPLDVTLVFCKCGHHHIDHDHEEPTMTVTGMFVNFAVTDLDRAKAFYEALGFTINPLFTDHNAACVVVEDGHSYFMVQTREFYQTMTELELGDPKVHPTAGTSIFVDTREAVDAEPADYGFMYQRGLTDPDGNVVDFGWMDPKAAEVGPEAFANQQA

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
88 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
92 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
163 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
164 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
165 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
166 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
167 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
174 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
205 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
206 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
207 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
235 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
236 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
237 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
238 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
239 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
240 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
241 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
244 2643221616 Leifsonia sp. Root227 Isolate Unclassified
245 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
246 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 0.25
Isolates 0.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.27
Nodule 0
Rhizoplane 7.52
Rhizosphere 78.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10015162 3300009174 Bacteria 5644
2 JGI24744J21845_10065246 3300002077 Bacteria 665
3 JGI25164J39214_1000209 3300002772 Bacteria 49837
4 JGI25165J46597_1000125 3300003214 Bacteria 131155
5 Ga0055527_1000003 3300003760 Bacteria 705001
6 Ga0055542_1000005 3300003762 Bacteria 550280
7 Ga0055529_1000046 3300003763 Bacteria 209430
8 Ga0070658_10032561 3300005327 Bacteria 4191
9 Ga0070658_10058223 3300005327 Bacteria 3144
10 Ga0070658_10072415 3300005327 Bacteria 2824
11 Ga0070658_10211061 3300005327 Bacteria 1640
12 Ga0070683_100091942 3300005329 Bacteria 2850
13 Ga0070677_10515376 3300005333 Bacteria 650
14 Ga0068869_100626291 3300005334 Bacteria 911
15 Ga0070666_10694375 3300005335 Bacteria 746
16 Ga0070680_102010562 3300005336 Bacteria 501
17 Ga0070682_100388644 3300005337 Bacteria 1052
18 Ga0070660_100100747 3300005339 Bacteria 2288
19 Ga0070691_10526601 3300005341 Bacteria 687
20 Ga0070661_100120678 3300005344 Bacteria 1963
21 Ga0070692_10424836 3300005345 Bacteria 845
22 Ga0070675_100097517 3300005354 Bacteria 2472
23 Ga0070675_100924072 3300005354 Bacteria 800
24 Ga0070674_100225626 3300005356 Bacteria 1460
25 Ga0070659_100000749 3300005366 Bacteria 23637
26 Ga0070659_100121766 3300005366 Bacteria 2114
27 Ga0070659_100246535 3300005366 Bacteria 1480
28 Ga0070663_100442597 3300005455 Bacteria 1070
29 Ga0070678_100327168 3300005456 Bacteria 1311
30 Ga0070662_101493741 3300005457 Bacteria 583
31 Ga0070681_10144416 3300005458 Bacteria 2309
32 Ga0070685_10023708 3300005466 Bacteria 3363
33 Ga0070685_10305883 3300005466 Bacteria 1073
34 Ga0070684_100009574 3300005535 Bacteria 7634
35 Ga0070684_100257501 3300005535 Bacteria 1596
36 Ga0070684_101624639 3300005535 Bacteria 610
37 Ga0068853_100108414 3300005539 Bacteria 2464
38 Ga0068853_101975816 3300005539 Bacteria 565
39 Ga0070672_100200494 3300005543 Bacteria 1669
40 Ga0070665_100186061 3300005548 Bacteria 2078
41 Ga0068855_100003924 3300005563 Bacteria 18149
42 Ga0068855_100009335 3300005563 Bacteria 11847
43 Ga0068855_100237478 3300005563 Bacteria 2038
44 Ga0068855_100372854 3300005563 Bacteria 1568
45 Ga0070664_100008041 3300005564 Bacteria 8522
46 Ga0070664_100703087 3300005564 Bacteria 942
47 Ga0068857_100001028 3300005577 Bacteria 21558
48 Ga0068857_100017779 3300005577 Bacteria 6233
49 Ga0068857_100052467 3300005577 Bacteria 3618
50 Ga0068857_101354468 3300005577 Bacteria 692
51 Ga0068854_100871061 3300005578 Bacteria 790
52 Ga0068856_100027232 3300005614 Bacteria 5576
53 Ga0068856_100080073 3300005614 Bacteria 3240
54 Ga0068856_100104794 3300005614 Bacteria 2822
55 Ga0068856_100615877 3300005614 Bacteria 1106
56 Ga0068852_100000501 3300005616 Bacteria 25721
57 Ga0068859_100107171 3300005617 Bacteria 2854
58 Ga0068851_10000008 3300005834 Bacteria 231006
59 Ga0068870_10067544 3300005840 Bacteria 1940
60 Ga0068863_100020054 3300005841 Bacteria 6395
61 Ga0068858_100000096 3300005842 Bacteria 91762
62 Ga0081540_1001036 3300005983 Bacteria 24897
63 Ga0075365_10799282 3300006038 Bacteria 666
64 Ga0075365_10979470 3300006038 Bacteria 596
65 Ga0075368_10440769 3300006042 Bacteria 576
66 Ga0075364_10462437 3300006051 Bacteria 867
67 Ga0075432_10009906 3300006058 Bacteria 3240
68 Ga0070716_100312345 3300006173 Bacteria 1098
69 Ga0070716_100945322 3300006173 Bacteria 678
70 Ga0070712_100432930 3300006175 Bacteria 1092
71 Ga0075367_10316037 3300006178 Bacteria 984
72 Ga0097621_100525018 3300006237 Bacteria 1075
73 Ga0075428_100025534 3300006844 Bacteria 6541
74 Ga0075428_101304490 3300006844 Bacteria 763
75 Ga0075430_100125237 3300006846 Bacteria 2141
76 Ga0075431_100437729 3300006847 Bacteria 1305
77 Ga0075433_10027089 3300006852 Bacteria 4859
78 Ga0075434_100158210 3300006871 Bacteria 2285
79 Ga0068865_100040815 3300006881 Bacteria 3155
80 Ga0075436_100527063 3300006914 Bacteria 866
81 Ga0097620_100107172 3300006931 Bacteria 2854
82 Ga0075435_100205163 3300007076 Bacteria 1671
83 Ga0105240_10012630 3300009093 Bacteria 11644
84 Ga0105240_10096652 3300009093 Bacteria 3599
85 Ga0105240_10420132 3300009093 Bacteria 1502
86 Ga0111539_10027872 3300009094 Bacteria 6897
87 Ga0105245_10029862 3300009098 Bacteria 4820
88 Ga0105245_10051456 3300009098 Bacteria 3692
89 Ga0105245_10054689 3300009098 Bacteria 3585
90 Ga0105245_10058830 3300009098 Bacteria 3459
91 Ga0114129_10010064 3300009147 Bacteria 13477
92 Ga0105243_10096661 3300009148 Bacteria 2444
93 Ga0105243_10374605 3300009148 Bacteria 1315
94 Ga0105243_12456136 3300009148 Bacteria 560
95 Ga0105242_10928692 3300009176 Bacteria 872
96 Ga0105248_10061203 3300009177 Bacteria 4226
97 Ga0105248_10155815 3300009177 Bacteria 2577
98 Ga0105248_10323473 3300009177 Bacteria 1737
99 Ga0105237_10000688 3300009545 Bacteria 46838
100 Ga0105238_10050049 3300009551 Bacteria 4207
101 Ga0105238_10545557 3300009551 Bacteria 1163
102 Ga0105238_11411781 3300009551 Bacteria 723
103 Ga0105249_10802193 3300009553 Bacteria 1005
104 Ga0105239_10456420 3300010375 Bacteria 1450
105 Ga0105239_10677794 3300010375 Bacteria 1178
106 Ga0105239_10791925 3300010375 Bacteria 1086
107 Ga0105239_11099602 3300010375 Bacteria 915
108 Ga0105246_10071938 3300011119 Bacteria 2436
109 Ga0157371_10798923 3300013102 Bacteria 711
110 Ga0157370_10292867 3300013104 Bacteria 1503
111 Ga0157370_10423740 3300013104 Bacteria 1224
112 Ga0157370_10590373 3300013104 Bacteria 1017
113 Ga0157369_10156600 3300013105 Bacteria 2406
114 Ga0157369_10209405 3300013105 Bacteria 2044
115 Ga0157369_10384040 3300013105 Bacteria 1457
116 Ga0157369_11088426 3300013105 Bacteria 817
117 Ga0157369_11529995 3300013105 Bacteria 679
118 Ga0157374_10215558 3300013296 Bacteria 1883
119 Ga0157374_10492615 3300013296 Bacteria 1230
120 Ga0163162_10241297 3300013306 Bacteria 1938
121 Ga0163162_10260650 3300013306 Bacteria 1865
122 Ga0157372_10835549 3300013307 Bacteria 1069
123 Ga0157372_11039064 3300013307 Bacteria 948
124 Ga0157372_11064380 3300013307 Bacteria 936
125 Ga0157372_11993423 3300013307 Bacteria 667
126 Ga0157375_10681817 3300013308 Bacteria 1182
127 Ga0157375_11464171 3300013308 Bacteria 805
128 Ga0157375_12290994 3300013308 Bacteria 644
129 Ga0163163_11226527 3300014325 Bacteria 812
130 Ga0163163_12384425 3300014325 Bacteria 588
131 Ga0157380_10019622 3300014326 Bacteria 5040
132 Ga0182008_10594804 3300014497 Bacteria 620
133 Ga0157377_10922435 3300014745 Bacteria 655
134 Ga0157379_10005881 3300014968 Bacteria 10552
135 Ga0157379_10892711 3300014968 Bacteria 843
136 Ga0157376_10121326 3300014969 Bacteria 2317
137 Ga0157376_10407582 3300014969 Bacteria 1316
138 Ga0163161_10239934 3300017792 Bacteria 1409
139 Ga0163161_10455669 3300017792 Bacteria 1035
140 Ga0206356_11112768 3300020070 Bacteria 536
141 Ga0213875_10046937 3300021388 Bacteria 2027
142 Ga0209672_100003 3300025228 Bacteria 1560476
143 Ga0209147_100646 3300025229 Bacteria 18280
144 Ga0207427_100039 3300025231 Bacteria 291576
145 Ga0209437_100922 3300025233 Bacteria 11217
146 Ga0209148_1000004 3300025254 Bacteria 1844481
147 Ga0209148_1001379 3300025254 Bacteria 12636
148 Ga0209233_1000014 3300025261 Bacteria 996641
149 Ga0209455_1000080 3300025272 Bacteria 266151
150 Ga0207656_10000005 3300025321 Bacteria 490514
151 Ga0207688_10906343 3300025901 Bacteria 558
152 Ga0207680_10517491 3300025903 Bacteria 851
153 Ga0207647_10028416 3300025904 Bacteria 3633
154 Ga0207699_10041240 3300025906 Bacteria 2665
155 Ga0207645_10660263 3300025907 Bacteria 710
156 Ga0207643_10224312 3300025908 Bacteria 1151
157 Ga0207643_10249718 3300025908 Bacteria 1093
158 Ga0207705_10033422 3300025909 Bacteria 3674
159 Ga0207705_10169614 3300025909 Bacteria 1643
160 Ga0207705_10197717 3300025909 Bacteria 1522
161 Ga0207654_10000001 3300025911 Bacteria 1816198
162 Ga0207707_10336826 3300025912 Bacteria 1301
163 Ga0207695_10005054 3300025913 Bacteria 17692
164 Ga0207695_10007931 3300025913 Bacteria 13399
165 Ga0207671_10000016 3300025914 Bacteria 435413
166 Ga0207657_10013644 3300025919 Bacteria 7965
167 Ga0207657_10208131 3300025919 Bacteria 1571
168 Ga0207657_10695612 3300025919 Bacteria 790
169 Ga0207681_10874735 3300025923 Bacteria 752
170 Ga0207694_10000019 3300025924 Bacteria 312382
171 Ga0207694_10126328 3300025924 Bacteria 2046
172 Ga0207650_10406310 3300025925 Bacteria 1128
173 Ga0207659_10624405 3300025926 Bacteria 920
174 Ga0207687_10020865 3300025927 Bacteria 4347
175 Ga0207687_10123798 3300025927 Bacteria 1938
176 Ga0207687_10644393 3300025927 Bacteria 896
177 Ga0207700_11336576 3300025928 Bacteria 638
178 Ga0207644_10826561 3300025931 Bacteria 775
179 Ga0207690_10007267 3300025932 Bacteria 6580
180 Ga0207690_10511707 3300025932 Bacteria 972
181 Ga0207690_10959626 3300025932 Bacteria 710
182 Ga0207706_10310800 3300025933 Bacteria 1372
183 Ga0207706_11113032 3300025933 Bacteria 659
184 Ga0207706_11177591 3300025933 Bacteria 638
185 Ga0207709_11223079 3300025935 Bacteria 619
186 Ga0207669_10783179 3300025937 Bacteria 790
187 Ga0207669_11103323 3300025937 Bacteria 670
188 Ga0207704_10749126 3300025938 Bacteria 812
189 Ga0207704_10845997 3300025938 Bacteria 766
190 Ga0207691_10043148 3300025940 Bacteria 4157
191 Ga0207711_10026964 3300025941 Bacteria 4823
192 Ga0207711_10034020 3300025941 Bacteria 4315
193 Ga0207711_11470025 3300025941 Bacteria 624
194 Ga0207689_10553896 3300025942 Bacteria 966
195 Ga0207661_10005545 3300025944 Bacteria 8905
196 Ga0207661_10231328 3300025944 Bacteria 1637
197 Ga0207679_10020782 3300025945 Bacteria 4437
198 Ga0207679_10773785 3300025945 Bacteria 874
199 Ga0207667_10000437 3300025949 Bacteria 55848
200 Ga0207667_10001482 3300025949 Bacteria 29458
201 Ga0207667_10008673 3300025949 Bacteria 12051
202 Ga0207667_10391990 3300025949 Bacteria 1414
203 Ga0207712_10373075 3300025961 Bacteria 1192
204 Ga0207668_10829224 3300025972 Bacteria 820
205 Ga0207640_11587682 3300025981 Bacteria 589
206 Ga0207658_10102844 3300025986 Bacteria 2241
207 Ga0207703_10001625 3300026035 Bacteria 20245
208 Ga0207703_11997922 3300026035 Bacteria 556
209 Ga0207639_10055278 3300026041 Bacteria 3037
210 Ga0207639_11544471 3300026041 Bacteria 623
211 Ga0207678_10091926 3300026067 Bacteria 2594
212 Ga0207678_10758061 3300026067 Bacteria 856
213 Ga0207702_10091237 3300026078 Bacteria 2667
214 Ga0207702_10092921 3300026078 Bacteria 2645
215 Ga0207702_10203978 3300026078 Bacteria 1834
216 Ga0207641_10297557 3300026088 Bacteria 1523
217 Ga0207641_10927145 3300026088 Bacteria 866
218 Ga0207648_10914958 3300026089 Bacteria 820
219 Ga0207674_10000405 3300026116 Bacteria 55884
220 Ga0207674_10026086 3300026116 Bacteria 6216
221 Ga0207674_10060264 3300026116 Bacteria 3838
222 Ga0207674_10852694 3300026116 Bacteria 878
223 Ga0207675_100102217 3300026118 Bacteria 2701
224 Ga0207683_10122690 3300026121 Bacteria 2333
225 Ga0207698_10000078 3300026142 Bacteria 65050
226 Ga0207698_10002109 3300026142 Bacteria 11726
227 Ga0207698_10057405 3300026142 Bacteria 3012
228 Ga0209813_10277396 3300027866 Bacteria 644
229 Ga0207428_10003440 3300027907 Bacteria 15375
230 Ga0268266_11040398 3300028379 Bacteria 792
231 Ga0268265_10546725 3300028380 Bacteria 1099
232 Ga0268264_10893911 3300028381 Bacteria 891
233 Ga0307515_10438084 3300028794 Bacteria 924
234 Ga0307513_10001290 3300031456 Bacteria 36243
235 Ga0307513_10658523 3300031456 Bacteria 754
236 Ga0307408_101333981 3300031548 Bacteria 673
237 Ga0307413_10902152 3300031824 Bacteria 751
238 Ga0307409_100614952 3300031995 Bacteria 1076
239 Ga0307414_10288646 3300032004 Bacteria 1382
240 Ga0307415_102496733 3300032126 Bacteria 509
241 Ga0373941_0299924 3300035115 Bacteria 641
242 Ga0373946_0522829 3300035171 Bacteria 610
243 Ga0373935_0024553 3300035692 Bacteria 3711
244 Ga0373927_0203199 3300035695 Bacteria 1301
245 Ga0373947_0652700 3300035725 Bacteria 717
246 Ga0395899_0265179 3300037312 Bacteria 1173
247 Ga0395900_0061609 3300037418 Bacteria 3857
248 Ga0395900_0117252 3300037418 Bacteria 2732
249 Ga0395898_0000647 3300037466 Bacteria 63277
250 Ga0395898_0073863 3300037466 Bacteria 3294
251 Ga0436364_1397485 3300037853 Bacteria 1955
252 Ga0436365_0157815 3300039437 Bacteria 1059
253 Ga0451787_510898 3300041441 Bacteria 742
254 Ga0451833_0678417 3300041491 Bacteria 1097
255 Ga0451837_1699558 3300041494 Bacteria 1022
256 Ga0451849_0653657 3300041505 Bacteria 812
257 Ga0451853_2495528 3300041512 Bacteria 2709
258 Ga0466965_0000003 3300044683 Bacteria 265985
259 Ga0466965_0016579 3300044683 Bacteria 3509
260 Ga0466965_0146027 3300044683 Bacteria 1234
261 Ga0466965_0149835 3300044683 Bacteria 1219
262 Ga0466965_0155608 3300044683 Bacteria 1196
263 Ga0466965_0291032 3300044683 Bacteria 884
264 Ga0466965_0490381 3300044683 Bacteria 688
265 Ga0466966_0242580 3300044684 Bacteria 1086
266 Ga0466966_0411090 3300044684 Bacteria 813
267 Ga0466966_0503154 3300044684 Bacteria 729
268 Ga0466966_0807009 3300044684 Bacteria 566
269 Ga0466961_0030204 3300044693 Bacteria 3483
270 Ga0466961_0088544 3300044693 Bacteria 1956
271 Ga0466961_0111405 3300044693 Bacteria 1722
272 Ga0466961_0604531 3300044693 Bacteria 659
273 Ga0466963_0317296 3300044694 Bacteria 1096
274 Ga0466963_0360618 3300044694 Bacteria 1024
275 Ga0466964_0098291 3300044706 Bacteria 1286
276 Ga0466964_0778385 3300044706 Bacteria 539
277 Ga0466971_0054084 3300044719 Bacteria 1809
278 Ga0466971_0163109 3300044719 Bacteria 1044
279 Ga0466968_0115855 3300044735 Bacteria 1209
280 Ga0466970_0024861 3300044765 Bacteria 3133
281 Ga0466970_0092065 3300044765 Bacteria 1646
282 Ga0466970_0130871 3300044765 Bacteria 1378
283 Ga0466970_0174876 3300044765 Bacteria 1190
284 Ga0466957_0768079 3300044842 Bacteria 683
285 Ga0466960_0103313 3300044901 Bacteria 1471
286 Ga0466960_0137673 3300044901 Bacteria 1294
287 Ga0466960_0552676 3300044901 Bacteria 679
288 Ga0466959_0150624 3300045049 Bacteria 1640
289 Ga0466959_0547981 3300045049 Bacteria 780
290 Ga0466958_0168912 3300045836 Bacteria 1385
291 Ga0466958_0235477 3300045836 Bacteria 1170
292 Ga0466967_0172099 3300045976 Bacteria 2038
293 Ga0495603_0234380 3300046455 Bacteria 1058
294 Ga0495608_0135684 3300046511 Bacteria 1573
295 Ga0495628_0301068 3300046516 Bacteria 1187
296 Ga0495630_0444106 3300046517 Bacteria 994
297 Ga0495631_0251179 3300046518 Bacteria 754
298 Ga0495640_0322896 3300046533 Bacteria 956
299 Ga0495609_0373468 3300046538 Bacteria 573
300 Ga0495668_0485530 3300046616 Bacteria 681
301 Ga0495657_0162568 3300046675 Bacteria 1381
302 Ga0496100_0994608 3300048903 Bacteria 660
303 Ga0496101_0133402 3300048904 Bacteria 1887
304 Ga0496102_0050844 3300048905 Bacteria 3775
305 Ga0496102_0793912 3300048905 Bacteria 869
306 Ga0496103_0153212 3300048906 Bacteria 1477
307 Ga0496103_0571643 3300048906 Bacteria 721
308 Ga0496104_0109494 3300048907 Bacteria 2647
309 Ga0496104_0206264 3300048907 Bacteria 1877
310 Ga0496105_0035365 3300048908 Bacteria 4111
311 Ga0496105_0220868 3300048908 Bacteria 1542
312 Ga0496105_0767173 3300048908 Bacteria 735
313 Ga0496106_1377160 3300048909 Bacteria 546
314 Ga0496108_0044795 3300048911 Bacteria 3694
315 Ga0496108_0583770 3300048911 Bacteria 974
316 Ga0496108_0698700 3300048911 Bacteria 880
317 Ga0496108_1023087 3300048911 Bacteria 705
318 Ga0496109_0025465 3300048912 Bacteria 5273
319 Ga0496109_0250330 3300048912 Bacteria 1668
320 Ga0496110_0129815 3300048913 Bacteria 2275
321 Ga0496111_0156272 3300048914 Bacteria 1692
322 Ga0496111_0318815 3300048914 Bacteria 1151
323 Ga0496111_0705380 3300048914 Bacteria 734
324 Ga0496112_0747150 3300048915 Bacteria 904
325 Ga0496113_0029739 3300048916 Bacteria 3949
326 Ga0496113_0035406 3300048916 Bacteria 3650
327 Ga0496113_0638448 3300048916 Bacteria 852
328 Ga0496114_0006887 3300048917 Bacteria 8952
329 Ga0496114_0328688 3300048917 Bacteria 1351
330 Ga0496115_0178569 3300048918 Bacteria 1755
331 Ga0496117_0001332 3300048920 Bacteria 36331
332 Ga0496117_0017549 3300048920 Bacteria 5972
333 Ga0496118_0007953 3300048921 Bacteria 11092
334 Ga0496119_0007381 3300048922 Bacteria 9924
335 Ga0496119_0042879 3300048922 Bacteria 2865
336 Ga0496120_0000929 3300048923 Bacteria 40563
337 Ga0496120_0002952 3300048923 Bacteria 16205
338 Ga0496120_0216031 3300048923 Bacteria 919
339 Ga0496126_0003195 3300048929 Bacteria 21042
340 Ga0496126_0183094 3300048929 Bacteria 1778
341 Ga0496126_0242027 3300048929 Bacteria 1507
342 Ga0496126_0336944 3300048929 Bacteria 1236
343 Ga0501031_0005483 3300049568 Bacteria 8258
344 Ga0501032_0004229 3300049569 Bacteria 10857
345 Ga0501032_0056123 3300049569 Bacteria 2648
346 Ga0501033_0008112 3300049570 Bacteria 8136
347 Ga0501033_0074121 3300049570 Bacteria 2499
348 Ga0501034_0011946 3300049571 Bacteria 8975
349 Ga0501034_0053735 3300049571 Bacteria 4055
350 Ga0501034_0169790 3300049571 Bacteria 2149
351 Ga0501034_0893461 3300049571 Bacteria 777
352 Ga0501034_1146349 3300049571 Bacteria 657
353 Ga0501037_0041206 3300049573 Bacteria 3396
354 Ga0501037_0379690 3300049573 Bacteria 971
355 Ga0501038_0001205 3300049574 Bacteria 23470
356 Ga0501038_0154237 3300049574 Bacteria 1871
357 Ga0501039_1185350 3300049575 Bacteria 591
358 Ga0501043_0248151 3300049579 Bacteria 1372
359 Ga0501043_0971616 3300049579 Bacteria 606
360 Ga0501046_0558374 3300049580 Bacteria 815
361 Ga0501047_0012282 3300049581 Bacteria 8106
362 Ga0501047_0817404 3300049581 Bacteria 746
363 Ga0501067_0069991 3300049583 Bacteria 1943
364 Ga0501070_0308741 3300049586 Bacteria 1288
365 Ga0501070_0900241 3300049586 Bacteria 690
366 Ga0501073_0133846 3300049589 Bacteria 1718
367 Ga0501076_0519180 3300049592 Bacteria 982
368 Ga0501083_0022438 3300049744 Bacteria 4381
369 Ga0501083_0109879 3300049744 Bacteria 1813
370 Ga0501035_0009512 3300049822 Bacteria 9038
371 Ga0501044_0015089 3300049823 Bacteria 8324
372 Ga0501044_0491254 3300049823 Bacteria 1130
373 nmdc:mga0yw44_914290_c1 3300050492 Bacteria 595
374 nmdc:mga05p37_21304_c1 3300050507 Bacteria 7848
375 nmdc:mga09592_296152_c1 3300050508 Bacteria 1403
376 nmdc:mga0qj67_104811_c1 3300050509 Bacteria 2281
377 nmdc:mga06r32_584500_c1 3300050510 Bacteria 1089
378 nmdc:mga0n895_3892_c1 3300050512 Bacteria 12134
379 nmdc:mga0rr50_34119_c1 3300050513 Bacteria 3642
380 nmdc:mga0a205_6069_c1 3300050515 Bacteria 10896
381 Ga0500635_0000097 3300053080 Bacteria 52649
382 Ga0500651_0000438 3300053093 Bacteria 22258
383 Ga0500559_0017618 3300053136 Bacteria 3017
384 Ga0500559_0052755 3300053136 Bacteria 1798
385 Ga0500559_0141834 3300053136 Bacteria 1125
386 Ga0500573_0009250 3300053140 Bacteria 5459
387 Ga0500573_0064015 3300053140 Bacteria 2104
388 Ga0500577_0021040 3300053142 Bacteria 2144
389 Ga0500577_0208461 3300053142 Bacteria 844
390 Ga0500590_000842 3300053148 Bacteria 11534
391 Ga0500616_0000088 3300053153 Bacteria 191662
392 Ga0500616_0000495 3300053153 Bacteria 50619
393 Ga0500620_000536 3300053155 Bacteria 6611
394 Ga0501082_0022063 3300060353 Bacteria 5489
395 Ga0466962_0270161 3300061719 Bacteria 838
396 Ga0466962_0482266 3300061719 Bacteria 626
397 2644096261 2643221616 Bacteria 4066575
398 2731907611 2731639228 Bacteria 4187555
399 2966925272 2966924647 Bacteria 3268643
400 Ga0105241_10015162
401 JGI24744J21845_10065246
402 JGI25164J39214_1000209
403 JGI25165J46597_1000125
404 Ga0055527_1000003
405 Ga0055542_1000005
406 Ga0055529_1000046
407 Ga0070658_10032561
408 Ga0070658_10058223
409 Ga0070658_10072415
410 Ga0070658_10211061
411 Ga0070683_100091942
412 Ga0070677_10515376
413 Ga0068869_100626291
414 Ga0070666_10694375
415 Ga0070680_102010562
416 Ga0070682_100388644
417 Ga0070660_100100747
418 Ga0070691_10526601
419 Ga0070661_100120678
420 Ga0070692_10424836
421 Ga0070675_100097517
422 Ga0070675_100924072
423 Ga0070674_100225626
424 Ga0070659_100000749
425 Ga0070659_100121766
426 Ga0070659_100246535
427 Ga0070663_100442597
428 Ga0070678_100327168
429 Ga0070662_101493741
430 Ga0070681_10144416
431 Ga0070685_10023708
432 Ga0070685_10305883
433 Ga0070684_100009574
434 Ga0070684_100257501
435 Ga0070684_101624639
436 Ga0068853_100108414
437 Ga0068853_101975816
438 Ga0070672_100200494
439 Ga0070665_100186061
440 Ga0068855_100003924
441 Ga0068855_100009335
442 Ga0068855_100237478
443 Ga0068855_100372854
444 Ga0070664_100008041
445 Ga0070664_100703087
446 Ga0068857_100001028
447 Ga0068857_100017779
448 Ga0068857_100052467
449 Ga0068857_101354468
450 Ga0068854_100871061
451 Ga0068856_100027232
452 Ga0068856_100080073
453 Ga0068856_100104794
454 Ga0068856_100615877
455 Ga0068852_100000501
456 Ga0068859_100107171
457 Ga0068851_10000008
458 Ga0068870_10067544
459 Ga0068863_100020054
460 Ga0068858_100000096
461 Ga0081540_1001036
462 Ga0075365_10799282
463 Ga0075365_10979470
464 Ga0075368_10440769
465 Ga0075364_10462437
466 Ga0075432_10009906
467 Ga0070716_100312345
468 Ga0070716_100945322
469 Ga0070712_100432930
470 Ga0075367_10316037
471 Ga0097621_100525018
472 Ga0075428_100025534
473 Ga0075428_101304490
474 Ga0075430_100125237
475 Ga0075431_100437729
476 Ga0075433_10027089
477 Ga0075434_100158210
478 Ga0068865_100040815
479 Ga0075436_100527063
480 Ga0097620_100107172
481 Ga0075435_100205163
482 Ga0105240_10012630
483 Ga0105240_10096652
484 Ga0105240_10420132
485 Ga0111539_10027872
486 Ga0105245_10029862
487 Ga0105245_10051456
488 Ga0105245_10054689
489 Ga0105245_10058830
490 Ga0114129_10010064
491 Ga0105243_10096661
492 Ga0105243_10374605
493 Ga0105243_12456136
494 Ga0105242_10928692
495 Ga0105248_10061203
496 Ga0105248_10155815
497 Ga0105248_10323473
498 Ga0105237_10000688
499 Ga0105238_10050049
500 Ga0105238_10545557
501 Ga0105238_11411781
502 Ga0105249_10802193
503 Ga0105239_10456420
504 Ga0105239_10677794
505 Ga0105239_10791925
506 Ga0105239_11099602
507 Ga0105246_10071938
508 Ga0157371_10798923
509 Ga0157370_10292867
510 Ga0157370_10423740
511 Ga0157370_10590373
512 Ga0157369_10156600
513 Ga0157369_10209405
514 Ga0157369_10384040
515 Ga0157369_11088426
516 Ga0157369_11529995
517 Ga0157374_10215558
518 Ga0157374_10492615
519 Ga0163162_10241297
520 Ga0163162_10260650
521 Ga0157372_10835549
522 Ga0157372_11039064
523 Ga0157372_11064380
524 Ga0157372_11993423
525 Ga0157375_10681817
526 Ga0157375_11464171
527 Ga0157375_12290994
528 Ga0163163_11226527
529 Ga0163163_12384425
530 Ga0157380_10019622
531 Ga0182008_10594804
532 Ga0157377_10922435
533 Ga0157379_10005881
534 Ga0157379_10892711
535 Ga0157376_10121326
536 Ga0157376_10407582
537 Ga0163161_10239934
538 Ga0163161_10455669
539 Ga0206356_11112768
540 Ga0213875_10046937
541 Ga0209672_100003
542 Ga0209147_100646
543 Ga0207427_100039
544 Ga0209437_100922
545 Ga0209148_1000004
546 Ga0209148_1001379
547 Ga0209233_1000014
548 Ga0209455_1000080
549 Ga0207656_10000005
550 Ga0207688_10906343
551 Ga0207680_10517491
552 Ga0207647_10028416
553 Ga0207699_10041240
554 Ga0207645_10660263
555 Ga0207643_10224312
556 Ga0207643_10249718
557 Ga0207705_10033422
558 Ga0207705_10169614
559 Ga0207705_10197717
560 Ga0207654_10000001
561 Ga0207707_10336826
562 Ga0207695_10005054
563 Ga0207695_10007931
564 Ga0207671_10000016
565 Ga0207657_10013644
566 Ga0207657_10208131
567 Ga0207657_10695612
568 Ga0207681_10874735
569 Ga0207694_10000019
570 Ga0207694_10126328
571 Ga0207650_10406310
572 Ga0207659_10624405
573 Ga0207687_10020865
574 Ga0207687_10123798
575 Ga0207687_10644393
576 Ga0207700_11336576
577 Ga0207644_10826561
578 Ga0207690_10007267
579 Ga0207690_10511707
580 Ga0207690_10959626
581 Ga0207706_10310800
582 Ga0207706_11113032
583 Ga0207706_11177591
584 Ga0207709_11223079
585 Ga0207669_10783179
586 Ga0207669_11103323
587 Ga0207704_10749126
588 Ga0207704_10845997
589 Ga0207691_10043148
590 Ga0207711_10026964
591 Ga0207711_10034020
592 Ga0207711_11470025
593 Ga0207689_10553896
594 Ga0207661_10005545
595 Ga0207661_10231328
596 Ga0207679_10020782
597 Ga0207679_10773785
598 Ga0207667_10000437
599 Ga0207667_10001482
600 Ga0207667_10008673
601 Ga0207667_10391990
602 Ga0207712_10373075
603 Ga0207668_10829224
604 Ga0207640_11587682
605 Ga0207658_10102844
606 Ga0207703_10001625
607 Ga0207703_11997922
608 Ga0207639_10055278
609 Ga0207639_11544471
610 Ga0207678_10091926
611 Ga0207678_10758061
612 Ga0207702_10091237
613 Ga0207702_10092921
614 Ga0207702_10203978
615 Ga0207641_10297557
616 Ga0207641_10927145
617 Ga0207648_10914958
618 Ga0207674_10000405
619 Ga0207674_10026086
620 Ga0207674_10060264
621 Ga0207674_10852694
622 Ga0207675_100102217
623 Ga0207683_10122690
624 Ga0207698_10000078
625 Ga0207698_10002109
626 Ga0207698_10057405
627 Ga0209813_10277396
628 Ga0207428_10003440
629 Ga0268266_11040398
630 Ga0268265_10546725
631 Ga0268264_10893911
632 Ga0307515_10438084
633 Ga0307513_10001290
634 Ga0307513_10658523
635 Ga0307408_101333981
636 Ga0307413_10902152
637 Ga0307409_100614952
638 Ga0307414_10288646
639 Ga0307415_102496733
640 Ga0373941_0299924
641 Ga0373946_0522829
642 Ga0373935_0024553
643 Ga0373927_0203199
644 Ga0373947_0652700
645 Ga0395899_0265179
646 Ga0395900_0061609
647 Ga0395900_0117252
648 Ga0395898_0000647
649 Ga0395898_0073863
650 Ga0436364_1397485
651 Ga0436365_0157815
652 Ga0451787_510898
653 Ga0451833_0678417
654 Ga0451837_1699558
655 Ga0451849_0653657
656 Ga0451853_2495528
657 Ga0466965_0000003
658 Ga0466965_0016579
659 Ga0466965_0146027
660 Ga0466965_0149835
661 Ga0466965_0155608
662 Ga0466965_0291032
663 Ga0466965_0490381
664 Ga0466966_0242580
665 Ga0466966_0411090
666 Ga0466966_0503154
667 Ga0466966_0807009
668 Ga0466961_0030204
669 Ga0466961_0088544
670 Ga0466961_0111405
671 Ga0466961_0604531
672 Ga0466963_0317296
673 Ga0466963_0360618
674 Ga0466964_0098291
675 Ga0466964_0778385
676 Ga0466971_0054084
677 Ga0466971_0163109
678 Ga0466968_0115855
679 Ga0466970_0024861
680 Ga0466970_0092065
681 Ga0466970_0130871
682 Ga0466970_0174876
683 Ga0466957_0768079
684 Ga0466960_0103313
685 Ga0466960_0137673
686 Ga0466960_0552676
687 Ga0466959_0150624
688 Ga0466959_0547981
689 Ga0466958_0168912
690 Ga0466958_0235477
691 Ga0466967_0172099
692 Ga0495603_0234380
693 Ga0495608_0135684
694 Ga0495628_0301068
695 Ga0495630_0444106
696 Ga0495631_0251179
697 Ga0495640_0322896
698 Ga0495609_0373468
699 Ga0495668_0485530
700 Ga0495657_0162568
701 Ga0496100_0994608
702 Ga0496101_0133402
703 Ga0496102_0050844
704 Ga0496102_0793912
705 Ga0496103_0153212
706 Ga0496103_0571643
707 Ga0496104_0109494
708 Ga0496104_0206264
709 Ga0496105_0035365
710 Ga0496105_0220868
711 Ga0496105_0767173
712 Ga0496106_1377160
713 Ga0496108_0044795
714 Ga0496108_0583770
715 Ga0496108_0698700
716 Ga0496108_1023087
717 Ga0496109_0025465
718 Ga0496109_0250330
719 Ga0496110_0129815
720 Ga0496111_0156272
721 Ga0496111_0318815
722 Ga0496111_0705380
723 Ga0496112_0747150
724 Ga0496113_0029739
725 Ga0496113_0035406
726 Ga0496113_0638448
727 Ga0496114_0006887
728 Ga0496114_0328688
729 Ga0496115_0178569
730 Ga0496117_0001332
731 Ga0496117_0017549
732 Ga0496118_0007953
733 Ga0496119_0007381
734 Ga0496119_0042879
735 Ga0496120_0000929
736 Ga0496120_0002952
737 Ga0496120_0216031
738 Ga0496126_0003195
739 Ga0496126_0183094
740 Ga0496126_0242027
741 Ga0496126_0336944
742 Ga0501031_0005483
743 Ga0501032_0004229
744 Ga0501032_0056123
745 Ga0501033_0008112
746 Ga0501033_0074121
747 Ga0501034_0011946
748 Ga0501034_0053735
749 Ga0501034_0169790
750 Ga0501034_0893461
751 Ga0501034_1146349
752 Ga0501037_0041206
753 Ga0501037_0379690
754 Ga0501038_0001205
755 Ga0501038_0154237
756 Ga0501039_1185350
757 Ga0501043_0248151
758 Ga0501043_0971616
759 Ga0501046_0558374
760 Ga0501047_0012282
761 Ga0501047_0817404
762 Ga0501067_0069991
763 Ga0501070_0308741
764 Ga0501070_0900241
765 Ga0501073_0133846
766 Ga0501076_0519180
767 Ga0501083_0022438
768 Ga0501083_0109879
769 Ga0501035_0009512
770 Ga0501044_0015089
771 Ga0501044_0491254
772 nmdc:mga0yw44_914290_c1
773 nmdc:mga05p37_21304_c1
774 nmdc:mga09592_296152_c1
775 nmdc:mga0qj67_104811_c1
776 nmdc:mga06r32_584500_c1
777 nmdc:mga0n895_3892_c1
778 nmdc:mga0rr50_34119_c1
779 nmdc:mga0a205_6069_c1
780 Ga0500635_0000097
781 Ga0500651_0000438
782 Ga0500559_0017618
783 Ga0500559_0052755
784 Ga0500559_0141834
785 Ga0500573_0009250
786 Ga0500573_0064015
787 Ga0500577_0021040
788 Ga0500577_0208461
789 Ga0500590_000842
790 Ga0500616_0000088
791 Ga0500616_0000495
792 Ga0500620_000536
793 Ga0501082_0022063
794 Ga0466962_0270161
795 Ga0466962_0482266
796 2644096261
797 2731907611
798 2966925272

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

34

74

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gym-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9391 5 138
4gym-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9368 5 133
4gym-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8659 5 133
4gym-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8647 5 138
4pav-assembly6.cif.gz_F structure of hypothetical protein sa1046 from s. aureus. 0.8568 1 126
ID Description Score Start End Superfamily
4gymA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8998 5 136 3.10.180.10
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8835 73 129 3.30.720.110
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8698 73 129 3.30.720.110
af_Q8IK86_519_679_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8688 74 96 3.40.50.300
4gymA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8546 5 136 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A1H3K4L0-F1-model_v4 Glyoxalase/fosfomycin resistance/dioxygenase domain-containing protein 0.9538 73 130
AF-A0A3N2IK80-F1-model_v4 VOC domain-containing protein 0.9491 4 142
AF-A0A0Q5R004-F1-model_v4 Lactoylglutathione lyase 0.947 4 137 GO:0016829
AF-A0A1G3X4Y9-F1-model_v4 VOC domain-containing protein 0.9425 5 128
AF-A0A7K1FE34-F1-model_v4 Glyoxalase 0.9421 1 144

Map