F434105

General Info

Members Datasets Scaffolds Average Seq Length
398 241 398 176

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0246688|Ga0436361_0246688_1949_2578
Length 209
Sequence MLCGPRDGATCGGLKRSSRGSKATRIKAMPVSSRPTKPLALMFGDDGSIPNNPRLPLLVYRGAIDLSLGSSAERVVERTFGANGWGDMWRNGIFPYVHYHSMIHEALGIARGRAKVRFGGAAGKILELAPGDVAVLPAGTGHQRLWATPELCVIGAYPKRGSYDLCRGGKAEHAKALETIPQVPLPDSDPVYGTDGPLTTLWRAAMVAL

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
63 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
118 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
119 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
120 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
131 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
134 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
216 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
224 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
228 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
229 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
230 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
231 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
232 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
233 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
234 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
235 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
236 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
237 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
238 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
239 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
240 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
241 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.99
Metatranscriptomes 2.01
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.04
Nodule 0
Rhizoplane 4.52
Rhizosphere 82.91
Stem 0
Stem Tuber 0
Unclassified 5.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10074013 3300003323 Bacteria 2697
2 Ga0070682_100094467 3300005337 Bacteria 1962
3 Ga0070660_100039424 3300005339 Bacteria 3590
4 Ga0070691_10088317 3300005341 Bacteria 1526
5 Ga0070661_100017917 3300005344 Bacteria 5029
6 Ga0070661_100504336 3300005344 Bacteria 969
7 Ga0070692_10314896 3300005345 Bacteria 960
8 Ga0070669_100193403 3300005353 Bacteria 1597
9 Ga0070671_100008192 3300005355 Bacteria 8363
10 Ga0070673_101066607 3300005364 Bacteria 754
11 Ga0070659_100029711 3300005366 Bacteria 4225
12 Ga0070659_100162791 3300005366 Bacteria 1825
13 Ga0070659_100621496 3300005366 Bacteria 930
14 Ga0070709_10000542 3300005434 Bacteria 22119
15 Ga0070709_10003605 3300005434 Bacteria 8317
16 Ga0070709_10006777 3300005434 Bacteria 6253
17 Ga0070709_10083568 3300005434 Bacteria 2089
18 Ga0070714_100006564 3300005435 Bacteria 8998
19 Ga0070714_100014271 3300005435 Bacteria 6381
20 Ga0070714_100016720 3300005435 Bacteria 5931
21 Ga0070714_100120650 3300005435 Bacteria 2332
22 Ga0070714_100213742 3300005435 Bacteria 1769
23 Ga0070714_100410882 3300005435 Bacteria 1281
24 Ga0070713_100026489 3300005436 Bacteria 4553
25 Ga0070713_100087689 3300005436 Bacteria 2670
26 Ga0070713_100095395 3300005436 Bacteria 2566
27 Ga0070713_100199706 3300005436 Bacteria 1805
28 Ga0070713_100382498 3300005436 Bacteria 1311
29 Ga0070713_100434558 3300005436 Bacteria 1230
30 Ga0070710_10000520 3300005437 Bacteria 18089
31 Ga0070710_10019952 3300005437 Bacteria 3472
32 Ga0070711_100007912 3300005439 Bacteria 6482
33 Ga0070711_100010444 3300005439 Bacteria 5749
34 Ga0070711_100026430 3300005439 Bacteria 3804
35 Ga0070711_100028745 3300005439 Bacteria 3661
36 Ga0070711_100041663 3300005439 Bacteria 3103
37 Ga0070663_100033165 3300005455 Bacteria 3565
38 Ga0068867_100518097 3300005459 Bacteria 1028
39 Ga0070706_100364702 3300005467 Bacteria 1346
40 Ga0070699_100046830 3300005518 Bacteria 3742
41 Ga0070679_100063425 3300005530 Bacteria 3683
42 Ga0070679_100233154 3300005530 Bacteria 1800
43 Ga0070684_100314627 3300005535 Bacteria 1438
44 Ga0070684_101824882 3300005535 Bacteria 574
45 Ga0070697_100118550 3300005536 Bacteria 2212
46 Ga0068853_100002730 3300005539 Bacteria 13327
47 Ga0070672_100302629 3300005543 Bacteria 1356
48 Ga0070696_100549289 3300005546 Bacteria 925
49 Ga0070665_100068265 3300005548 Bacteria 3565
50 Ga0070665_100826189 3300005548 Bacteria 940
51 Ga0068855_100100377 3300005563 Bacteria 3333
52 Ga0068855_100201724 3300005563 Bacteria 2239
53 Ga0068857_100123586 3300005577 Bacteria 2332
54 Ga0068851_10001428 3300005834 Bacteria 10455
55 Ga0068858_100237706 3300005842 Bacteria 1728
56 Ga0081455_10036699 3300005937 Bacteria 4359
57 Ga0081455_10115309 3300005937 Bacteria 2127
58 Ga0081455_10190748 3300005937 Bacteria 1543
59 Ga0081540_1034968 3300005983 Bacteria 2700
60 Ga0081540_1055114 3300005983 Bacteria 1938
61 Ga0070717_10002541 3300006028 Bacteria 12852
62 Ga0070717_10119870 3300006028 Bacteria 2253
63 Ga0070717_10299379 3300006028 Bacteria 1430
64 Ga0070717_10709470 3300006028 Bacteria 914
65 Ga0075365_10537036 3300006038 Bacteria 827
66 Ga0075363_100205874 3300006048 Bacteria 1125
67 Ga0070715_10004204 3300006163 Bacteria 4691
68 Ga0070715_10015497 3300006163 Bacteria 2844
69 Ga0070715_10190495 3300006163 Bacteria 1035
70 Ga0070715_10266554 3300006163 Bacteria 902
71 Ga0070716_100023208 3300006173 Bacteria 3287
72 Ga0070712_100003642 3300006175 Bacteria 9500
73 Ga0070712_100046596 3300006175 Bacteria 2997
74 Ga0070712_100139836 3300006175 Bacteria 1846
75 Ga0070712_100662013 3300006175 Bacteria 888
76 Ga0075362_10403065 3300006177 Bacteria 690
77 Ga0075367_10234752 3300006178 Bacteria 1149
78 Ga0075367_10506670 3300006178 Bacteria 766
79 Ga0075366_10235569 3300006195 Bacteria 1116
80 Ga0075428_100170461 3300006844 Bacteria 2360
81 Ga0075428_100179852 3300006844 Bacteria 2290
82 Ga0075428_101112825 3300006844 Bacteria 834
83 Ga0075430_100132798 3300006846 Bacteria 2075
84 Ga0075431_100037584 3300006847 Bacteria 4986
85 Ga0075431_100484687 3300006847 Bacteria 1229
86 Ga0075434_100228635 3300006871 Bacteria 1879
87 Ga0075434_100368003 3300006871 Bacteria 1458
88 Ga0075436_100475334 3300006914 Bacteria 912
89 Ga0075436_101045231 3300006914 Unclassified 614
90 Ga0075435_100099452 3300007076 Bacteria 2409
91 Ga0075435_100414156 3300007076 Bacteria 1160
92 Ga0099795_10186979 3300007788 Bacteria 868
93 Ga0105240_10097927 3300009093 Bacteria 3573
94 Ga0105245_11279097 3300009098 Bacteria 782
95 Ga0105247_10352963 3300009101 Bacteria 1035
96 Ga0114129_10195432 3300009147 Bacteria 2744
97 Ga0105241_10215643 3300009174 Bacteria 1610
98 Ga0105237_10051620 3300009545 Bacteria 4130
99 Ga0105237_11418275 3300009545 Bacteria 701
100 Ga0105237_11476084 3300009545 Bacteria 686
101 Ga0105238_10002380 3300009551 Bacteria 18868
102 Ga0105238_10698760 3300009551 Bacteria 1026
103 Ga0099796_10024318 3300010159 Bacteria 1901
104 Ga0099796_10181108 3300010159 Bacteria 846
105 Ga0105239_10066019 3300010375 Bacteria 3975
106 Ga0157370_10402233 3300013104 Bacteria 1260
107 Ga0157369_10003624 3300013105 Bacteria 18332
108 Ga0157369_10015770 3300013105 Bacteria 8515
109 Ga0157369_10100990 3300013105 Bacteria 3075
110 Ga0157369_10129096 3300013105 Bacteria 2679
111 Ga0157372_10317110 3300013307 Bacteria 1815
112 Ga0157375_12056446 3300013308 Bacteria 679
113 Ga0182007_10045742 3300015262 Bacteria 1450
114 Ga0197907_11364390 3300020069 Bacteria 666
115 Ga0206351_10423907 3300020077 Bacteria 1329
116 Ga0206350_10539156 3300020080 Bacteria 1289
117 Ga0206350_11057266 3300020080 Bacteria 716
118 Ga0206353_10391993 3300020082 Eukaryota 595
119 Ga0206353_11366159 3300020082 Bacteria 1127
120 Ga0154015_1078261 3300020610 Bacteria 1343
121 Ga0213873_10112551 3300021358 Bacteria 792
122 Ga0213872_10144564 3300021361 Bacteria 1042
123 Ga0213874_10129366 3300021377 Bacteria 865
124 Ga0213876_10008031 3300021384 Bacteria 5720
125 Ga0213875_10000142 3300021388 Bacteria 77423
126 Ga0213875_10254730 3300021388 Unclassified 828
127 Ga0224712_10062729 3300022467 Bacteria 1485
128 Ga0209564_1004563 3300025295 Bacteria 8391
129 Ga0207692_10010343 3300025898 Bacteria 3928
130 Ga0207692_10072089 3300025898 Bacteria 1823
131 Ga0207692_10102370 3300025898 Bacteria 1575
132 Ga0207685_10025105 3300025905 Bacteria 2053
133 Ga0207699_10003338 3300025906 Bacteria 7653
134 Ga0207699_10011007 3300025906 Bacteria 4557
135 Ga0207699_10079908 3300025906 Bacteria 2025
136 Ga0207699_10179527 3300025906 Bacteria 1422
137 Ga0207699_10406072 3300025906 Bacteria 971
138 Ga0207705_10662792 3300025909 Bacteria 811
139 Ga0207684_10093157 3300025910 Bacteria 2569
140 Ga0207654_10386107 3300025911 Bacteria 971
141 Ga0207707_10008321 3300025912 Bacteria 9000
142 Ga0207707_10826664 3300025912 Bacteria 770
143 Ga0207671_10022891 3300025914 Bacteria 4717
144 Ga0207693_10002958 3300025915 Bacteria 14705
145 Ga0207693_10004191 3300025915 Bacteria 12228
146 Ga0207693_10012930 3300025915 Bacteria 6737
147 Ga0207693_10129833 3300025915 Bacteria 1981
148 Ga0207663_10006946 3300025916 Bacteria 5834
149 Ga0207663_10029553 3300025916 Bacteria 3220
150 Ga0207663_10068542 3300025916 Bacteria 2279
151 Ga0207663_10235375 3300025916 Bacteria 1340
152 Ga0207663_10315940 3300025916 Bacteria 1172
153 Ga0207660_10003996 3300025917 Bacteria 9612
154 Ga0207657_10012885 3300025919 Bacteria 8222
155 Ga0207649_10078716 3300025920 Bacteria 2128
156 Ga0207649_10086346 3300025920 Bacteria 2044
157 Ga0207649_10098398 3300025920 Bacteria 1931
158 Ga0207652_10003241 3300025921 Bacteria 13496
159 Ga0207652_10165648 3300025921 Bacteria 1982
160 Ga0207681_10200142 3300025923 Bacteria 1533
161 Ga0207694_10035977 3300025924 Bacteria 3799
162 Ga0207650_10151514 3300025925 Bacteria 1830
163 Ga0207687_10617455 3300025927 Bacteria 915
164 Ga0207700_10072513 3300025928 Bacteria 2656
165 Ga0207700_10160199 3300025928 Bacteria 1868
166 Ga0207700_10228629 3300025928 Bacteria 1580
167 Ga0207700_10636768 3300025928 Bacteria 950
168 Ga0207664_10037729 3300025929 Bacteria 3742
169 Ga0207664_10052948 3300025929 Bacteria 3211
170 Ga0207664_10148351 3300025929 Bacteria 1990
171 Ga0207664_10171317 3300025929 Bacteria 1858
172 Ga0207664_10260358 3300025929 Bacteria 1517
173 Ga0207664_10496383 3300025929 Bacteria 1093
174 Ga0207664_10746603 3300025929 Bacteria 880
175 Ga0207644_10027536 3300025931 Bacteria 3927
176 Ga0207690_10526809 3300025932 Bacteria 958
177 Ga0207670_10093268 3300025936 Bacteria 2133
178 Ga0207665_10010436 3300025939 Bacteria 6102
179 Ga0207665_10021131 3300025939 Bacteria 4278
180 Ga0207665_10565173 3300025939 Bacteria 885
181 Ga0207691_10175337 3300025940 Bacteria 1875
182 Ga0207679_10040974 3300025945 Bacteria 3319
183 Ga0207679_10372032 3300025945 Bacteria 1251
184 Ga0207667_10011866 3300025949 Bacteria 10092
185 Ga0207667_10153080 3300025949 Bacteria 2373
186 Ga0207651_10514061 3300025960 Bacteria 1037
187 Ga0207658_10302602 3300025986 Bacteria 1378
188 Ga0207639_10069015 3300026041 Bacteria 2756
189 Ga0207639_10073882 3300026041 Bacteria 2675
190 Ga0207708_10219918 3300026075 Unclassified 1521
191 Ga0207641_10030690 3300026088 Bacteria 4453
192 Ga0207641_11150144 3300026088 Bacteria 775
193 Ga0207648_10333526 3300026089 Bacteria 1365
194 Ga0207648_10482416 3300026089 Bacteria 1132
195 Ga0207674_10022229 3300026116 Bacteria 6815
196 Ga0207674_11194717 3300026116 Bacteria 730
197 Ga0207698_10107614 3300026142 Bacteria 2328
198 Ga0209179_1034667 3300027512 Bacteria 1047
199 Ga0268266_10054676 3300028379 Bacteria 3431
200 Ga0268266_10209725 3300028379 Bacteria 1786
201 Ga0268264_10419919 3300028381 Bacteria 1289
202 Ga0265339_10061322 3300031249 Bacteria 2024
203 Ga0265339_10128629 3300031249 Bacteria 1297
204 Ga0265316_10098270 3300031344 Bacteria 2228
205 Ga0265314_10055137 3300031711 Bacteria 2747
206 Ga0265342_10008275 3300031712 Bacteria 7488
207 Ga0307510_10097480 3300033180 Bacteria 2750
208 Ga0373941_0106493 3300035115 Bacteria 983
209 Ga0373953_0060055 3300035117 Bacteria 1553
210 Ga0373957_0004013 3300035120 Bacteria 4428
211 Ga0373955_0040931 3300035172 Bacteria 2481
212 Ga0373955_0058335 3300035172 Bacteria 2124
213 Ga0373961_0158486 3300035241 Bacteria 776
214 Ga0373931_0125651 3300035691 Bacteria 1471
215 Ga0373935_0106906 3300035692 Bacteria 1852
216 Ga0373933_0151351 3300035724 Bacteria 1469
217 Ga0373933_0212537 3300035724 Bacteria 1240
218 Ga0373937_0042688 3300036401 Bacteria 4137
219 Ga0373937_0223993 3300036401 Bacteria 1770
220 Ga0373937_0712719 3300036401 Bacteria 950
221 Ga0395898_1284789 3300037466 Eukaryota 661
222 Ga0436364_0585548 3300037853 Bacteria 2249
223 Ga0436364_0602749 3300037853 Bacteria 4409
224 Ga0436364_0786654 3300037853 Bacteria 1597
225 Ga0436364_1344711 3300037853 Bacteria 1653
226 Ga0436364_1464203 3300037853 Bacteria 1219
227 Ga0436364_1547573 3300037853 Bacteria 9374
228 Ga0436365_0960996 3300039437 Bacteria 16654
229 Ga0436365_1289235 3300039437 Bacteria 3456
230 Ga0436365_1675423 3300039437 Bacteria 2007
231 Ga0436365_1698889 3300039437 Bacteria 823
232 Ga0436360_0301354 3300039438 Bacteria 949
233 Ga0436360_0800351 3300039438 Bacteria 1361
234 Ga0436360_0942546 3300039438 Bacteria 1590
235 Ga0436361_0061829 3300039447 Bacteria 837
236 Ga0436361_0246688 3300039447 Bacteria 7893
237 Ga0436363_0680417 3300039450 Bacteria 1296
238 Ga0436363_1278418 3300039450 Bacteria 2015
239 Ga0436362_0807065 3300039453 Bacteria 5208
240 Ga0451833_0236692 3300041491 Bacteria 753
241 Ga0466966_0133295 3300044684 Bacteria 1520
242 Ga0466961_0346608 3300044693 Bacteria 904
243 Ga0466964_0086290 3300044706 Bacteria 1357
244 Ga0466964_0501266 3300044706 Bacteria 652
245 Ga0466957_0219522 3300044842 Bacteria 1255
246 Ga0466957_0874491 3300044842 Bacteria 641
247 Ga0466959_0038300 3300045049 Bacteria 3543
248 Ga0495592_0029853 3300046454 Bacteria 4125
249 Ga0495592_0117875 3300046454 Bacteria 1871
250 Ga0495603_0018617 3300046455 Bacteria 4202
251 Ga0495629_0105841 3300046459 Bacteria 1962
252 Ga0495638_0190984 3300046460 Bacteria 1162
253 Ga0495651_0043443 3300046462 Bacteria 3487
254 Ga0495651_0271467 3300046462 Bacteria 1149
255 Ga0495653_0220696 3300046463 Bacteria 1274
256 Ga0495650_0151574 3300046471 Bacteria 832
257 Ga0495664_0210224 3300046477 Bacteria 1178
258 Ga0495594_0484676 3300046499 Bacteria 703
259 Ga0495608_0035510 3300046511 Bacteria 3362
260 Ga0495618_0014207 3300046514 Bacteria 4849
261 Ga0495618_0034683 3300046514 Bacteria 3166
262 Ga0495628_0204089 3300046516 Bacteria 1488
263 Ga0495628_0377066 3300046516 Bacteria 1039
264 Ga0495628_0716555 3300046516 Bacteria 706
265 Ga0495630_0965431 3300046517 Bacteria 648
266 Ga0495652_0038740 3300046529 Bacteria 4127
267 Ga0495640_0168201 3300046533 Bacteria 1402
268 Ga0495640_0378896 3300046533 Bacteria 871
269 Ga0495587_0018200 3300046536 Bacteria 4357
270 Ga0495587_0430024 3300046536 Bacteria 732
271 Ga0495645_0031137 3300046543 Bacteria 3886
272 Ga0495667_0013626 3300046559 Bacteria 5497
273 Ga0495667_0206022 3300046559 Bacteria 1258
274 Ga0495634_0044945 3300046642 Bacteria 2987
275 Ga0495611_0356667 3300046648 Unclassified 671
276 Ga0495657_0075680 3300046675 Bacteria 2188
277 Ga0495657_0319118 3300046675 Bacteria 924
278 Ga0495599_0012392 3300046678 Bacteria 5254
279 Ga0495599_0073296 3300046678 Bacteria 2137
280 Ga0495599_0481346 3300046678 Bacteria 732
281 Ga0495623_0026547 3300046679 Bacteria 3727
282 Ga0495623_0184996 3300046679 Bacteria 1207
283 Ga0495646_0249474 3300046680 Bacteria 951
284 Ga0495613_0758634 3300046689 Bacteria 635
285 Ga0495600_0081678 3300046809 Bacteria 2109
286 Ga0495660_0178035 3300046810 Bacteria 1031
287 Ga0495604_0030953 3300047317 Bacteria 4246
288 Ga0495674_0202014 3300047319 Bacteria 1648
289 Ga0495674_0329031 3300047319 Bacteria 1243
290 Ga0495672_0019527 3300047320 Bacteria 4468
291 Ga0495675_0033006 3300047444 Bacteria 3303
292 Ga0495675_0052661 3300047444 Bacteria 2584
293 Ga0495602_0025911 3300048088 Bacteria 5667
294 Ga0495602_0514978 3300048088 Bacteria 834
295 Ga0495626_0126851 3300048091 Bacteria 1093
296 Ga0496100_0218742 3300048903 Bacteria 1397
297 Ga0496101_0022803 3300048904 Bacteria 4315
298 Ga0496101_0273059 3300048904 Bacteria 1320
299 Ga0496102_0568194 3300048905 Bacteria 1057
300 Ga0496102_1129476 3300048905 Bacteria 703
301 Ga0496103_0233343 3300048906 Bacteria 1184
302 Ga0496104_0128517 3300048907 Bacteria 2433
303 Ga0496104_0502185 3300048907 Bacteria 1124
304 Ga0496106_0040620 3300048909 Bacteria 3485
305 Ga0496106_0186340 3300048909 Bacteria 1649
306 Ga0496108_1145825 3300048911 Bacteria 659
307 Ga0496109_0117819 3300048912 Bacteria 2472
308 Ga0496111_0405629 3300048914 Bacteria 1007
309 Ga0496111_0961203 3300048914 Unclassified 613
310 Ga0496112_0097256 3300048915 Bacteria 2914
311 Ga0496113_0592058 3300048916 Bacteria 888
312 Ga0496115_0164739 3300048918 Bacteria 1833
313 Ga0496115_0182080 3300048918 Bacteria 1737
314 Ga0496125_0251564 3300048928 Bacteria 1114
315 Ga0496126_0102902 3300048929 Bacteria 2496
316 Ga0496126_0389875 3300048929 Bacteria 1132
317 Ga0501031_0020065 3300049568 Bacteria 4357
318 Ga0501032_0068292 3300049569 Bacteria 2373
319 Ga0501032_0381051 3300049569 Bacteria 907
320 Ga0501033_0051412 3300049570 Bacteria 3055
321 Ga0501033_0085932 3300049570 Bacteria 2303
322 Ga0501034_0166201 3300049571 Bacteria 2175
323 Ga0501034_0184123 3300049571 Bacteria 2052
324 Ga0501034_0942176 3300049571 Bacteria 750
325 Ga0501034_1260441 3300049571 Bacteria 617
326 Ga0501036_0010793 3300049572 Bacteria 7549
327 Ga0501037_0012652 3300049573 Bacteria 6218
328 Ga0501038_0041753 3300049574 Bacteria 3999
329 Ga0501039_0015448 3300049575 Bacteria 5844
330 Ga0501040_0950157 3300049576 Bacteria 623
331 Ga0501042_0012263 3300049578 Bacteria 5801
332 Ga0501043_0015768 3300049579 Bacteria 5924
333 Ga0501043_0121045 3300049579 Bacteria 2052
334 Ga0501046_0020667 3300049580 Bacteria 5442
335 Ga0501046_0807334 3300049580 Bacteria 657
336 Ga0501048_0009058 3300049582 Bacteria 7491
337 Ga0501067_0054069 3300049583 Bacteria 2225
338 Ga0501068_0016317 3300049584 Bacteria 4280
339 Ga0501069_0006875 3300049585 Bacteria 5949
340 Ga0501069_0359631 3300049585 Bacteria 859
341 Ga0501071_0017585 3300049587 Bacteria 4934
342 Ga0501072_0169434 3300049588 Bacteria 1743
343 Ga0501072_0212811 3300049588 Unclassified 1540
344 Ga0501073_0096527 3300049589 Bacteria 2052
345 Ga0501079_0055700 3300049741 Bacteria 3051
346 Ga0501079_0311796 3300049741 Bacteria 1231
347 Ga0501080_0026383 3300049742 Bacteria 5399
348 Ga0501080_0362021 3300049742 Bacteria 1309
349 Ga0501083_0021738 3300049744 Bacteria 4456
350 Ga0501035_0146242 3300049822 Bacteria 2052
351 Ga0501035_0628877 3300049822 Bacteria 872
352 Ga0501044_0046864 3300049823 Bacteria 4473
353 Ga0501044_0115149 3300049823 Bacteria 2693
354 Ga0501044_0396955 3300049823 Bacteria 1292
355 Ga0501045_0046051 3300049824 Bacteria 3176
356 Ga0501045_0317936 3300049824 Bacteria 1158
357 nmdc:mga03n38_95784_c1 3300050490 Bacteria 1422
358 nmdc:mga0yw44_629642_c1 3300050492 Unclassified 729
359 nmdc:mga0k408_130107_c1 3300050493 Bacteria 1494
360 nmdc:mga06z11_464624_c1 3300050494 Bacteria 765
361 nmdc:mga07m45_463056_c1 3300050496 Bacteria 735
362 nmdc:mga05p37_277556_c1 3300050507 Bacteria 2000
363 nmdc:mga06r32_469792_c1 3300050510 Bacteria 1236
364 nmdc:mga06r32_69603_c1 3300050510 Bacteria 3401
365 nmdc:mga0n895_162079_c1 3300050512 Bacteria 2268
366 nmdc:mga0n895_179911_c1 3300050512 Bacteria 2146
367 nmdc:mga0n895_193247_c1 3300050512 Bacteria 2066
368 nmdc:mga0n895_19346_c1 3300050512 Bacteria 2422
369 nmdc:mga0n895_817620_c1 3300050512 Bacteria 921
370 nmdc:mga0rr50_1027417_c1 3300050513 Unclassified 702
371 nmdc:mga08x19_417705_c1 3300050514 Bacteria 942
372 nmdc:mga08x19_859617_c1 3300050514 Unclassified 644
373 Ga0495601_0107890 3300053077 Bacteria 1801
374 Ga0495601_0114723 3300053077 Bacteria 1746
375 Ga0495612_0062872 3300053078 Bacteria 1539
376 Ga0495612_0103775 3300053078 Bacteria 1212
377 Ga0500635_0006990 3300053080 Bacteria 3040
378 Ga0495595_0012978 3300053084 Bacteria 3514
379 Ga0495595_0021964 3300053084 Bacteria 2795
380 Ga0495595_0109644 3300053084 Bacteria 1337
381 Ga0495619_0042002 3300053085 Bacteria 2993
382 Ga0495619_0288490 3300053085 Bacteria 1137
383 Ga0500644_0044559 3300053088 Bacteria 1490
384 Ga0500651_0013117 3300053093 Bacteria 5038
385 Ga0500641_0099586 3300053096 Bacteria 1246
386 Ga0500554_003066 3300053102 Bacteria 3370
387 Ga0500594_0037234 3300053118 Bacteria 1313
388 Ga0500595_002906 3300053119 Bacteria 8201
389 Ga0500642_0003535 3300053130 Bacteria 4740
390 Ga0500603_004856 3300053150 Bacteria 2878
391 Ga0500604_0229322 3300053151 Bacteria 641
392 Ga0500622_0025347 3300053156 Bacteria 3133
393 Ga0500627_0189151 3300053158 Bacteria 925
394 Ga0500636_0013231 3300053177 Bacteria 4842
395 Ga0500636_0112231 3300053177 Bacteria 1539
396 Ga0500637_0035803 3300053178 Bacteria 2784
397 Ga0500601_004650 3300053737 Bacteria 1499
398 Ga0466962_0041918 3300061719 Bacteria 2190

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046689 Ga0495613_0758634 Ga0495613_0758634_23_478 149
2 3300048904 Ga0496101_0273059 Ga0496101_0273059_55_507 150
3 3300048905 Ga0496102_1129476 Ga0496102_1129476_48_500 150
4 3300048906 Ga0496103_0233343 Ga0496103_0233343_698_1150 150
5 3300048907 Ga0496104_0128517 Ga0496104_0128517_102_554 150
6 3300048909 Ga0496106_0040620 Ga0496106_0040620_1152_1604 150
7 3300048912 Ga0496109_0117819 Ga0496109_0117819_259_711 150
8 3300048918 Ga0496115_0182080 Ga0496115_0182080_486_938 150
9 3300046810 Ga0495660_0178035 Ga0495660_0178035_537_1004 154
10 3300010159 Ga0099796_10181108 Ga0099796_101811081 161
11 3300039438 Ga0436360_0301354 Ga0436360_0301354_12_518 161
12 3300048904 Ga0496101_0022803 Ga0496101_0022803_3303_3809 161
13 3300048905 Ga0496102_0568194 Ga0496102_0568194_190_696 161
14 3300048914 Ga0496111_0961203 Ga0496111_0961203_17_523 161
15 3300050512 nmdc:mga0n895_162079_c1 nmdc:mga0n895_162079_c1_955_1494 161
16 3300050512 nmdc:mga0n895_179911_c1 nmdc:mga0n895_179911_c1_675_1181 161
17 3300050514 nmdc:mga08x19_859617_c1 nmdc:mga08x19_859617_c1_97_603 161
18 3300025912 Ga0207707_10826664 Ga0207707_108266641 169
19 3300006844 Ga0075428_100170461 Ga0075428_1001704612 170
20 3300006847 Ga0075431_100484687 Ga0075431_1004846872 170
21 3300025295 Ga0209564_1004563 Ga0209564_10045634 170
22 3300026075 Ga0207708_10219918 Ga0207708_102199183 170
23 3300026089 Ga0207648_10333526 Ga0207648_103335261 170
24 3300049571 Ga0501034_0942176 Ga0501034_0942176_67_585 170
25 3300049741 Ga0501079_0311796 Ga0501079_0311796_494_1024 170
26 3300049742 Ga0501080_0362021 Ga0501080_0362021_399_917 170
27 3300049824 Ga0501045_0317936 Ga0501045_0317936_303_833 170
28 3300050507 nmdc:mga05p37_277556_c1 nmdc:mga05p37_277556_c1_1132_1650 170
29 3300050510 nmdc:mga06r32_469792_c1 nmdc:mga06r32_469792_c1_429_947 170
30 3300005530 Ga0070679_100233154 Ga0070679_1002331543 171
31 3300025921 Ga0207652_10165648 Ga0207652_101656482 171
32 3300050494 nmdc:mga06z11_464624_c1 nmdc:mga06z11_464624_c1_87_608 171
33 3300005435 Ga0070714_100410882 Ga0070714_1004108822 172
34 3300005548 Ga0070665_100826189 Ga0070665_1008261892 172
35 3300005937 Ga0081455_10115309 Ga0081455_101153092 172
36 3300006163 Ga0070715_10004204 Ga0070715_100042044 172
37 3300006177 Ga0075362_10403065 Ga0075362_104030652 172
38 3300021388 Ga0213875_10000142 Ga0213875_1000014274 172
39 3300025929 Ga0207664_10260358 Ga0207664_102603582 172
40 3300026088 Ga0207641_11150144 Ga0207641_111501442 172
41 3300028379 Ga0268266_10209725 Ga0268266_102097252 172
42 3300028381 Ga0268264_10419919 Ga0268264_104199192 172
43 3300035172 Ga0373955_0058335 Ga0373955_0058335_673_1197 172
44 3300035692 Ga0373935_0106906 Ga0373935_0106906_611_1135 172
45 3300036401 Ga0373937_0712719 Ga0373937_0712719_114_638 172
46 3300037853 Ga0436364_1464203 Ga0436364_1464203_683_1204 172
47 3300037853 Ga0436364_1547573 Ga0436364_1547573_2545_3066 172
48 3300039437 Ga0436365_1289235 Ga0436365_1289235_753_1274 172
49 3300039437 Ga0436365_1698889 Ga0436365_1698889_78_599 172
50 3300039438 Ga0436360_0800351 Ga0436360_0800351_797_1318 172
51 3300046516 Ga0495628_0377066 Ga0495628_0377066_29_553 172
52 3300046533 Ga0495640_0378896 Ga0495640_0378896_109_633 172
53 3300046559 Ga0495667_0206022 Ga0495667_0206022_114_638 172
54 3300048088 Ga0495602_0514978 Ga0495602_0514978_58_582 172
55 3300049588 Ga0501072_0169434 Ga0501072_0169434_529_1053 172
56 3300053078 Ga0495612_0062872 Ga0495612_0062872_360_884 172
57 3300053084 Ga0495595_0109644 Ga0495595_0109644_195_719 172
58 3300053085 Ga0495619_0042002 Ga0495619_0042002_2010_2534 172
59 3300005353 Ga0070669_100193403 Ga0070669_1001934032 173
60 3300005364 Ga0070673_101066607 Ga0070673_1010666071 173
61 3300005366 Ga0070659_100621496 Ga0070659_1006214961 173
62 3300005435 Ga0070714_100016720 Ga0070714_1000167203 173
63 3300005459 Ga0068867_100518097 Ga0068867_1005180972 173
64 3300006028 Ga0070717_10119870 Ga0070717_101198702 173
65 3300015262 Ga0182007_10045742 Ga0182007_100457422 173
66 3300020080 Ga0206350_10539156 Ga0206350_105391562 173
67 3300020082 Ga0206353_10391993 Ga0206353_103919931 173
68 3300022467 Ga0224712_10062729 Ga0224712_100627291 173
69 3300025906 Ga0207699_10406072 Ga0207699_104060722 173
70 3300025923 Ga0207681_10200142 Ga0207681_102001422 173
71 3300025929 Ga0207664_10037729 Ga0207664_100377296 173
72 3300025939 Ga0207665_10565173 Ga0207665_105651732 173
73 3300025945 Ga0207679_10372032 Ga0207679_103720322 173
74 3300025960 Ga0207651_10514061 Ga0207651_105140611 173
75 3300026089 Ga0207648_10482416 Ga0207648_104824162 173
76 3300026116 Ga0207674_11194717 Ga0207674_111947172 173
77 3300031249 Ga0265339_10061322 Ga0265339_100613222 173
78 3300031711 Ga0265314_10055137 Ga0265314_100551372 173
79 3300031712 Ga0265342_10008275 Ga0265342_100082754 173
80 3300035115 Ga0373941_0106493 Ga0373941_0106493_384_911 173
81 3300035724 Ga0373933_0212537 Ga0373933_0212537_673_1200 173
82 3300037466 Ga0395898_1284789 Ga0395898_1284789_102_623 173
83 3300037853 Ga0436364_1344711 Ga0436364_1344711_202_726 173
84 3300046460 Ga0495638_0190984 Ga0495638_0190984_132_653 173
85 3300046648 Ga0495611_0356667 Ga0495611_0356667_29_556 173
86 3300048929 Ga0496126_0102902 Ga0496126_0102902_1340_1861 173
87 3300049585 Ga0501069_0359631 Ga0501069_0359631_271_798 173
88 3300053085 Ga0495619_0288490 Ga0495619_0288490_269_796 173
89 3300053088 Ga0500644_0044559 Ga0500644_0044559_676_1197 173
90 3300053093 Ga0500651_0013117 Ga0500651_0013117_2902_3423 173
91 3300053096 Ga0500641_0099586 Ga0500641_0099586_686_1207 173
92 3300053118 Ga0500594_0037234 Ga0500594_0037234_346_867 173
93 3300053119 Ga0500595_002906 Ga0500595_002906_3390_3911 173
94 3300053130 Ga0500642_0003535 Ga0500642_0003535_686_1207 173
95 3300053151 Ga0500604_0229322 Ga0500604_0229322_79_600 173
96 3300053156 Ga0500622_0025347 Ga0500622_0025347_11_532 173
97 3300053158 Ga0500627_0189151 Ga0500627_0189151_154_675 173
98 3300053177 Ga0500636_0112231 Ga0500636_0112231_184_795 173
99 3300003323 rootH1_10074013 rootH1_100740134 174
100 3300005337 Ga0070682_100094467 Ga0070682_1000944673 174
101 3300005339 Ga0070660_100039424 Ga0070660_1000394246 174
102 3300005341 Ga0070691_10088317 Ga0070691_100883172 174
103 3300005344 Ga0070661_100017917 Ga0070661_1000179176 174
104 3300005344 Ga0070661_100504336 Ga0070661_1005043362 174
105 3300005345 Ga0070692_10314896 Ga0070692_103148962 174
106 3300005355 Ga0070671_100008192 Ga0070671_1000081925 174
107 3300005366 Ga0070659_100029711 Ga0070659_1000297112 174
108 3300005366 Ga0070659_100162791 Ga0070659_1001627911 174
109 3300005434 Ga0070709_10000542 Ga0070709_100005427 174
110 3300005434 Ga0070709_10003605 Ga0070709_100036057 174
111 3300005434 Ga0070709_10006777 Ga0070709_100067776 174
112 3300005434 Ga0070709_10083568 Ga0070709_100835682 174
113 3300005435 Ga0070714_100006564 Ga0070714_10000656410 174
114 3300005435 Ga0070714_100014271 Ga0070714_1000142712 174
115 3300005435 Ga0070714_100120650 Ga0070714_1001206502 174
116 3300005435 Ga0070714_100213742 Ga0070714_1002137422 174
117 3300005436 Ga0070713_100026489 Ga0070713_1000264894 174
118 3300005436 Ga0070713_100087689 Ga0070713_1000876893 174
119 3300005436 Ga0070713_100095395 Ga0070713_1000953951 174
120 3300005436 Ga0070713_100199706 Ga0070713_1001997062 174
121 3300005436 Ga0070713_100382498 Ga0070713_1003824982 174
122 3300005436 Ga0070713_100434558 Ga0070713_1004345582 174
123 3300005437 Ga0070710_10000520 Ga0070710_1000052015 174
124 3300005437 Ga0070710_10019952 Ga0070710_100199524 174
125 3300005439 Ga0070711_100007912 Ga0070711_1000079123 174
126 3300005439 Ga0070711_100010444 Ga0070711_1000104444 174
127 3300005439 Ga0070711_100026430 Ga0070711_1000264303 174
128 3300005439 Ga0070711_100028745 Ga0070711_1000287452 174
129 3300005439 Ga0070711_100041663 Ga0070711_1000416634 174
130 3300005455 Ga0070663_100033165 Ga0070663_1000331653 174
131 3300005467 Ga0070706_100364702 Ga0070706_1003647021 174
132 3300005518 Ga0070699_100046830 Ga0070699_1000468303 174
133 3300005530 Ga0070679_100063425 Ga0070679_1000634252 174
134 3300005535 Ga0070684_100314627 Ga0070684_1003146272 174
135 3300005535 Ga0070684_101824882 Ga0070684_1018248821 174
136 3300005536 Ga0070697_100118550 Ga0070697_1001185502 174
137 3300005539 Ga0068853_100002730 Ga0068853_1000027303 174
138 3300005543 Ga0070672_100302629 Ga0070672_1003026292 174
139 3300005546 Ga0070696_100549289 Ga0070696_1005492891 174
140 3300005548 Ga0070665_100068265 Ga0070665_1000682652 174
141 3300005563 Ga0068855_100100377 Ga0068855_1001003776 174
142 3300005563 Ga0068855_100201724 Ga0068855_1002017243 174
143 3300005577 Ga0068857_100123586 Ga0068857_1001235863 174
144 3300005834 Ga0068851_10001428 Ga0068851_1000142813 174
145 3300005842 Ga0068858_100237706 Ga0068858_1002377062 174
146 3300005937 Ga0081455_10036699 Ga0081455_100366992 174
147 3300005937 Ga0081455_10190748 Ga0081455_101907483 174
148 3300005983 Ga0081540_1034968 Ga0081540_10349682 174
149 3300005983 Ga0081540_1055114 Ga0081540_10551143 174
150 3300006028 Ga0070717_10002541 Ga0070717_100025416 174
151 3300006028 Ga0070717_10299379 Ga0070717_102993793 174
152 3300006028 Ga0070717_10709470 Ga0070717_107094701 174
153 3300006038 Ga0075365_10537036 Ga0075365_105370361 174
154 3300006048 Ga0075363_100205874 Ga0075363_1002058742 174
155 3300006163 Ga0070715_10015497 Ga0070715_100154973 174
156 3300006163 Ga0070715_10190495 Ga0070715_101904952 174
157 3300006163 Ga0070715_10266554 Ga0070715_102665541 174
158 3300006173 Ga0070716_100023208 Ga0070716_1000232084 174
159 3300006175 Ga0070712_100003642 Ga0070712_1000036428 174
160 3300006175 Ga0070712_100046596 Ga0070712_1000465962 174
161 3300006175 Ga0070712_100139836 Ga0070712_1001398362 174
162 3300006175 Ga0070712_100662013 Ga0070712_1006620132 174
163 3300006178 Ga0075367_10234752 Ga0075367_102347522 174
164 3300006178 Ga0075367_10506670 Ga0075367_105066702 174
165 3300006195 Ga0075366_10235569 Ga0075366_102355691 174
166 3300006844 Ga0075428_100179852 Ga0075428_1001798523 174
167 3300006844 Ga0075428_101112825 Ga0075428_1011128251 174
168 3300006846 Ga0075430_100132798 Ga0075430_1001327983 174
169 3300006847 Ga0075431_100037584 Ga0075431_1000375844 174
170 3300006871 Ga0075434_100228635 Ga0075434_1002286352 174
171 3300006871 Ga0075434_100368003 Ga0075434_1003680031 174
172 3300006914 Ga0075436_100475334 Ga0075436_1004753342 174
173 3300006914 Ga0075436_101045231 Ga0075436_1010452311 174
174 3300007076 Ga0075435_100099452 Ga0075435_1000994523 174
175 3300007076 Ga0075435_100414156 Ga0075435_1004141563 174
176 3300007788 Ga0099795_10186979 Ga0099795_101869792 174
177 3300009093 Ga0105240_10097927 Ga0105240_100979273 174
178 3300009098 Ga0105245_11279097 Ga0105245_112790972 174
179 3300009101 Ga0105247_10352963 Ga0105247_103529633 174
180 3300009147 Ga0114129_10195432 Ga0114129_101954323 174
181 3300009174 Ga0105241_10215643 Ga0105241_102156432 174
182 3300009545 Ga0105237_10051620 Ga0105237_100516205 174
183 3300009545 Ga0105237_11418275 Ga0105237_114182751 174
184 3300009545 Ga0105237_11476084 Ga0105237_114760841 174
185 3300009551 Ga0105238_10002380 Ga0105238_1000238011 174
186 3300009551 Ga0105238_10698760 Ga0105238_106987602 174
187 3300010159 Ga0099796_10024318 Ga0099796_100243181 174
188 3300010375 Ga0105239_10066019 Ga0105239_100660196 174
189 3300013104 Ga0157370_10402233 Ga0157370_104022332 174
190 3300013105 Ga0157369_10003624 Ga0157369_100036242 174
191 3300013105 Ga0157369_10015770 Ga0157369_100157705 174
192 3300013105 Ga0157369_10100990 Ga0157369_101009903 174
193 3300013105 Ga0157369_10129096 Ga0157369_101290963 174
194 3300013307 Ga0157372_10317110 Ga0157372_103171102 174
195 3300013308 Ga0157375_12056446 Ga0157375_120564461 174
196 3300020069 Ga0197907_11364390 Ga0197907_113643901 174
197 3300020077 Ga0206351_10423907 Ga0206351_104239072 174
198 3300020080 Ga0206350_11057266 Ga0206350_110572662 174
199 3300020082 Ga0206353_11366159 Ga0206353_113661592 174
200 3300020610 Ga0154015_1078261 Ga0154015_10782612 174
201 3300021358 Ga0213873_10112551 Ga0213873_101125511 174
202 3300021361 Ga0213872_10144564 Ga0213872_101445641 174
203 3300021377 Ga0213874_10129366 Ga0213874_101293661 174
204 3300021384 Ga0213876_10008031 Ga0213876_100080314 174
205 3300021388 Ga0213875_10254730 Ga0213875_102547302 174
206 3300025898 Ga0207692_10010343 Ga0207692_100103433 174
207 3300025898 Ga0207692_10072089 Ga0207692_100720892 174
208 3300025898 Ga0207692_10102370 Ga0207692_101023702 174
209 3300025905 Ga0207685_10025105 Ga0207685_100251051 174
210 3300025906 Ga0207699_10003338 Ga0207699_100033386 174
211 3300025906 Ga0207699_10011007 Ga0207699_100110074 174
212 3300025906 Ga0207699_10079908 Ga0207699_100799082 174
213 3300025906 Ga0207699_10179527 Ga0207699_101795272 174
214 3300025909 Ga0207705_10662792 Ga0207705_106627921 174
215 3300025910 Ga0207684_10093157 Ga0207684_100931572 174
216 3300025911 Ga0207654_10386107 Ga0207654_103861072 174
217 3300025912 Ga0207707_10008321 Ga0207707_100083213 174
218 3300025914 Ga0207671_10022891 Ga0207671_100228912 174
219 3300025915 Ga0207693_10002958 Ga0207693_100029588 174
220 3300025915 Ga0207693_10004191 Ga0207693_100041919 174
221 3300025915 Ga0207693_10012930 Ga0207693_100129305 174
222 3300025915 Ga0207693_10129833 Ga0207693_101298332 174
223 3300025916 Ga0207663_10006946 Ga0207663_100069461 174
224 3300025916 Ga0207663_10029553 Ga0207663_100295534 174
225 3300025916 Ga0207663_10068542 Ga0207663_100685422 174
226 3300025916 Ga0207663_10235375 Ga0207663_102353752 174
227 3300025916 Ga0207663_10315940 Ga0207663_103159401 174
228 3300025917 Ga0207660_10003996 Ga0207660_100039963 174
229 3300025919 Ga0207657_10012885 Ga0207657_100128852 174
230 3300025920 Ga0207649_10078716 Ga0207649_100787162 174
231 3300025920 Ga0207649_10086346 Ga0207649_100863463 174
232 3300025920 Ga0207649_10098398 Ga0207649_100983982 174
233 3300025921 Ga0207652_10003241 Ga0207652_1000324114 174
234 3300025924 Ga0207694_10035977 Ga0207694_100359776 174
235 3300025925 Ga0207650_10151514 Ga0207650_101515143 174
236 3300025927 Ga0207687_10617455 Ga0207687_106174552 174
237 3300025928 Ga0207700_10072513 Ga0207700_100725132 174
238 3300025928 Ga0207700_10160199 Ga0207700_101601993 174
239 3300025928 Ga0207700_10228629 Ga0207700_102286292 174
240 3300025928 Ga0207700_10636768 Ga0207700_106367682 174
241 3300025929 Ga0207664_10052948 Ga0207664_100529482 174
242 3300025929 Ga0207664_10148351 Ga0207664_101483512 174
243 3300025929 Ga0207664_10171317 Ga0207664_101713171 174
244 3300025929 Ga0207664_10496383 Ga0207664_104963832 174
245 3300025929 Ga0207664_10746603 Ga0207664_107466031 174
246 3300025931 Ga0207644_10027536 Ga0207644_100275366 174
247 3300025932 Ga0207690_10526809 Ga0207690_105268092 174
248 3300025936 Ga0207670_10093268 Ga0207670_100932682 174
249 3300025939 Ga0207665_10010436 Ga0207665_100104363 174
250 3300025939 Ga0207665_10021131 Ga0207665_100211312 174
251 3300025940 Ga0207691_10175337 Ga0207691_101753372 174
252 3300025945 Ga0207679_10040974 Ga0207679_100409744 174
253 3300025949 Ga0207667_10011866 Ga0207667_1001186610 174
254 3300025949 Ga0207667_10153080 Ga0207667_101530803 174
255 3300025986 Ga0207658_10302602 Ga0207658_103026022 174
256 3300026041 Ga0207639_10069015 Ga0207639_100690153 174
257 3300026041 Ga0207639_10073882 Ga0207639_100738822 174
258 3300026088 Ga0207641_10030690 Ga0207641_100306901 174
259 3300026116 Ga0207674_10022229 Ga0207674_100222294 174
260 3300026142 Ga0207698_10107614 Ga0207698_101076142 174
261 3300027512 Ga0209179_1034667 Ga0209179_10346672 174
262 3300028379 Ga0268266_10054676 Ga0268266_100546762 174
263 3300031249 Ga0265339_10128629 Ga0265339_101286292 174
264 3300031344 Ga0265316_10098270 Ga0265316_100982702 174
265 3300033180 Ga0307510_10097480 Ga0307510_100974803 174
266 3300035117 Ga0373953_0060055 Ga0373953_0060055_494_1024 174
267 3300035120 Ga0373957_0004013 Ga0373957_0004013_2181_2711 174
268 3300035172 Ga0373955_0040931 Ga0373955_0040931_1598_2128 174
269 3300035241 Ga0373961_0158486 Ga0373961_0158486_162_692 174
270 3300035691 Ga0373931_0125651 Ga0373931_0125651_539_1072 174
271 3300035724 Ga0373933_0151351 Ga0373933_0151351_706_1236 174
272 3300036401 Ga0373937_0042688 Ga0373937_0042688_470_1000 174
273 3300036401 Ga0373937_0223993 Ga0373937_0223993_995_1525 174
274 3300037853 Ga0436364_0585548 Ga0436364_0585548_1499_2029 174
275 3300037853 Ga0436364_0602749 Ga0436364_0602749_1689_2219 174
276 3300037853 Ga0436364_0786654 Ga0436364_0786654_135_665 174
277 3300039437 Ga0436365_0960996 Ga0436365_0960996_23_550 174
278 3300039437 Ga0436365_1675423 Ga0436365_1675423_39_569 174
279 3300039438 Ga0436360_0942546 Ga0436360_0942546_284_811 174
280 3300039447 Ga0436361_0061829 Ga0436361_0061829_82_642 174
281 3300039447 Ga0436361_0246688 Ga0436361_0246688_1949_2578 174
282 3300039450 Ga0436363_0680417 Ga0436363_0680417_338_862 174
283 3300039450 Ga0436363_1278418 Ga0436363_1278418_151_702 174
284 3300039453 Ga0436362_0807065 Ga0436362_0807065_2029_2556 174
285 3300041491 Ga0451833_0236692 Ga0451833_0236692_20_586 174
286 3300044684 Ga0466966_0133295 Ga0466966_0133295_545_1102 174
287 3300044693 Ga0466961_0346608 Ga0466961_0346608_69_599 174
288 3300044706 Ga0466964_0086290 Ga0466964_0086290_95_640 174
289 3300044706 Ga0466964_0501266 Ga0466964_0501266_108_638 174
290 3300044842 Ga0466957_0219522 Ga0466957_0219522_365_925 174
291 3300044842 Ga0466957_0874491 Ga0466957_0874491_29_586 174
292 3300045049 Ga0466959_0038300 Ga0466959_0038300_154_711 174
293 3300046454 Ga0495592_0029853 Ga0495592_0029853_473_1003 174
294 3300046454 Ga0495592_0117875 Ga0495592_0117875_1301_1831 174
295 3300046455 Ga0495603_0018617 Ga0495603_0018617_2553_3083 174
296 3300046459 Ga0495629_0105841 Ga0495629_0105841_1352_1882 174
297 3300046462 Ga0495651_0043443 Ga0495651_0043443_1166_1696 174
298 3300046462 Ga0495651_0271467 Ga0495651_0271467_591_1121 174
299 3300046463 Ga0495653_0220696 Ga0495653_0220696_619_1149 174
300 3300046471 Ga0495650_0151574 Ga0495650_0151574_89_613 174
301 3300046477 Ga0495664_0210224 Ga0495664_0210224_494_1024 174
302 3300046499 Ga0495594_0484676 Ga0495594_0484676_94_624 174
303 3300046511 Ga0495608_0035510 Ga0495608_0035510_2108_2638 174
304 3300046514 Ga0495618_0014207 Ga0495618_0014207_3633_4163 174
305 3300046514 Ga0495618_0034683 Ga0495618_0034683_2327_2857 174
306 3300046516 Ga0495628_0204089 Ga0495628_0204089_647_1183 174
307 3300046516 Ga0495628_0716555 Ga0495628_0716555_29_559 174
308 3300046517 Ga0495630_0965431 Ga0495630_0965431_57_587 174
309 3300046529 Ga0495652_0038740 Ga0495652_0038740_3150_3680 174
310 3300046533 Ga0495640_0168201 Ga0495640_0168201_746_1282 174
311 3300046536 Ga0495587_0018200 Ga0495587_0018200_3355_3885 174
312 3300046536 Ga0495587_0430024 Ga0495587_0430024_177_713 174
313 3300046543 Ga0495645_0031137 Ga0495645_0031137_56_586 174
314 3300046559 Ga0495667_0013626 Ga0495667_0013626_2212_2742 174
315 3300046642 Ga0495634_0044945 Ga0495634_0044945_1517_2047 174
316 3300046675 Ga0495657_0075680 Ga0495657_0075680_782_1312 174
317 3300046675 Ga0495657_0319118 Ga0495657_0319118_171_701 174
318 3300046678 Ga0495599_0012392 Ga0495599_0012392_405_935 174
319 3300046678 Ga0495599_0073296 Ga0495599_0073296_681_1217 174
320 3300046678 Ga0495599_0481346 Ga0495599_0481346_114_644 174
321 3300046679 Ga0495623_0026547 Ga0495623_0026547_1213_1743 174
322 3300046679 Ga0495623_0184996 Ga0495623_0184996_584_1114 174
323 3300046680 Ga0495646_0249474 Ga0495646_0249474_287_817 174
324 3300046809 Ga0495600_0081678 Ga0495600_0081678_55_585 174
325 3300047317 Ga0495604_0030953 Ga0495604_0030953_2324_2854 174
326 3300047319 Ga0495674_0202014 Ga0495674_0202014_878_1408 174
327 3300047319 Ga0495674_0329031 Ga0495674_0329031_440_970 174
328 3300047320 Ga0495672_0019527 Ga0495672_0019527_2962_3492 174
329 3300047444 Ga0495675_0033006 Ga0495675_0033006_612_1142 174
330 3300047444 Ga0495675_0052661 Ga0495675_0052661_1312_1842 174
331 3300048088 Ga0495602_0025911 Ga0495602_0025911_3097_3627 174
332 3300048091 Ga0495626_0126851 Ga0495626_0126851_53_583 174
333 3300048903 Ga0496100_0218742 Ga0496100_0218742_525_1055 174
334 3300048907 Ga0496104_0502185 Ga0496104_0502185_314_844 174
335 3300048909 Ga0496106_0186340 Ga0496106_0186340_866_1396 174
336 3300048911 Ga0496108_1145825 Ga0496108_1145825_31_561 174
337 3300048914 Ga0496111_0405629 Ga0496111_0405629_30_566 174
338 3300048915 Ga0496112_0097256 Ga0496112_0097256_1590_2120 174
339 3300048916 Ga0496113_0592058 Ga0496113_0592058_348_878 174
340 3300048918 Ga0496115_0164739 Ga0496115_0164739_1245_1769 174
341 3300048928 Ga0496125_0251564 Ga0496125_0251564_453_980 174
342 3300048929 Ga0496126_0389875 Ga0496126_0389875_54_581 174
343 3300049568 Ga0501031_0020065 Ga0501031_0020065_153_707 174
344 3300049569 Ga0501032_0068292 Ga0501032_0068292_734_1288 174
345 3300049569 Ga0501032_0381051 Ga0501032_0381051_322_852 174
346 3300049570 Ga0501033_0051412 Ga0501033_0051412_350_880 174
347 3300049570 Ga0501033_0085932 Ga0501033_0085932_857_1411 174
348 3300049571 Ga0501034_0166201 Ga0501034_0166201_332_862 174
349 3300049571 Ga0501034_0184123 Ga0501034_0184123_765_1319 174
350 3300049571 Ga0501034_1260441 Ga0501034_1260441_69_599 174
351 3300049572 Ga0501036_0010793 Ga0501036_0010793_4921_5475 174
352 3300049573 Ga0501037_0012652 Ga0501037_0012652_4358_4912 174
353 3300049574 Ga0501038_0041753 Ga0501038_0041753_1822_2376 174
354 3300049575 Ga0501039_0015448 Ga0501039_0015448_1120_1674 174
355 3300049576 Ga0501040_0950157 Ga0501040_0950157_57_611 174
356 3300049578 Ga0501042_0012263 Ga0501042_0012263_3507_4061 174
357 3300049579 Ga0501043_0015768 Ga0501043_0015768_1080_1610 174
358 3300049579 Ga0501043_0121045 Ga0501043_0121045_734_1288 174
359 3300049580 Ga0501046_0020667 Ga0501046_0020667_2745_3299 174
360 3300049580 Ga0501046_0807334 Ga0501046_0807334_33_563 174
361 3300049582 Ga0501048_0009058 Ga0501048_0009058_6077_6631 174
362 3300049583 Ga0501067_0054069 Ga0501067_0054069_495_1049 174
363 3300049584 Ga0501068_0016317 Ga0501068_0016317_1812_2366 174
364 3300049585 Ga0501069_0006875 Ga0501069_0006875_3146_3700 174
365 3300049587 Ga0501071_0017585 Ga0501071_0017585_1898_2452 174
366 3300049588 Ga0501072_0212811 Ga0501072_0212811_220_774 174
367 3300049589 Ga0501073_0096527 Ga0501073_0096527_765_1319 174
368 3300049741 Ga0501079_0055700 Ga0501079_0055700_630_1184 174
369 3300049742 Ga0501080_0026383 Ga0501080_0026383_752_1306 174
370 3300049744 Ga0501083_0021738 Ga0501083_0021738_1807_2361 174
371 3300049822 Ga0501035_0146242 Ga0501035_0146242_734_1288 174
372 3300049822 Ga0501035_0628877 Ga0501035_0628877_327_857 174
373 3300049823 Ga0501044_0046864 Ga0501044_0046864_860_1390 174
374 3300049823 Ga0501044_0115149 Ga0501044_0115149_734_1288 174
375 3300049823 Ga0501044_0396955 Ga0501044_0396955_481_1011 174
376 3300049824 Ga0501045_0046051 Ga0501045_0046051_118_672 174
377 3300050490 nmdc:mga03n38_95784_c1 nmdc:mga03n38_95784_c1_69_614 174
378 3300050492 nmdc:mga0yw44_629642_c1 nmdc:mga0yw44_629642_c1_33_578 174
379 3300050493 nmdc:mga0k408_130107_c1 nmdc:mga0k408_130107_c1_133_666 174
380 3300050496 nmdc:mga07m45_463056_c1 nmdc:mga07m45_463056_c1_177_710 174
381 3300050510 nmdc:mga06r32_69603_c1 nmdc:mga06r32_69603_c1_1897_2442 174
382 3300050512 nmdc:mga0n895_193247_c1 nmdc:mga0n895_193247_c1_1382_1912 174
383 3300050512 nmdc:mga0n895_19346_c1 nmdc:mga0n895_19346_c1_1682_2209 174
384 3300050512 nmdc:mga0n895_817620_c1 nmdc:mga0n895_817620_c1_265_795 174
385 3300050513 nmdc:mga0rr50_1027417_c1 nmdc:mga0rr50_1027417_c1_44_574 174
386 3300050514 nmdc:mga08x19_417705_c1 nmdc:mga08x19_417705_c1_182_709 174
387 3300053077 Ga0495601_0107890 Ga0495601_0107890_1098_1634 174
388 3300053077 Ga0495601_0114723 Ga0495601_0114723_761_1291 174
389 3300053078 Ga0495612_0103775 Ga0495612_0103775_345_881 174
390 3300053080 Ga0500635_0006990 Ga0500635_0006990_684_1214 174
391 3300053084 Ga0495595_0012978 Ga0495595_0012978_682_1212 174
392 3300053084 Ga0495595_0021964 Ga0495595_0021964_402_932 174
393 3300053102 Ga0500554_003066 Ga0500554_003066_1075_1605 174
394 3300053150 Ga0500603_004856 Ga0500603_004856_474_1004 174
395 3300053177 Ga0500636_0013231 Ga0500636_0013231_1387_1914 174
396 3300053178 Ga0500637_0035803 Ga0500637_0035803_474_1004 174
397 3300053737 Ga0500601_004650 Ga0500601_004650_325_852 174
398 3300061719 Ga0466962_0041918 Ga0466962_0041918_729_1286 174

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tpv-assembly1.cif.gz_A x-ray structure of wlara (tdp-fucose-3,4-ketoisomerase) from campylobacter jejuni 0.7761 55 132
1s4c-assembly1.cif.gz_A yhch protein (hi0227) copper complex 0.7714 58 128
4hsl-assembly1.cif.gz_A-2 2.00 angstrom x-ray crystal structure of substrate-bound e110a 3-hydroxyanthranilate-3,4-dioxygenase from cupriavidus metallidurans 0.7674 68 131
2evx-assembly1.cif.gz_A crystal structure of pumpkin seed globulin 0.7564 58 137
5tpu-assembly1.cif.gz_B x-ray structure of the wlarb tdp-quinovose 3,4-ketoisomerase from campylobacter jejuni 0.7528 58 145
ID Description Score Start End Superfamily
af_Q54FG7_190_474_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.7767 67 128 2.60.120.650
af_I1MK06_17_180_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7639 66 134 2.60.120.10
af_I1M4N3_280_453_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7568 52 137 2.60.120.10
3kscB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7563 58 127 2.60.120.10
2pa7A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7538 55 148 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A0S6UIS9-F1-model_v4 Uncharacterized protein containing double-stranded beta helix domain 0.9935 14 173
AF-A0A6P1REI5-F1-model_v4 Cupin domain-containing protein 0.9897 3 173
AF-A0A0S6UIS9-F1-model_v4 Uncharacterized protein containing double-stranded beta helix domain 0.9874 14 173
AF-A0A327L1W0-F1-model_v4 Cupin 0.9847 9 172
AF-F7QM83-F1-model_v4 Cupin domain-containing protein 0.9844 59 174

Feature Viewer

pLDDT pTM Quality
92.47 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map