F434071

General Info

Members Datasets Scaffolds Average Seq Length
398 221 796 157

Family's Representative Sequence

Representative Sequence 3300028786|Ga0307517_10498632|Ga0307517_104986321
Length 164
Sequence VTVRDPSSKVMSWSVARAWRDRLHESGARRIVFTNGVFDLLHPGHVDVLHGARAAGDALIVGLNSDDSVRRLNKGPERPVRSEADRAYVLAALEAVDAVTLFTQDTPLELIQALRPDVVVKGGDYTPDTIVGATDVQSWGGEVLVIPLTPNQSTTSIIAKLRAL

Samples

Sample ID Description Type Environment
1 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
109 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
110 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
112 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
113 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
114 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
118 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
132 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
142 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
177 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
178 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
198 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
199 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
200 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
201 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
202 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
203 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
208 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
213 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.26
Rhizosphere 97.24
Stem 0
Stem Tuber 0
Unclassified 9.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307517_10498632 3300028786 Unclassified 620
2 Ga0070658_10110852 3300005327 Bacteria 2273
3 Ga0070658_10191558 3300005327 Unclassified 1723
4 Ga0070658_10205378 3300005327 Bacteria 1663
5 Ga0070658_10606996 3300005327 Bacteria 948
6 Ga0070683_100022264 3300005329 Bacteria 5662
7 Ga0070683_100056408 3300005329 Archaea 3648
8 Ga0070683_100162256 3300005329 Bacteria 2121
9 Ga0070670_100604765 3300005331 Bacteria 981
10 Ga0070680_100000087 3300005336 Bacteria 51648
11 Ga0070680_100176609 3300005336 Bacteria 1798
12 Ga0070682_100572549 3300005337 Bacteria 887
13 Ga0070660_100032923 3300005339 Bacteria 3904
14 Ga0070660_100133684 3300005339 Bacteria 1986
15 Ga0070660_100488703 3300005339 Unclassified 1023
16 Ga0070661_100133369 3300005344 Bacteria 1867
17 Ga0070692_10362978 3300005345 Bacteria 903
18 Ga0070668_100043022 3300005347 Bacteria 3463
19 Ga0070659_100231630 3300005366 Bacteria 1527
20 Ga0070659_100914686 3300005366 Unclassified 767
21 Ga0070710_10007842 3300005437 Bacteria 5182
22 Ga0070711_100142747 3300005439 Bacteria 1797
23 Ga0070711_100978138 3300005439 Bacteria 725
24 Ga0070694_100316678 3300005444 Bacteria 1200
25 Ga0070663_100010002 3300005455 Bacteria 5897
26 Ga0070681_10016406 3300005458 Bacteria 7393
27 Ga0070681_10055379 3300005458 Bacteria 3948
28 Ga0070681_10120387 3300005458 Bacteria 2560
29 Ga0070681_10390707 3300005458 Unclassified 1302
30 Ga0070679_100004790 3300005530 Bacteria 12482
31 Ga0070679_100224626 3300005530 Bacteria 1838
32 Ga0070679_100231050 3300005530 Bacteria 1809
33 Ga0070679_100340891 3300005530 Bacteria 1447
34 Ga0070679_100382977 3300005530 Bacteria 1353
35 Ga0070684_100009196 3300005535 Bacteria 7774
36 Ga0070684_100015894 3300005535 Bacteria 6142
37 Ga0070684_100117454 3300005535 Bacteria 2390
38 Ga0070684_100154523 3300005535 Bacteria 2080
39 Ga0070684_100181701 3300005535 Bacteria 1913
40 Ga0070684_100330386 3300005535 Bacteria 1401
41 Ga0070684_100893460 3300005535 Bacteria 832
42 Ga0068853_100182248 3300005539 Bacteria 1905
43 Ga0070672_100041180 3300005543 Bacteria 3550
44 Ga0070695_100060082 3300005545 Bacteria 2463
45 Ga0070696_100031277 3300005546 Bacteria 3647
46 Ga0070696_100037864 3300005546 Bacteria 3327
47 Ga0070704_100271465 3300005549 Bacteria 1401
48 Ga0068855_100107391 3300005563 Bacteria 3207
49 Ga0068855_100441900 3300005563 Bacteria 1420
50 Ga0068855_100443194 3300005563 Bacteria 1418
51 Ga0068855_100673929 3300005563 Bacteria 1109
52 Ga0070664_100577369 3300005564 Bacteria 1041
53 Ga0068854_100183373 3300005578 Bacteria 1636
54 Ga0068856_100024574 3300005614 Bacteria 5866
55 Ga0068856_100136419 3300005614 Bacteria 2459
56 Ga0068852_100265912 3300005616 Unclassified 1648
57 Ga0068862_100070489 3300005844 Bacteria 3018
58 Ga0068862_100151942 3300005844 Bacteria 2061
59 Ga0081539_10301348 3300005985 Unclassified 689
60 Ga0070717_10775359 3300006028 Bacteria 872
61 Ga0070716_100003603 3300006173 Bacteria 7320
62 Ga0070712_100224419 3300006175 Bacteria 1489
63 Ga0068871_100975588 3300006358 Bacteria 788
64 Ga0075430_100023108 3300006846 Bacteria 5288
65 Ga0075430_100029490 3300006846 Bacteria 4657
66 Ga0075431_100023697 3300006847 Bacteria 6283
67 Ga0075431_100028415 3300006847 Bacteria 5747
68 Ga0075431_100083346 3300006847 Bacteria 3301
69 Ga0075434_100019696 3300006871 Bacteria 6531
70 Ga0075429_100104672 3300006880 Bacteria 2472
71 Ga0075436_100147743 3300006914 Bacteria 1653
72 Ga0075435_100108827 3300007076 Bacteria 2303
73 Ga0075435_100360867 3300007076 Bacteria 1246
74 Ga0075435_100564353 3300007076 Bacteria 986
75 Ga0105240_10053647 3300009093 Bacteria 5059
76 Ga0105240_10638996 3300009093 Unclassified 1168
77 Ga0111539_10096423 3300009094 Bacteria 3474
78 Ga0111539_10155179 3300009094 Bacteria 2679
79 Ga0105245_10489088 3300009098 Bacteria 1245
80 Ga0114129_10530847 3300009147 Unclassified 1533
81 Ga0105248_10340228 3300009177 Unclassified 1689
82 Ga0105248_10372957 3300009177 Bacteria 1607
83 Ga0105237_10003899 3300009545 Bacteria 17497
84 Ga0105238_10040956 3300009551 Bacteria 4693
85 Ga0105249_10010608 3300009553 Bacteria 8094
86 Ga0157373_10208028 3300013100 Bacteria 1379
87 Ga0157373_10257896 3300013100 Bacteria 1234
88 Ga0157371_10006847 3300013102 Bacteria 9310
89 Ga0157370_10191889 3300013104 Bacteria 1896
90 Ga0157370_11736244 3300013104 Bacteria 560
91 Ga0157369_10092925 3300013105 Bacteria 3220
92 Ga0157369_10253979 3300013105 Bacteria 1834
93 Ga0157374_11303943 3300013296 Bacteria 748
94 Ga0157372_10142238 3300013307 Unclassified 2765
95 Ga0157372_10255292 3300013307 Bacteria 2035
96 Ga0157372_11096649 3300013307 Bacteria 921
97 Ga0157375_10206586 3300013308 Unclassified 2120
98 Ga0157375_10233075 3300013308 Unclassified 2000
99 Ga0157376_10429969 3300014969 Bacteria 1283
100 Ga0213876_10018613 3300021384 Bacteria 3668
101 Ga0213876_10050792 3300021384 Bacteria 2191
102 Ga0213876_10066963 3300021384 Bacteria 1896
103 Ga0207692_10064066 3300025898 Bacteria 1912
104 Ga0207699_10013947 3300025906 Bacteria 4128
105 Ga0207699_10329663 3300025906 Bacteria 1073
106 Ga0207645_10274442 3300025907 Bacteria 1118
107 Ga0207705_10069901 3300025909 Bacteria 2543
108 Ga0207705_10083588 3300025909 Bacteria 2329
109 Ga0207705_10134729 3300025909 Bacteria 1840
110 Ga0207705_10373873 3300025909 Bacteria 1100
111 Ga0207705_10485894 3300025909 Bacteria 958
112 Ga0207705_10516021 3300025909 Unclassified 928
113 Ga0207705_10769645 3300025909 Bacteria 748
114 Ga0207707_10000874 3300025912 Bacteria 29449
115 Ga0207707_10015630 3300025912 Bacteria 6612
116 Ga0207707_10030261 3300025912 Bacteria 4737
117 Ga0207695_10093463 3300025913 Bacteria 3017
118 Ga0207671_10010658 3300025914 Bacteria 7563
119 Ga0207693_10229109 3300025915 Bacteria 1459
120 Ga0207663_10076791 3300025916 Bacteria 2172
121 Ga0207663_10172271 3300025916 Bacteria 1538
122 Ga0207660_10008819 3300025917 Bacteria 6519
123 Ga0207660_10115350 3300025917 Bacteria 2027
124 Ga0207660_10462262 3300025917 Unclassified 1027
125 Ga0207657_10011192 3300025919 Bacteria 8921
126 Ga0207657_10026384 3300025919 Bacteria 5341
127 Ga0207657_10081363 3300025919 Bacteria 2721
128 Ga0207649_10064894 3300025920 Bacteria 2310
129 Ga0207649_10204499 3300025920 Unclassified 1397
130 Ga0207652_10004380 3300025921 Bacteria 11506
131 Ga0207652_10262156 3300025921 Bacteria 1559
132 Ga0207652_10696949 3300025921 Unclassified 906
133 Ga0207700_10191343 3300025928 Bacteria 1719
134 Ga0207644_10173024 3300025931 Bacteria 1687
135 Ga0207690_10302365 3300025932 Bacteria 1252
136 Ga0207690_10796026 3300025932 Unclassified 781
137 Ga0207665_10004505 3300025939 Bacteria 9241
138 Ga0207691_10012455 3300025940 Bacteria 8156
139 Ga0207711_10679042 3300025941 Bacteria 961
140 Ga0207661_10035129 3300025944 Bacteria 3904
141 Ga0207661_10051576 3300025944 Bacteria 3283
142 Ga0207661_10062259 3300025944 Bacteria 3018
143 Ga0207661_10112882 3300025944 Bacteria 2301
144 Ga0207661_10896270 3300025944 Bacteria 817
145 Ga0207679_10101801 3300025945 Bacteria 2248
146 Ga0207667_10068435 3300025949 Bacteria 3697
147 Ga0207667_10188607 3300025949 Bacteria 2116
148 Ga0207667_10269326 3300025949 Bacteria 1741
149 Ga0207667_10659380 3300025949 Bacteria 1051
150 Ga0207667_11007536 3300025949 Bacteria 820
151 Ga0207712_10002241 3300025961 Bacteria 12587
152 Ga0207668_10009813 3300025972 Bacteria 5752
153 Ga0207640_10101044 3300025981 Bacteria 2022
154 Ga0207677_10263483 3300026023 Bacteria 1406
155 Ga0207639_10048769 3300026041 Bacteria 3207
156 Ga0207678_10002486 3300026067 Bacteria 16757
157 Ga0207702_10014668 3300026078 Bacteria 6502
158 Ga0207674_10280947 3300026116 Bacteria 1613
159 Ga0207698_10723383 3300026142 Bacteria 992
160 Ga0209969_1000304 3300027360 Bacteria 6583
161 Ga0209995_1012419 3300027471 Bacteria 1389
162 Ga0209971_1030229 3300027682 Unclassified 1297
163 Ga0209966_1014886 3300027695 Bacteria 1457
164 Ga0209998_10034878 3300027717 Bacteria 1126
165 Ga0209974_10023114 3300027876 Bacteria 2058
166 Ga0268265_10140717 3300028380 Bacteria 2020
167 Ga0307408_100006788 3300031548 Bacteria 7588
168 Ga0307408_100579144 3300031548 Bacteria 994
169 Ga0307408_100639194 3300031548 Unclassified 950
170 Ga0307405_10007458 3300031731 Bacteria 5473
171 Ga0307405_10012999 3300031731 Bacteria 4429
172 Ga0307405_10125297 3300031731 Bacteria 1765
173 Ga0307405_10456179 3300031731 Bacteria 1015
174 Ga0307405_10899571 3300031731 Bacteria 749
175 Ga0307405_11017112 3300031731 Bacteria 708
176 Ga0307413_10001386 3300031824 Bacteria 9115
177 Ga0307413_10006325 3300031824 Bacteria 5392
178 Ga0307413_10031851 3300031824 Bacteria 2981
179 Ga0307413_10232098 3300031824 Bacteria 1356
180 Ga0307413_10310079 3300031824 Bacteria 1201
181 Ga0307413_10422923 3300031824 Bacteria 1050
182 Ga0307410_10087897 3300031852 Bacteria 2199
183 Ga0307410_10113534 3300031852 Bacteria 1964
184 Ga0307410_10409029 3300031852 Bacteria 1098
185 Ga0307410_10597769 3300031852 Unclassified 920
186 Ga0307406_10013611 3300031901 Bacteria 4662
187 Ga0307406_10017388 3300031901 Bacteria 4185
188 Ga0307406_10108961 3300031901 Bacteria 1903
189 Ga0307406_10138825 3300031901 Unclassified 1717
190 Ga0307406_10253258 3300031901 Bacteria 1328
191 Ga0307407_10000370 3300031903 Bacteria 13506
192 Ga0307407_10029267 3300031903 Bacteria 2956
193 Ga0307407_10124311 3300031903 Bacteria 1641
194 Ga0307412_10001685 3300031911 Bacteria 12220
195 Ga0307412_10104744 3300031911 Bacteria 2008
196 Ga0307409_100002126 3300031995 Bacteria 10205
197 Ga0307409_100037193 3300031995 Bacteria 3586
198 Ga0307409_100044294 3300031995 Bacteria 3350
199 Ga0307409_100178629 3300031995 Unclassified 1876
200 Ga0307409_100225398 3300031995 Bacteria 1695
201 Ga0307409_100316754 3300031995 Bacteria 1458
202 Ga0307409_100429486 3300031995 Bacteria 1269
203 Ga0307416_100050658 3300032002 Bacteria 3311
204 Ga0307416_100076765 3300032002 Bacteria 2802
205 Ga0307416_100182606 3300032002 Bacteria 1968
206 Ga0307416_100246038 3300032002 Bacteria 1737
207 Ga0307416_100286182 3300032002 Bacteria 1629
208 Ga0307416_100345131 3300032002 Bacteria 1504
209 Ga0307416_100554185 3300032002 Bacteria 1223
210 Ga0307416_101309094 3300032002 Bacteria 830
211 Ga0307414_10004798 3300032004 Bacteria 7375
212 Ga0307414_10096838 3300032004 Unclassified 2209
213 Ga0307414_10383057 3300032004 Bacteria 1216
214 Ga0307411_10004565 3300032005 Bacteria 6656
215 Ga0307411_10043876 3300032005 Bacteria 2864
216 Ga0307411_10465407 3300032005 Unclassified 1061
217 Ga0307411_10467013 3300032005 Bacteria 1059
218 Ga0307411_10649535 3300032005 Unclassified 913
219 Ga0307415_100003426 3300032126 Bacteria 8067
220 Ga0307415_100005420 3300032126 Bacteria 6775
221 Ga0307415_100079400 3300032126 Bacteria 2337
222 Ga0307415_100591763 3300032126 Bacteria 986
223 Ga0307415_100953358 3300032126 Bacteria 794
224 Ga0373959_0115846 3300034820 Unclassified 651
225 Ga0373934_0002324 3300035086 Bacteria 6989
226 Ga0373923_0152755 3300035111 Bacteria 1049
227 Ga0373953_0185512 3300035117 Bacteria 898
228 Ga0373954_0076307 3300035118 Bacteria 1597
229 Ga0373954_0283570 3300035118 Bacteria 816
230 Ga0373956_0004485 3300035119 Bacteria 5579
231 Ga0373956_0096237 3300035119 Bacteria 1369
232 Ga0373957_0104491 3300035120 Bacteria 1136
233 Ga0373943_0074937 3300035170 Bacteria 1722
234 Ga0373955_0022981 3300035172 Bacteria 3171
235 Ga0373955_0023340 3300035172 Bacteria 3149
236 Ga0373942_0123984 3300035207 Bacteria 810
237 Ga0373924_0165686 3300035410 Bacteria 970
238 Ga0373931_0042979 3300035691 Bacteria 2378
239 Ga0373935_0208005 3300035692 Bacteria 1355
240 Ga0373927_0172414 3300035695 Bacteria 1418
241 Ga0373927_0342346 3300035695 Bacteria 985
242 Ga0373933_0007899 3300035724 Bacteria 5806
243 Ga0373933_0027263 3300035724 Bacteria 3288
244 Ga0373937_0000374 3300036401 Bacteria 41591
245 Ga0373937_0219358 3300036401 Bacteria 1790
246 Ga0373925_0987729 3300037068 Bacteria 693
247 Ga0395905_0044555 3300037471 Bacteria 4164
248 Ga0436365_0886644 3300039437 Bacteria 3149
249 Ga0436365_0966755 3300039437 Bacteria 4553
250 Ga0451577_0045403 3300042876 Bacteria 3933
251 Ga0466966_0032485 3300044684 Bacteria 3382
252 Ga0466966_0088831 3300044684 Bacteria 1920
253 Ga0466961_0891202 3300044693 Bacteria 530
254 Ga0453684_0001365 3300044712 Bacteria 70925
255 Ga0453684_0169976 3300044712 Bacteria 2570
256 Ga0453684_0237372 3300044712 Bacteria 2101
257 Ga0466970_0717825 3300044765 Bacteria 583
258 Ga0466959_0020167 3300045049 Bacteria 4908
259 Ga0466967_0157670 3300045976 Unclassified 2128
260 Ga0466967_0259991 3300045976 Bacteria 1661
261 Ga0495592_0152707 3300046454 Bacteria 1595
262 Ga0495603_0115791 3300046455 Bacteria 1563
263 Ga0495629_0071815 3300046459 Bacteria 2416
264 Ga0495629_0141380 3300046459 Bacteria 1675
265 Ga0495629_0178127 3300046459 Bacteria 1474
266 Ga0495638_0025469 3300046460 Bacteria 3845
267 Ga0495653_0054822 3300046463 Bacteria 3045
268 Ga0495653_0162257 3300046463 Bacteria 1550
269 Ga0495580_0022324 3300046472 Bacteria 4658
270 Ga0495580_0134871 3300046472 Bacteria 1712
271 Ga0495582_0199279 3300046473 Bacteria 1143
272 Ga0495582_0302333 3300046473 Bacteria 920
273 Ga0495582_0625417 3300046473 Unclassified 623
274 Ga0495639_0018885 3300046475 Bacteria 3005
275 Ga0495662_0070431 3300046476 Bacteria 1695
276 Ga0495664_0094041 3300046477 Bacteria 1804
277 Ga0495664_0477247 3300046477 Bacteria 746
278 Ga0495594_0008431 3300046499 Bacteria 5312
279 Ga0495594_0323540 3300046499 Bacteria 878
280 Ga0495608_0250574 3300046511 Bacteria 1104
281 Ga0495618_0060261 3300046514 Bacteria 2406
282 Ga0495628_0053147 3300046516 Bacteria 3198
283 Ga0495628_0054568 3300046516 Bacteria 3150
284 Ga0495628_0112746 3300046516 Bacteria 2090
285 Ga0495630_0071667 3300046517 Bacteria 2608
286 Ga0495663_0051042 3300046525 Bacteria 1280
287 Ga0495652_0007864 3300046529 Bacteria 9794
288 Ga0495652_0093223 3300046529 Bacteria 2459
289 Ga0495665_0002520 3300046531 Bacteria 9895
290 Ga0495640_0046345 3300046533 Bacteria 3012
291 Ga0495586_0048946 3300046535 Bacteria 2285
292 Ga0495586_0326629 3300046535 Bacteria 880
293 Ga0495587_0008763 3300046536 Bacteria 6489
294 Ga0495587_0013422 3300046536 Bacteria 5149
295 Ga0495645_0015748 3300046543 Bacteria 5383
296 Ga0495645_0044769 3300046543 Bacteria 3228
297 Ga0495645_0110503 3300046543 Bacteria 1945
298 Ga0495667_0007384 3300046559 Bacteria 7454
299 Ga0495667_0058505 3300046559 Bacteria 2532
300 Ga0495667_0067140 3300046559 Bacteria 2344
301 Ga0495667_0076047 3300046559 Bacteria 2184
302 Ga0495635_0022166 3300046663 Bacteria 4424
303 Ga0495635_0126079 3300046663 Bacteria 1746
304 Ga0495635_0538523 3300046663 Bacteria 766
305 Ga0495657_0076897 3300046675 Bacteria 2167
306 Ga0495599_0007947 3300046678 Bacteria 6433
307 Ga0495599_0053870 3300046678 Bacteria 2520
308 Ga0495623_0012412 3300046679 Bacteria 5516
309 Ga0495613_0032334 3300046689 Bacteria 3886
310 Ga0495600_0398672 3300046809 Bacteria 856
311 Ga0495604_0017740 3300047317 Bacteria 5695
312 Ga0495604_0131195 3300047317 Bacteria 1801
313 Ga0495636_0087783 3300047318 Bacteria 1347
314 Ga0495674_0059327 3300047319 Bacteria 3342
315 Ga0495674_0060050 3300047319 Bacteria 3318
316 Ga0495674_0152597 3300047319 Bacteria 1936
317 Ga0495674_0450933 3300047319 Bacteria 1034
318 Ga0495672_0057233 3300047320 Bacteria 2265
319 Ga0495680_0025648 3300047322 Bacteria 4875
320 Ga0495680_0104813 3300047322 Bacteria 2103
321 Ga0495680_0460484 3300047322 Bacteria 869
322 Ga0495675_0017790 3300047444 Bacteria 4506
323 Ga0495675_0073691 3300047444 Bacteria 2153
324 Ga0495675_0086499 3300047444 Bacteria 1970
325 Ga0495675_0099678 3300047444 Bacteria 1819
326 Ga0495684_0077972 3300047471 Bacteria 2514
327 Ga0495684_0117270 3300047471 Bacteria 2007
328 Ga0495684_0388347 3300047471 Bacteria 983
329 Ga0495593_0281792 3300047673 Bacteria 831
330 Ga0495593_0284607 3300047673 Bacteria 827
331 Ga0495602_0072797 3300048088 Bacteria 2928
332 Ga0496106_0528220 3300048909 Bacteria 947
333 Ga0496109_1239748 3300048912 Bacteria 682
334 Ga0496112_0070170 3300048915 Bacteria 3462
335 Ga0496115_0127249 3300048918 Bacteria 2099
336 Ga0496115_0145380 3300048918 Bacteria 1957
337 Ga0501298_058890 3300049521 Unclassified 810
338 Ga0501299_024133 3300049522 Bacteria 1133
339 Ga0501302_005507 3300049525 Unclassified 796
340 Ga0501032_0073922 3300049569 Bacteria 2271
341 Ga0501033_0011380 3300049570 Bacteria 6808
342 Ga0501033_0159734 3300049570 Bacteria 1623
343 Ga0501034_0173074 3300049571 Bacteria 2125
344 Ga0501036_0005247 3300049572 Bacteria 10484
345 Ga0501037_0197574 3300049573 Bacteria 1422
346 Ga0501037_1077359 3300049573 Bacteria 521
347 Ga0501038_0314374 3300049574 Bacteria 1226
348 Ga0501040_0035165 3300049576 Bacteria 3397
349 Ga0501046_0432959 3300049580 Bacteria 947
350 Ga0501046_0711798 3300049580 Bacteria 707
351 Ga0501047_0022273 3300049581 Bacteria 6087
352 Ga0501047_0094032 3300049581 Bacteria 2877
353 Ga0501047_0370945 3300049581 Bacteria 1266
354 Ga0501048_0125847 3300049582 Bacteria 1812
355 Ga0501067_0034901 3300049583 Unclassified 2792
356 Ga0501068_1108933 3300049584 Bacteria 523
357 Ga0501070_0018592 3300049586 Bacteria 5830
358 Ga0501071_0130875 3300049587 Bacteria 1864
359 Ga0501072_0728964 3300049588 Bacteria 778
360 Ga0501073_0034416 3300049589 Bacteria 3606
361 Ga0501075_0070313 3300049591 Bacteria 2645
362 Ga0501077_0393977 3300049593 Bacteria 885
363 Ga0501201_001629 3300049651 Bacteria 2084
364 Ga0501223_056376 3300049663 Unclassified 764
365 Ga0501233_047163 3300049668 Bacteria 1033
366 Ga0501233_169184 3300049668 Unclassified 620
367 Ga0501235_004608 3300049669 Bacteria 2979
368 Ga0501261_008640 3300049690 Bacteria 1318
369 Ga0501225_0029153 3300049705 Bacteria 1516
370 Ga0501234_001887 3300049707 Unclassified 3305
371 Ga0501079_0022111 3300049741 Bacteria 4873
372 Ga0501080_0256235 3300049742 Bacteria 1595
373 Ga0501080_0777611 3300049742 Unclassified 841
374 Ga0501081_0126590 3300049743 Bacteria 1823
375 Ga0501265_034919 3300049762 Unclassified 739
376 Ga0501270_000854 3300049767 Bacteria 2761
377 Ga0501035_0264476 3300049822 Bacteria 1457
378 Ga0501035_0725035 3300049822 Bacteria 800
379 Ga0501044_0042156 3300049823 Bacteria 4750
380 Ga0501045_0122922 3300049824 Bacteria 1927
381 Ga0501212_004392 3300049851 Bacteria 1818
382 nmdc:mga09592_48852_c1 3300050508 Bacteria 3567
383 nmdc:mga09592_69945_c1 3300050508 Bacteria 2977
384 nmdc:mga06r32_105992_c1 3300050510 Bacteria 2762
385 nmdc:mga06r32_107244_c1 3300050510 Bacteria 2745
386 nmdc:mga06r32_111175_c1 3300050510 Bacteria 2696
387 nmdc:mga08y16_162607_c1 3300050511 Bacteria 2319
388 nmdc:mga08y16_396896_c1 3300050511 Bacteria 1412
389 nmdc:mga08y16_49107_c1 3300050511 Bacteria 4416
390 nmdc:mga0rr50_532341_c1 3300050513 Bacteria 1000
391 nmdc:mga0rr50_559639_c1 3300050513 Bacteria 974
392 nmdc:mga08x19_75032_c1 3300050514 Bacteria 2210
393 nmdc:mga0a205_82035_c1 3300050515 Bacteria 3115
394 Ga0495619_0083692 3300053085 Bacteria 2152
395 Ga0495619_0284287 3300053085 Bacteria 1146
396 Ga0501084_0131103 3300054114 Bacteria 2110
397 Ga0501082_0245787 3300060353 Bacteria 1557
398 Ga0501082_1108397 3300060353 Bacteria 692
399 Ga0307517_10498632
400 Ga0070658_10110852
401 Ga0070658_10191558
402 Ga0070658_10205378
403 Ga0070658_10606996
404 Ga0070683_100022264
405 Ga0070683_100056408
406 Ga0070683_100162256
407 Ga0070670_100604765
408 Ga0070680_100000087
409 Ga0070680_100176609
410 Ga0070682_100572549
411 Ga0070660_100032923
412 Ga0070660_100133684
413 Ga0070660_100488703
414 Ga0070661_100133369
415 Ga0070692_10362978
416 Ga0070668_100043022
417 Ga0070659_100231630
418 Ga0070659_100914686
419 Ga0070710_10007842
420 Ga0070711_100142747
421 Ga0070711_100978138
422 Ga0070694_100316678
423 Ga0070663_100010002
424 Ga0070681_10016406
425 Ga0070681_10055379
426 Ga0070681_10120387
427 Ga0070681_10390707
428 Ga0070679_100004790
429 Ga0070679_100224626
430 Ga0070679_100231050
431 Ga0070679_100340891
432 Ga0070679_100382977
433 Ga0070684_100009196
434 Ga0070684_100015894
435 Ga0070684_100117454
436 Ga0070684_100154523
437 Ga0070684_100181701
438 Ga0070684_100330386
439 Ga0070684_100893460
440 Ga0068853_100182248
441 Ga0070672_100041180
442 Ga0070695_100060082
443 Ga0070696_100031277
444 Ga0070696_100037864
445 Ga0070704_100271465
446 Ga0068855_100107391
447 Ga0068855_100441900
448 Ga0068855_100443194
449 Ga0068855_100673929
450 Ga0070664_100577369
451 Ga0068854_100183373
452 Ga0068856_100024574
453 Ga0068856_100136419
454 Ga0068852_100265912
455 Ga0068862_100070489
456 Ga0068862_100151942
457 Ga0081539_10301348
458 Ga0070717_10775359
459 Ga0070716_100003603
460 Ga0070712_100224419
461 Ga0068871_100975588
462 Ga0075430_100023108
463 Ga0075430_100029490
464 Ga0075431_100023697
465 Ga0075431_100028415
466 Ga0075431_100083346
467 Ga0075434_100019696
468 Ga0075429_100104672
469 Ga0075436_100147743
470 Ga0075435_100108827
471 Ga0075435_100360867
472 Ga0075435_100564353
473 Ga0105240_10053647
474 Ga0105240_10638996
475 Ga0111539_10096423
476 Ga0111539_10155179
477 Ga0105245_10489088
478 Ga0114129_10530847
479 Ga0105248_10340228
480 Ga0105248_10372957
481 Ga0105237_10003899
482 Ga0105238_10040956
483 Ga0105249_10010608
484 Ga0157373_10208028
485 Ga0157373_10257896
486 Ga0157371_10006847
487 Ga0157370_10191889
488 Ga0157370_11736244
489 Ga0157369_10092925
490 Ga0157369_10253979
491 Ga0157374_11303943
492 Ga0157372_10142238
493 Ga0157372_10255292
494 Ga0157372_11096649
495 Ga0157375_10206586
496 Ga0157375_10233075
497 Ga0157376_10429969
498 Ga0213876_10018613
499 Ga0213876_10050792
500 Ga0213876_10066963
501 Ga0207692_10064066
502 Ga0207699_10013947
503 Ga0207699_10329663
504 Ga0207645_10274442
505 Ga0207705_10069901
506 Ga0207705_10083588
507 Ga0207705_10134729
508 Ga0207705_10373873
509 Ga0207705_10485894
510 Ga0207705_10516021
511 Ga0207705_10769645
512 Ga0207707_10000874
513 Ga0207707_10015630
514 Ga0207707_10030261
515 Ga0207695_10093463
516 Ga0207671_10010658
517 Ga0207693_10229109
518 Ga0207663_10076791
519 Ga0207663_10172271
520 Ga0207660_10008819
521 Ga0207660_10115350
522 Ga0207660_10462262
523 Ga0207657_10011192
524 Ga0207657_10026384
525 Ga0207657_10081363
526 Ga0207649_10064894
527 Ga0207649_10204499
528 Ga0207652_10004380
529 Ga0207652_10262156
530 Ga0207652_10696949
531 Ga0207700_10191343
532 Ga0207644_10173024
533 Ga0207690_10302365
534 Ga0207690_10796026
535 Ga0207665_10004505
536 Ga0207691_10012455
537 Ga0207711_10679042
538 Ga0207661_10035129
539 Ga0207661_10051576
540 Ga0207661_10062259
541 Ga0207661_10112882
542 Ga0207661_10896270
543 Ga0207679_10101801
544 Ga0207667_10068435
545 Ga0207667_10188607
546 Ga0207667_10269326
547 Ga0207667_10659380
548 Ga0207667_11007536
549 Ga0207712_10002241
550 Ga0207668_10009813
551 Ga0207640_10101044
552 Ga0207677_10263483
553 Ga0207639_10048769
554 Ga0207678_10002486
555 Ga0207702_10014668
556 Ga0207674_10280947
557 Ga0207698_10723383
558 Ga0209969_1000304
559 Ga0209995_1012419
560 Ga0209971_1030229
561 Ga0209966_1014886
562 Ga0209998_10034878
563 Ga0209974_10023114
564 Ga0268265_10140717
565 Ga0307408_100006788
566 Ga0307408_100579144
567 Ga0307408_100639194
568 Ga0307405_10007458
569 Ga0307405_10012999
570 Ga0307405_10125297
571 Ga0307405_10456179
572 Ga0307405_10899571
573 Ga0307405_11017112
574 Ga0307413_10001386
575 Ga0307413_10006325
576 Ga0307413_10031851
577 Ga0307413_10232098
578 Ga0307413_10310079
579 Ga0307413_10422923
580 Ga0307410_10087897
581 Ga0307410_10113534
582 Ga0307410_10409029
583 Ga0307410_10597769
584 Ga0307406_10013611
585 Ga0307406_10017388
586 Ga0307406_10108961
587 Ga0307406_10138825
588 Ga0307406_10253258
589 Ga0307407_10000370
590 Ga0307407_10029267
591 Ga0307407_10124311
592 Ga0307412_10001685
593 Ga0307412_10104744
594 Ga0307409_100002126
595 Ga0307409_100037193
596 Ga0307409_100044294
597 Ga0307409_100178629
598 Ga0307409_100225398
599 Ga0307409_100316754
600 Ga0307409_100429486
601 Ga0307416_100050658
602 Ga0307416_100076765
603 Ga0307416_100182606
604 Ga0307416_100246038
605 Ga0307416_100286182
606 Ga0307416_100345131
607 Ga0307416_100554185
608 Ga0307416_101309094
609 Ga0307414_10004798
610 Ga0307414_10096838
611 Ga0307414_10383057
612 Ga0307411_10004565
613 Ga0307411_10043876
614 Ga0307411_10465407
615 Ga0307411_10467013
616 Ga0307411_10649535
617 Ga0307415_100003426
618 Ga0307415_100005420
619 Ga0307415_100079400
620 Ga0307415_100591763
621 Ga0307415_100953358
622 Ga0373959_0115846
623 Ga0373934_0002324
624 Ga0373923_0152755
625 Ga0373953_0185512
626 Ga0373954_0076307
627 Ga0373954_0283570
628 Ga0373956_0004485
629 Ga0373956_0096237
630 Ga0373957_0104491
631 Ga0373943_0074937
632 Ga0373955_0022981
633 Ga0373955_0023340
634 Ga0373942_0123984
635 Ga0373924_0165686
636 Ga0373931_0042979
637 Ga0373935_0208005
638 Ga0373927_0172414
639 Ga0373927_0342346
640 Ga0373933_0007899
641 Ga0373933_0027263
642 Ga0373937_0000374
643 Ga0373937_0219358
644 Ga0373925_0987729
645 Ga0395905_0044555
646 Ga0436365_0886644
647 Ga0436365_0966755
648 Ga0451577_0045403
649 Ga0466966_0032485
650 Ga0466966_0088831
651 Ga0466961_0891202
652 Ga0453684_0001365
653 Ga0453684_0169976
654 Ga0453684_0237372
655 Ga0466970_0717825
656 Ga0466959_0020167
657 Ga0466967_0157670
658 Ga0466967_0259991
659 Ga0495592_0152707
660 Ga0495603_0115791
661 Ga0495629_0071815
662 Ga0495629_0141380
663 Ga0495629_0178127
664 Ga0495638_0025469
665 Ga0495653_0054822
666 Ga0495653_0162257
667 Ga0495580_0022324
668 Ga0495580_0134871
669 Ga0495582_0199279
670 Ga0495582_0302333
671 Ga0495582_0625417
672 Ga0495639_0018885
673 Ga0495662_0070431
674 Ga0495664_0094041
675 Ga0495664_0477247
676 Ga0495594_0008431
677 Ga0495594_0323540
678 Ga0495608_0250574
679 Ga0495618_0060261
680 Ga0495628_0053147
681 Ga0495628_0054568
682 Ga0495628_0112746
683 Ga0495630_0071667
684 Ga0495663_0051042
685 Ga0495652_0007864
686 Ga0495652_0093223
687 Ga0495665_0002520
688 Ga0495640_0046345
689 Ga0495586_0048946
690 Ga0495586_0326629
691 Ga0495587_0008763
692 Ga0495587_0013422
693 Ga0495645_0015748
694 Ga0495645_0044769
695 Ga0495645_0110503
696 Ga0495667_0007384
697 Ga0495667_0058505
698 Ga0495667_0067140
699 Ga0495667_0076047
700 Ga0495635_0022166
701 Ga0495635_0126079
702 Ga0495635_0538523
703 Ga0495657_0076897
704 Ga0495599_0007947
705 Ga0495599_0053870
706 Ga0495623_0012412
707 Ga0495613_0032334
708 Ga0495600_0398672
709 Ga0495604_0017740
710 Ga0495604_0131195
711 Ga0495636_0087783
712 Ga0495674_0059327
713 Ga0495674_0060050
714 Ga0495674_0152597
715 Ga0495674_0450933
716 Ga0495672_0057233
717 Ga0495680_0025648
718 Ga0495680_0104813
719 Ga0495680_0460484
720 Ga0495675_0017790
721 Ga0495675_0073691
722 Ga0495675_0086499
723 Ga0495675_0099678
724 Ga0495684_0077972
725 Ga0495684_0117270
726 Ga0495684_0388347
727 Ga0495593_0281792
728 Ga0495593_0284607
729 Ga0495602_0072797
730 Ga0496106_0528220
731 Ga0496109_1239748
732 Ga0496112_0070170
733 Ga0496115_0127249
734 Ga0496115_0145380
735 Ga0501298_058890
736 Ga0501299_024133
737 Ga0501302_005507
738 Ga0501032_0073922
739 Ga0501033_0011380
740 Ga0501033_0159734
741 Ga0501034_0173074
742 Ga0501036_0005247
743 Ga0501037_0197574
744 Ga0501037_1077359
745 Ga0501038_0314374
746 Ga0501040_0035165
747 Ga0501046_0432959
748 Ga0501046_0711798
749 Ga0501047_0022273
750 Ga0501047_0094032
751 Ga0501047_0370945
752 Ga0501048_0125847
753 Ga0501067_0034901
754 Ga0501068_1108933
755 Ga0501070_0018592
756 Ga0501071_0130875
757 Ga0501072_0728964
758 Ga0501073_0034416
759 Ga0501075_0070313
760 Ga0501077_0393977
761 Ga0501201_001629
762 Ga0501223_056376
763 Ga0501233_047163
764 Ga0501233_169184
765 Ga0501235_004608
766 Ga0501261_008640
767 Ga0501225_0029153
768 Ga0501234_001887
769 Ga0501079_0022111
770 Ga0501080_0256235
771 Ga0501080_0777611
772 Ga0501081_0126590
773 Ga0501265_034919
774 Ga0501270_000854
775 Ga0501035_0264476
776 Ga0501035_0725035
777 Ga0501044_0042156
778 Ga0501045_0122922
779 Ga0501212_004392
780 nmdc:mga09592_48852_c1
781 nmdc:mga09592_69945_c1
782 nmdc:mga06r32_105992_c1
783 nmdc:mga06r32_107244_c1
784 nmdc:mga06r32_111175_c1
785 nmdc:mga08y16_162607_c1
786 nmdc:mga08y16_396896_c1
787 nmdc:mga08y16_49107_c1
788 nmdc:mga0rr50_532341_c1
789 nmdc:mga0rr50_559639_c1
790 nmdc:mga08x19_75032_c1
791 nmdc:mga0a205_82035_c1
792 Ga0495619_0083692
793 Ga0495619_0284287
794 Ga0501084_0131103
795 Ga0501082_0245787
796 Ga0501082_1108397

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01467

CTP_transf_like

Cytidylyltransferase-like

33

160

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xf2-assembly1.cif.gz_A crystal structure of semet-hldc from burkholderia pseudomallei 0.9489 2 133
5x9q-assembly1.cif.gz_B crystal structure of hldc from burkholderia pseudomallei 0.8804 2 148
5xf2-assembly1.cif.gz_A crystal structure of semet-hldc from burkholderia pseudomallei 0.878 2 133
5x9q-assembly1.cif.gz_B crystal structure of hldc from burkholderia pseudomallei 0.8422 2 148
2b7l-assembly2.cif.gz_D crystal structure of ctp:glycerol-3-phosphate cytidylyltransferase from staphylococcus aureus 0.8382 17 133
ID Description Score Start End Superfamily
af_P76658_320_476_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9399 2 147 3.40.50.620
af_P76658_320_476_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8929 2 147 3.40.50.620
1cozA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8593 17 146 3.40.50.620
1cozA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8405 17 146 3.40.50.620
2b7lD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8382 17 133 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A136LV67-F1-model_v4 D-heptose-1-phosphate adenylyltransferase 0.987 19 131 GO:0009058
GO:0016779
AF-A0A7Y5QPD3-F1-model_v4 Adenylyltransferase/cytidyltransferase family protein 0.9833 2 135 GO:0009058
GO:0016779
AF-A0A813AI90-F1-model_v4 deleted 0.9794 2 129
AF-A0A529L1G2-F1-model_v4 D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase (EC 2.7.7.70) 0.9785 2 132 GO:0005524
GO:0005975
GO:0009058
GO:0016773
GO:0016779
AF-A0A7Y5QPD3-F1-model_v4 Adenylyltransferase/cytidyltransferase family protein 0.976 2 135 GO:0009058
GO:0016779

Map