metagRoot

F434051

General Info

Members	Datasets	Scaffolds	Average Seq Length
398	240	395	220

Family's Representative Sequence

Representative Sequence	3300025298\|Ga0209050_1009946\|Ga0209050_10099464
Length	241
Sequence	MAGPLHHCFAMVPLPVPGMNYMTNRLAVFDCDGTLVDSQVNICRAMEATFDAHRLAPPVRSDIRRIVGLSLVPAIAQLLPEAEPALHEAMAEEYKRAFHAMRASAALDPEPLYDGIIETIEALDAAGWLLGVATGKSDRGLRLILEHHGLHARFVTLQTADRHPSKPHPAMLELAIAEAGAAPETTAMIGDTSFDMAMARAAGTHAVGVLWGYHTSGELLGAGAHRLADHASQLPAHLEAL

Samples

	Sample ID	Description	Type	Environment
1	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
2	2512564014	Sphingobium sp. AP49	Isolate	Rhizosphere
3	2775507255	Sphingobium indicum B90A	Isolate	Rhizosphere
4	2919138771	Novosphingobium sp. 1748	Isolate	Rhizosphere
5	3300001915	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7	Metagenome	Rhizosphere
6	3300001976	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7	Metagenome	Rhizosphere
7	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
8	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
9	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
10	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
11	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
12	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
13	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
14	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
15	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
16	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
17	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
18	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
19	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
20	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
21	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
22	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
23	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
24	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
25	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
26	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
27	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
28	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
29	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
30	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
31	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
32	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
33	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
34	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
35	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
36	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
37	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
38	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
39	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
40	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
41	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
42	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
43	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
44	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
45	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
46	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
47	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
48	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
49	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
50	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
51	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
52	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
53	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
54	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
55	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
56	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
57	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
58	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
59	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
60	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
61	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
62	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
63	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
64	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
65	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
66	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
67	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
68	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
69	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
70	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
71	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
72	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
73	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
74	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
75	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
76	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
77	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
78	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
79	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
80	3300009978	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG	Metagenome	Rhizosphere
81	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
82	3300012513	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510	Metagenome	Rhizosphere
83	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
84	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
85	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
86	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
87	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
88	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
89	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
90	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
91	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
92	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
93	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
94	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
95	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
96	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
97	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
98	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
99	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
100	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
101	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
102	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
103	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
104	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
105	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
106	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
142	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
146	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
147	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
148	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
149	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
150	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
151	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
152	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
153	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
154	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
155	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
156	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
157	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
158	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
159	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
160	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
161	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
162	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
163	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
164	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
165	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
166	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
167	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
168	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
169	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
170	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
171	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
172	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
173	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
174	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
175	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
176	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
177	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
178	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
179	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
180	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
181	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
182	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
183	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
184	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
185	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
186	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
187	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
188	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
189	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
190	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
191	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
192	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
193	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
194	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
195	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
196	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
197	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
198	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
199	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
200	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
201	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
202	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
203	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
204	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
205	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
206	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
207	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
208	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
209	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
210	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
211	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
212	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
213	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
214	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
215	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
216	3300049770	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control	Metagenome	Rhizosphere
217	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
218	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
219	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
220	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
221	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
222	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
223	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
224	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
225	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
226	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
227	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
228	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
229	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
230	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
231	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
232	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
233	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
234	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
235	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
236	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
237	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
238	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
239	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
240	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.74
Metatranscriptomes	0.5
Isolates	0.75

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	17.34
Nodule	0
Rhizoplane	4.52
Rhizosphere	68.84
Stem	0
Stem Tuber	0
Unclassified	9.3

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL2b_contig_1450093	2162886007	Bacteria	1262
2	SwRhRL2b_contig_3772865	2162886007	Bacteria	47800
3	SwRhRL2b_contig_922431	2162886007	Bacteria	1106
4	JGI24741J21665_1000091	3300001915	Bacteria	23103
5	JGI24752J21851_1000568	3300001976	Bacteria	4919
6	JGI24740J21852_10001400	3300001979	Bacteria	11028
7	JGI24739J22299_10000493	3300001989	Bacteria	13945
8	JGI24739J22299_10032316	3300001989	Bacteria	1801
9	JGI24737J22298_10039757	3300001990	Bacteria	1445
10	JGI24737J22298_10042067	3300001990	Bacteria	1401
11	JGI24737J22298_10078672	3300001990	Bacteria	982
12	JGI24743J22301_10014455	3300001991	Bacteria	1456
13	JGI24735J21928_10001087	3300002067	Bacteria	9718
14	JGI24735J21928_10015263	3300002067	Bacteria	2398
15	JGI24735J21928_10024054	3300002067	Bacteria	1845
16	JGI24744J21845_10008064	3300002077	Bacteria	2175
17	JGI24742J22300_10025856	3300002244	Bacteria	1015
18	JGI25150J39212_1003534	3300002774	Bacteria	3648
19	JGI25151J46595_10050066	3300003187	Bacteria	1427
20	JGI25153J46596_10000186	3300003215	Bacteria	60427
21	rootL2_10123190	3300003322	Bacteria	1551
22	rootH1_10120483	3300003323	Bacteria	3923
23	Ga0055542_1006837	3300003762	Bacteria	2387
24	Ga0055526_1004582	3300003771	Bacteria	8249
25	Ga0055537_1007931	3300003773	Bacteria	2499
26	Ga0055530_10010848	3300003791	Bacteria	3324
27	Ga0055540_1000768	3300003792	Bacteria	21808
28	Ga0055540_1002060	3300003792	Bacteria	11094
29	Ga0065707_10179577	3300005295	Bacteria	1427
30	Ga0070658_10023792	3300005327	Bacteria	4913
31	Ga0070658_10156868	3300005327	Bacteria	1908
32	Ga0070658_10232525	3300005327	Bacteria	1561
33	Ga0070670_100010913	3300005331	Bacteria	7759
34	Ga0070666_10008183	3300005335	Bacteria	6481
35	Ga0070660_100040882	3300005339	Bacteria	3531
36	Ga0070661_100070276	3300005344	Bacteria	2574
37	Ga0070669_100000012	3300005353	Bacteria	211302
38	Ga0070669_100018657	3300005353	Bacteria	4958
39	Ga0070669_100096434	3300005353	Bacteria	2225
40	Ga0070675_100006402	3300005354	Bacteria	9037
41	Ga0070671_100000019	3300005355	Bacteria	132341
42	Ga0070671_100000469	3300005355	Bacteria	28112
43	Ga0070671_100015454	3300005355	Bacteria	6166
44	Ga0070671_100020752	3300005355	Bacteria	5358
45	Ga0070671_100066072	3300005355	Bacteria	3014
46	Ga0070674_100021737	3300005356	Bacteria	4126
47	Ga0070673_100011976	3300005364	Bacteria	5940
48	Ga0070659_100002740	3300005366	Bacteria	12537
49	Ga0070659_100034151	3300005366	Bacteria	3954
50	Ga0070659_100039134	3300005366	Bacteria	3701
51	Ga0070659_100499782	3300005366	Bacteria	1036
52	Ga0070667_100231297	3300005367	Bacteria	1648
53	Ga0070667_100575820	3300005367	Bacteria	1036
54	Ga0070705_100015450	3300005440	Bacteria	3949
55	Ga0070708_100568304	3300005445	Bacteria	1069
56	Ga0070663_100027909	3300005455	Bacteria	3837
57	Ga0070663_100368060	3300005455	Bacteria	1167
58	Ga0070678_100006441	3300005456	Bacteria	6892
59	Ga0070662_100083579	3300005457	Bacteria	2383
60	Ga0070685_10023857	3300005466	Bacteria	3353
61	Ga0070684_100395828	3300005535	Bacteria	1273
62	Ga0068853_100060803	3300005539	Bacteria	3265
63	Ga0068853_100252431	3300005539	Bacteria	1619
64	Ga0068853_100650632	3300005539	Bacteria	1003
65	Ga0070672_100058268	3300005543	Bacteria	3035
66	Ga0070686_100078185	3300005544	Bacteria	2184
67	Ga0070665_100002555	3300005548	Bacteria	19975
68	Ga0070665_101046254	3300005548	Bacteria	828
69	Ga0068855_100055285	3300005563	Bacteria	4663
70	Ga0068855_100412968	3300005563	Bacteria	1477
71	Ga0070664_100065894	3300005564	Bacteria	3092
72	Ga0070664_100107737	3300005564	Bacteria	2429
73	Ga0070664_100198291	3300005564	Bacteria	1790
74	Ga0068857_100027005	3300005577	Bacteria	5064
75	Ga0068857_100127391	3300005577	Bacteria	2295
76	Ga0068857_100162718	3300005577	Bacteria	2025
77	Ga0068857_100327937	3300005577	Bacteria	1414
78	Ga0068854_100040917	3300005578	Bacteria	3272
79	Ga0068854_100092820	3300005578	Bacteria	2249
80	Ga0068854_100119731	3300005578	Bacteria	1997
81	Ga0068854_100180792	3300005578	Bacteria	1647
82	Ga0068856_100109461	3300005614	Bacteria	2759
83	Ga0068852_100250213	3300005616	Bacteria	1698
84	Ga0068852_100403523	3300005616	Bacteria	1345
85	Ga0068859_100001454	3300005617	Bacteria	24047
86	Ga0068864_100001010	3300005618	Bacteria	23505
87	Ga0068864_100014358	3300005618	Bacteria	6578
88	Ga0068861_100007383	3300005719	Bacteria	7532
89	Ga0068861_100089669	3300005719	Bacteria	2424
90	Ga0068851_10025430	3300005834	Bacteria	2904
91	Ga0068851_10033866	3300005834	Bacteria	2548
92	Ga0068863_100000548	3300005841	Bacteria	38257
93	Ga0068863_100003659	3300005841	Bacteria	15173
94	Ga0068863_100009063	3300005841	Bacteria	9716
95	Ga0068863_100181544	3300005841	Bacteria	2020
96	Ga0068858_100002778	3300005842	Bacteria	17593
97	Ga0068858_100113550	3300005842	Bacteria	2530
98	Ga0068858_100178979	3300005842	Bacteria	2001
99	Ga0068862_100102028	3300005844	Bacteria	2511
100	Ga0081455_10174605	3300005937	Bacteria	1633
101	Ga0075368_10002355	3300006042	Bacteria	6144
102	Ga0075363_100005360	3300006048	Bacteria	5698
103	Ga0075363_100032331	3300006048	Bacteria	2717
104	Ga0075362_10000018	3300006177	Bacteria	75123
105	Ga0075367_10008705	3300006178	Bacteria	5271
106	Ga0075369_10002686	3300006186	Bacteria	6376
107	Ga0075369_10097158	3300006186	Bacteria	1319
108	Ga0075366_10000303	3300006195	Bacteria	22259
109	Ga0075370_10000065	3300006353	Bacteria	31858
110	Ga0075370_10044042	3300006353	Bacteria	2523
111	Ga0068865_100259532	3300006881	Bacteria	1375
112	Ga0097620_100001454	3300006931	Bacteria	24047
113	Ga0105251_10009719	3300009011	Bacteria	5652
114	Ga0105251_10075631	3300009011	Bacteria	1563
115	Ga0105240_10698645	3300009093	Bacteria	1107
116	Ga0105240_11064873	3300009093	Bacteria	862
117	Ga0105240_11406580	3300009093	Bacteria	733
118	Ga0105247_10002750	3300009101	Bacteria	11780
119	Ga0114129_10243414	3300009147	Bacteria	2417
120	Ga0105243_10066615	3300009148	Bacteria	2897
121	Ga0105241_10000807	3300009174	Bacteria	23818
122	Ga0105241_10043201	3300009174	Bacteria	3413
123	Ga0105248_10000928	3300009177	Bacteria	32626
124	Ga0105248_10157075	3300009177	Bacteria	2566
125	Ga0105248_10371457	3300009177	Bacteria	1610
126	Ga0105248_10699311	3300009177	Bacteria	1144
127	Ga0105237_10039374	3300009545	Bacteria	4772
128	Ga0105249_10000553	3300009553	Bacteria	34593
129	Ga0105249_10178935	3300009553	Bacteria	2062
130	Ga0105148_100060	3300009978	Bacteria	17151
131	Ga0105239_10361961	3300010375	Bacteria	1638
132	Ga0157326_1000067	3300012513	Bacteria	10095
133	Ga0157373_10009452	3300013100	Bacteria	7202
134	Ga0157373_10082970	3300013100	Bacteria	2259
135	Ga0157373_10106838	3300013100	Bacteria	1968
136	Ga0157370_10186804	3300013104	Bacteria	1924
137	Ga0157370_10490610	3300013104	Unclassified	1129
138	Ga0157369_10210307	3300013105	Bacteria	2039
139	Ga0163162_10001039	3300013306	Bacteria	25819
140	Ga0157372_10019632	3300013307	Bacteria	7285
141	Ga0157372_10100807	3300013307	Bacteria	3295
142	Ga0163163_10036136	3300014325	Bacteria	4797
143	Ga0157379_10072698	3300014968	Bacteria	3077
144	Ga0163161_10002388	3300017792	Bacteria	13455
145	Ga0206354_11625545	3300020081	Bacteria	1133
146	Ga0206353_11095245	3300020082	Bacteria	4162
147	Ga0213876_10000671	3300021384	Bacteria	24376
148	Ga0209147_101887	3300025229	Bacteria	6361
149	Ga0207425_1000049	3300025245	Bacteria	180735
150	Ga0209148_1000074	3300025254	Bacteria	314356
151	Ga0209129_1010745	3300025258	Bacteria	2252
152	Ga0209565_1001004	3300025263	Bacteria	14505
153	Ga0209565_1017864	3300025263	Bacteria	1545
154	Ga0209676_1034407	3300025292	Bacteria	1498
155	Ga0209025_1000068	3300025294	Bacteria	294129
156	Ga0209564_1004346	3300025295	Bacteria	8727
157	Ga0209758_1000019	3300025297	Bacteria	743682
158	Ga0209758_1017162	3300025297	Bacteria	3624
159	Ga0209050_1000001	3300025298	Bacteria	3563507
160	Ga0209050_1000108	3300025298	Bacteria	222534
161	Ga0209050_1009946	3300025298	Bacteria	4771
162	Ga0209051_1005046	3300025303	Bacteria	7858
163	Ga0209257_1005464	3300025304	Bacteria	8914
164	Ga0209257_1022360	3300025304	Bacteria	2257
165	Ga0209257_1032822	3300025304	Bacteria	1641
166	Ga0207697_10000372	3300025315	Bacteria	25128
167	Ga0207710_10028849	3300025900	Bacteria	2410
168	Ga0207680_10000142	3300025903	Bacteria	34278
169	Ga0207647_10006596	3300025904	Bacteria	8433
170	Ga0207647_10054444	3300025904	Bacteria	2461
171	Ga0207645_10018561	3300025907	Bacteria	4572
172	Ga0207705_10000110	3300025909	Bacteria	92932
173	Ga0207705_10021882	3300025909	Bacteria	4562
174	Ga0207705_10179387	3300025909	Bacteria	1598
175	Ga0207654_10117340	3300025911	Bacteria	1666
176	Ga0207657_10010636	3300025919	Bacteria	9165
177	Ga0207657_10189940	3300025919	Bacteria	1657
178	Ga0207649_10020288	3300025920	Bacteria	3809
179	Ga0207649_10151296	3300025920	Bacteria	1598
180	Ga0207681_10000004	3300025923	Bacteria	559005
181	Ga0207681_10001962	3300025923	Bacteria	13202
182	Ga0207681_10053262	3300025923	Bacteria	2747
183	Ga0207681_10088895	3300025923	Bacteria	2201
184	Ga0207681_10239658	3300025923	Bacteria	1411
185	Ga0207681_10410468	3300025923	Bacteria	1095
186	Ga0207650_10000706	3300025925	Bacteria	26130
187	Ga0207659_10010728	3300025926	Bacteria	5762
188	Ga0207644_10000031	3300025931	Bacteria	134402
189	Ga0207644_10000514	3300025931	Bacteria	25001
190	Ga0207644_10080856	3300025931	Bacteria	2400
191	Ga0207644_10237009	3300025931	Bacteria	1451
192	Ga0207644_10337026	3300025931	Bacteria	1222
193	Ga0207690_10000522	3300025932	Bacteria	24983
194	Ga0207690_10053450	3300025932	Bacteria	2710
195	Ga0207706_10032170	3300025933	Bacteria	4671
196	Ga0207669_10016701	3300025937	Bacteria	3739
197	Ga0207704_10230891	3300025938	Bacteria	1376
198	Ga0207711_10000243	3300025941	Bacteria	58447
199	Ga0207711_10010472	3300025941	Bacteria	7701
200	Ga0207679_10284528	3300025945	Bacteria	1419
201	Ga0207667_10000071	3300025949	Bacteria	178355
202	Ga0207651_10009419	3300025960	Bacteria	5347
203	Ga0207712_10135710	3300025961	Bacteria	1881
204	Ga0207668_10000135	3300025972	Bacteria	50909
205	Ga0207668_10036787	3300025972	Bacteria	3270
206	Ga0207640_10041407	3300025981	Bacteria	2930
207	Ga0207640_10077153	3300025981	Bacteria	2264
208	Ga0207658_10048711	3300025986	Bacteria	3108
209	Ga0207658_10134198	3300025986	Bacteria	1993
210	Ga0207658_10256560	3300025986	Bacteria	1488
211	Ga0207703_10033576	3300026035	Bacteria	4069
212	Ga0207703_10091942	3300026035	Bacteria	2553
213	Ga0207639_10000138	3300026041	Bacteria	54326
214	Ga0207639_10008360	3300026041	Bacteria	7094
215	Ga0207639_10054015	3300026041	Bacteria	3068
216	Ga0207678_10003206	3300026067	Bacteria	14797
217	Ga0207678_10143071	3300026067	Bacteria	2041
218	Ga0207702_10006612	3300026078	Bacteria	9971
219	Ga0207702_10027130	3300026078	Bacteria	4755
220	Ga0207702_10360483	3300026078	Bacteria	1393
221	Ga0207641_10000348	3300026088	Bacteria	55272
222	Ga0207641_10003138	3300026088	Bacteria	14847
223	Ga0207641_10940446	3300026088	Bacteria	859
224	Ga0207676_10000591	3300026095	Bacteria	29797
225	Ga0207676_10004790	3300026095	Bacteria	9602
226	Ga0207674_10010136	3300026116	Bacteria	10716
227	Ga0207674_10028798	3300026116	Bacteria	5856
228	Ga0207674_10039836	3300026116	Bacteria	4869
229	Ga0207674_10116440	3300026116	Bacteria	2644
230	Ga0207675_100000684	3300026118	Bacteria	33377
231	Ga0207683_10002781	3300026121	Bacteria	15279
232	Ga0207698_10029224	3300026142	Bacteria	3944
233	Ga0207698_10175480	3300026142	Bacteria	1892
234	Ga0207698_10330908	3300026142	Bacteria	1431
235	Ga0207698_10535961	3300026142	Bacteria	1145
236	Ga0209813_10000036	3300027866	Bacteria	58545
237	Ga0268266_10000198	3300028379	Bacteria	104891
238	Ga0268266_10353047	3300028379	Bacteria	1382
239	Ga0268265_10001018	3300028380	Bacteria	25269
240	Ga0268264_10000483	3300028381	Bacteria	52975
241	Ga0268264_10089449	3300028381	Bacteria	2651
242	Ga0307408_100033828	3300031548	Bacteria	3574
243	Ga0307405_10011171	3300031731	Bacteria	4689
244	Ga0307413_10010354	3300031824	Bacteria	4518
245	Ga0307413_10489266	3300031824	Bacteria	985
246	Ga0307410_10396825	3300031852	Bacteria	1113
247	Ga0307410_10477533	3300031852	Bacteria	1022
248	Ga0307406_10025759	3300031901	Bacteria	3523
249	Ga0307407_10001961	3300031903	Bacteria	7806
250	Ga0307407_10113594	3300031903	Bacteria	1705
251	Ga0307412_10054161	3300031911	Bacteria	2661
252	Ga0307409_100221168	3300031995	Bacteria	1709
253	Ga0307409_100241021	3300031995	Bacteria	1646
254	Ga0307409_100268184	3300031995	Bacteria	1571
255	Ga0307409_100314674	3300031995	Bacteria	1462
256	Ga0307414_10017183	3300032004	Bacteria	4420
257	Ga0307414_10034242	3300032004	Bacteria	3365
258	Ga0307414_10071384	3300032004	Bacteria	2504
259	Ga0307414_10226756	3300032004	Bacteria	1538
260	Ga0307411_10021932	3300032005	Bacteria	3749
261	Ga0307411_10320843	3300032005	Bacteria	1251
262	Ga0307411_10450418	3300032005	Bacteria	1077
263	Ga0307415_100024609	3300032126	Bacteria	3762
264	Ga0373931_0031266	3300035691	Bacteria	2747
265	Ga0373935_0315740	3300035692	Bacteria	1108
266	Ga0436365_1088341	3300039437	Bacteria	26854
267	Ga0439432_009122	3300042006	Bacteria	3465
268	Ga0439449_0010707	3300042007	Bacteria	3464
269	Ga0439455_0060834	3300042012	Bacteria	1001
270	Ga0466972_0001992	3300044658	Bacteria	9992
271	Ga0466961_0006506	3300044693	Bacteria	7427
272	Ga0466963_0004089	3300044694	Bacteria	8439
273	Ga0466964_0072670	3300044706	Bacteria	1458
274	Ga0466971_0013596	3300044719	Bacteria	3576
275	Ga0466968_0052031	3300044735	Bacteria	1751
276	Ga0466970_0001267	3300044765	Bacteria	12216
277	Ga0466957_0082442	3300044842	Bacteria	2005
278	Ga0466960_0005669	3300044901	Bacteria	4956
279	Ga0466959_0001787	3300045049	Bacteria	13436
280	Ga0466959_0393682	3300045049	Bacteria	942
281	Ga0466958_0025126	3300045836	Bacteria	3509
282	Ga0466958_0063520	3300045836	Bacteria	2252
283	Ga0466967_0139082	3300045976	Bacteria	2260
284	Ga0495617_110675	3300046452	Bacteria	888
285	Ga0495627_000737	3300046453	Bacteria	24627
286	Ga0495638_0000018	3300046460	Bacteria	389696
287	Ga0495650_0000898	3300046471	Bacteria	35090
288	Ga0495583_0000559	3300046506	Bacteria	51854
289	Ga0495632_0000113	3300046519	Bacteria	83027
290	Ga0495632_0002518	3300046519	Bacteria	13874
291	Ga0495648_0000018	3300046524	Bacteria	282490
292	Ga0495648_0036328	3300046524	Bacteria	3181
293	Ga0495648_0278753	3300046524	Bacteria	793
294	Ga0495654_0005860	3300046530	Bacteria	7067
295	Ga0495597_0094853	3300046542	Bacteria	1263
296	Ga0495622_0010748	3300046557	Bacteria	4223
297	Ga0495633_0029161	3300046558	Bacteria	2685
298	Ga0495668_0082616	3300046616	Bacteria	1762
299	Ga0495625_0008029	3300046660	Bacteria	9055
300	Ga0495671_0000011	3300046692	Bacteria	365582
301	Ga0495671_0014862	3300046692	Bacteria	4183
302	Ga0495673_0000013	3300047469	Bacteria	612902
303	Ga0495681_0000275	3300047470	Bacteria	41082
304	Ga0495686_0004626	3300047472	Bacteria	11191
305	Ga0496100_0014427	3300048903	Bacteria	4586
306	Ga0496101_0004188	3300048904	Bacteria	9038
307	Ga0496102_0342222	3300048905	Bacteria	1408
308	Ga0496106_0000666	3300048909	Bacteria	24598
309	Ga0496107_0000181	3300048910	Bacteria	32803
310	Ga0496107_0137126	3300048910	Bacteria	1808
311	Ga0496108_0001061	3300048911	Bacteria	21446
312	Ga0496108_0101492	3300048911	Bacteria	2454
313	Ga0496108_0178768	3300048911	Bacteria	1837
314	Ga0496108_0393691	3300048911	Bacteria	1210
315	Ga0496109_0000774	3300048912	Bacteria	26581
316	Ga0496110_0000647	3300048913	Bacteria	23828
317	Ga0496110_0062416	3300048913	Bacteria	3291
318	Ga0496110_0283564	3300048913	Bacteria	1508
319	Ga0496111_0010055	3300048914	Bacteria	6330
320	Ga0496112_0000354	3300048915	Bacteria	29882
321	Ga0496113_0012911	3300048916	Bacteria	5633
322	Ga0496113_0140727	3300048916	Bacteria	1898
323	Ga0496116_0024692	3300048919	Bacteria	4437
324	Ga0496117_0009129	3300048920	Bacteria	9304
325	Ga0496118_0041628	3300048921	Bacteria	3634
326	Ga0496118_0057330	3300048921	Bacteria	2920
327	Ga0496118_0140822	3300048921	Bacteria	1529
328	Ga0496118_0148005	3300048921	Bacteria	1474
329	Ga0496118_0307576	3300048921	Bacteria	867
330	Ga0496119_0065261	3300048922	Bacteria	2157
331	Ga0496119_0102513	3300048922	Bacteria	1604
332	Ga0496121_0007894	3300048924	Bacteria	12736
333	Ga0496121_0012248	3300048924	Bacteria	9391
334	Ga0496121_0047915	3300048924	Bacteria	3641
335	Ga0496121_0138335	3300048924	Bacteria	1811
336	Ga0496121_0154506	3300048924	Bacteria	1685
337	Ga0496121_0322647	3300048924	Bacteria	1039
338	Ga0496122_0000858	3300048925	Bacteria	57235
339	Ga0496122_0014706	3300048925	Bacteria	7546
340	Ga0496122_0265453	3300048925	Bacteria	950
341	Ga0496123_0000431	3300048926	Bacteria	75535
342	Ga0496123_0010591	3300048926	Bacteria	8117
343	Ga0496124_0016984	3300048927	Bacteria	6888
344	Ga0496124_0049195	3300048927	Bacteria	3597
345	Ga0496124_0062711	3300048927	Bacteria	3109
346	Ga0496125_0016545	3300048928	Bacteria	7076
347	Ga0496125_0040798	3300048928	Bacteria	3976
348	Ga0496125_0053387	3300048928	Bacteria	3313
349	Ga0496125_0082967	3300048928	Bacteria	2440
350	Ga0496125_0084193	3300048928	Bacteria	2416
351	Ga0496125_0118873	3300048928	Bacteria	1891
352	Ga0496125_0205633	3300048928	Bacteria	1284
353	Ga0496126_0007661	3300048929	Bacteria	11785
354	Ga0496126_0067839	3300048929	Bacteria	3186
355	Ga0496126_0135810	3300048929	Bacteria	2122
356	Ga0501032_0528205	3300049569	Bacteria	753
357	Ga0501047_0250695	3300049581	Bacteria	1619
358	Ga0501223_000042	3300049663	Bacteria	44258
359	Ga0501225_0000119	3300049705	Bacteria	24346
360	Ga0501225_0030159	3300049705	Bacteria	1491
361	Ga0501225_0040538	3300049705	Bacteria	1284
362	Ga0501273_028961	3300049770	Bacteria	781
363	Ga0501044_0000469	3300049823	Bacteria	49092
364	nmdc:mga03683_8_c1	3300050489	Bacteria	138266
365	nmdc:mga03n38_110521_c1	3300050490	Bacteria	1338
366	nmdc:mga03n38_704_c1	3300050490	Bacteria	8762
367	nmdc:mga00v17_21817_c1	3300050491	Bacteria	3687
368	nmdc:mga0k408_110080_c1	3300050493	Bacteria	1628
369	nmdc:mga0k408_212_c1	3300050493	Bacteria	31209
370	nmdc:mga06z11_1072_c1	3300050494	Bacteria	9952
371	nmdc:mga04h51_136_c1	3300050495	Bacteria	21531
372	nmdc:mga07m45_2_c1	3300050496	Bacteria	451154
373	nmdc:mga07m45_862_c1	3300050496	Bacteria	13219
374	nmdc:mga07m45_93766_c1	3300050496	Bacteria	1721
375	nmdc:mga0sz30_20925_c1	3300050516	Bacteria	2643
376	nmdc:mga0sz30_48_c1	3300050516	Bacteria	19397
377	Ga0500643_013697	3300053087	Bacteria	2852
378	Ga0500643_018491	3300053087	Bacteria	2311
379	Ga0500650_0065588	3300053098	Bacteria	1696
380	Ga0500556_0000014	3300053104	Bacteria	232989
381	Ga0500562_047263	3300053108	Bacteria	1148
382	Ga0500594_0003167	3300053118	Bacteria	3603
383	Ga0500607_000460	3300053121	Bacteria	39303
384	Ga0500608_020161	3300053122	Bacteria	3063
385	Ga0500642_0000001	3300053130	Bacteria	1468402
386	Ga0500559_0003985	3300053136	Bacteria	7105
387	Ga0500559_0037315	3300053136	Bacteria	2106
388	Ga0500559_0051338	3300053136	Bacteria	1821
389	Ga0500622_0001001	3300053156	Bacteria	23826
390	Ga0500624_000048	3300053157	Bacteria	82685
391	Ga0500636_0022973	3300053177	Bacteria	3686
392	Ga0500636_0061077	3300053177	Bacteria	2200
393	Ga0500637_0016466	3300053178	Bacteria	3940
394	Ga0500645_001534	3300053730	Bacteria	11539
395	Ga0466962_0024579	3300061719	Bacteria	2893

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049581	Ga0501047_0250695	Ga0501047_0250695_404_1051	215
2	iso_pu_bacteria	2512564014	2512644040	215
3	iso_pu_bacteria	2775507255	2778123832	215
4	2162886007	SwRhRL2b_contig_3772865	SwRhRL2b_0821.00000810	216
5	3300005841	Ga0068863_100000548	Ga0068863_1000005484	216
6	3300009177	Ga0105248_10699311	Ga0105248_106993113	216
7	3300026088	Ga0207641_10000348	Ga0207641_1000034813	216
8	3300031824	Ga0307413_10010354	Ga0307413_100103543	216
9	3300031852	Ga0307410_10477533	Ga0307410_104775331	216
10	3300032004	Ga0307414_10071384	Ga0307414_100713843	216
11	3300032005	Ga0307411_10320843	Ga0307411_103208433	216
12	3300046453	Ga0495627_000737	Ga0495627_000737_9847_10497	216
13	3300046471	Ga0495650_0000898	Ga0495650_0000898_6830_7480	216
14	3300046519	Ga0495632_0002518	Ga0495632_0002518_6381_7031	216
15	3300046530	Ga0495654_0005860	Ga0495654_0005860_3578_4228	216
16	3300047470	Ga0495681_0000275	Ga0495681_0000275_12760_13410	216
17	3300048924	Ga0496121_0322647	Ga0496121_0322647_287_937	216
18	3300006048	Ga0075363_100032331	Ga0075363_1000323313	217
19	3300006177	Ga0075362_10000018	Ga0075362_1000001848	217
20	3300006186	Ga0075369_10002686	Ga0075369_100026868	217
21	3300006186	Ga0075369_10097158	Ga0075369_100971582	217
22	3300006195	Ga0075366_10000303	Ga0075366_100003033	217
23	3300006353	Ga0075370_10000065	Ga0075370_1000006511	217
24	3300035691	Ga0373931_0031266	Ga0373931_0031266_142_795	217
25	3300049569	Ga0501032_0528205	Ga0501032_0528205_22_675	217
26	3300049823	Ga0501044_0000469	Ga0501044_0000469_25148_25801	217
27	3300050489	nmdc:mga03683_8_c1	nmdc:mga03683_8_c1_21300_21953	217
28	3300050490	nmdc:mga03n38_704_c1	nmdc:mga03n38_704_c1_1174_1827	217
29	3300050491	nmdc:mga00v17_21817_c1	nmdc:mga00v17_21817_c1_3007_3660	217
30	3300050493	nmdc:mga0k408_212_c1	nmdc:mga0k408_212_c1_9869_10522	217
31	3300050496	nmdc:mga07m45_2_c1	nmdc:mga07m45_2_c1_427077_427730	217
32	3300050496	nmdc:mga07m45_862_c1	nmdc:mga07m45_862_c1_8268_8921	217
33	3300050516	nmdc:mga0sz30_20925_c1	nmdc:mga0sz30_20925_c1_1932_2585	217
34	3300050516	nmdc:mga0sz30_48_c1	nmdc:mga0sz30_48_c1_42_695	217
35	3300053087	Ga0500643_013697	Ga0500643_013697_1803_2456	217
36	3300053121	Ga0500607_000460	Ga0500607_000460_773_1426	217
37	3300053136	Ga0500559_0003985	Ga0500559_0003985_3771_4424	217
38	3300053156	Ga0500622_0001001	Ga0500622_0001001_6146_6799	217
39	3300053178	Ga0500637_0016466	Ga0500637_0016466_560_1213	217
40	iso_pu_bacteria	2919138771	2919141257	217
41	3300001989	JGI24739J22299_10032316	JGI24739J22299_100323163	218
42	3300001990	JGI24737J22298_10039757	JGI24737J22298_100397571	218
43	3300001990	JGI24737J22298_10042067	JGI24737J22298_100420672	218
44	3300001991	JGI24743J22301_10014455	JGI24743J22301_100144552	218
45	3300002067	JGI24735J21928_10015263	JGI24735J21928_100152633	218
46	3300002067	JGI24735J21928_10024054	JGI24735J21928_100240543	218
47	3300002077	JGI24744J21845_10008064	JGI24744J21845_100080642	218
48	3300002244	JGI24742J22300_10025856	JGI24742J22300_100258561	218
49	3300002774	JGI25150J39212_1003534	JGI25150J39212_10035347	218
50	3300003187	JGI25151J46595_10050066	JGI25151J46595_100500662	218
51	3300003215	JGI25153J46596_10000186	JGI25153J46596_1000018654	218
52	3300003322	rootL2_10123190	rootL2_101231902	218
53	3300003323	rootH1_10120483	rootH1_101204836	218
54	3300003762	Ga0055542_1006837	Ga0055542_10068372	218
55	3300003791	Ga0055530_10010848	Ga0055530_100108483	218
56	3300003792	Ga0055540_1000768	Ga0055540_100076828	218
57	3300003792	Ga0055540_1002060	Ga0055540_10020609	218
58	3300005327	Ga0070658_10156868	Ga0070658_101568682	218
59	3300005327	Ga0070658_10232525	Ga0070658_102325253	218
60	3300005339	Ga0070660_100040882	Ga0070660_1000408823	218
61	3300005353	Ga0070669_100018657	Ga0070669_1000186576	218
62	3300005354	Ga0070675_100006402	Ga0070675_1000064026	218
63	3300005355	Ga0070671_100015454	Ga0070671_1000154547	218
64	3300005355	Ga0070671_100020752	Ga0070671_1000207522	218
65	3300005356	Ga0070674_100021737	Ga0070674_1000217373	218
66	3300005366	Ga0070659_100002740	Ga0070659_1000027403	218
67	3300005366	Ga0070659_100034151	Ga0070659_1000341516	218
68	3300005366	Ga0070659_100039134	Ga0070659_1000391345	218
69	3300005445	Ga0070708_100568304	Ga0070708_1005683042	218
70	3300005455	Ga0070663_100368060	Ga0070663_1003680602	218
71	3300005456	Ga0070678_100006441	Ga0070678_1000064413	218
72	3300005457	Ga0070662_100083579	Ga0070662_1000835793	218
73	3300005539	Ga0068853_100252431	Ga0068853_1002524312	218
74	3300005539	Ga0068853_100650632	Ga0068853_1006506322	218
75	3300005543	Ga0070672_100058268	Ga0070672_1000582682	218
76	3300005548	Ga0070665_100002555	Ga0070665_10000255513	218
77	3300005563	Ga0068855_100055285	Ga0068855_1000552854	218
78	3300005564	Ga0070664_100198291	Ga0070664_1001982914	218
79	3300005577	Ga0068857_100027005	Ga0068857_1000270055	218
80	3300005577	Ga0068857_100327937	Ga0068857_1003279372	218
81	3300005578	Ga0068854_100040917	Ga0068854_1000409172	218
82	3300005578	Ga0068854_100119731	Ga0068854_1001197312	218
83	3300005578	Ga0068854_100180792	Ga0068854_1001807923	218
84	3300005616	Ga0068852_100403523	Ga0068852_1004035232	218
85	3300005719	Ga0068861_100089669	Ga0068861_1000896694	218
86	3300005841	Ga0068863_100009063	Ga0068863_1000090637	218
87	3300005842	Ga0068858_100178979	Ga0068858_1001789792	218
88	3300005844	Ga0068862_100102028	Ga0068862_1001020284	218
89	3300005937	Ga0081455_10174605	Ga0081455_101746054	218
90	3300006881	Ga0068865_100259532	Ga0068865_1002595322	218
91	3300009093	Ga0105240_11406580	Ga0105240_114065801	218
92	3300009148	Ga0105243_10066615	Ga0105243_100666154	218
93	3300009174	Ga0105241_10043201	Ga0105241_100432013	218
94	3300009177	Ga0105248_10371457	Ga0105248_103714573	218
95	3300013100	Ga0157373_10009452	Ga0157373_100094525	218
96	3300013100	Ga0157373_10106838	Ga0157373_101068382	218
97	3300013104	Ga0157370_10490610	Ga0157370_104906102	218
98	3300013105	Ga0157369_10210307	Ga0157369_102103073	218
99	3300013307	Ga0157372_10019632	Ga0157372_100196323	218
100	3300020081	Ga0206354_11625545	Ga0206354_116255452	218
101	3300020082	Ga0206353_11095245	Ga0206353_110952455	218
102	3300021384	Ga0213876_10000671	Ga0213876_1000067128	218
103	3300025245	Ga0207425_1000049	Ga0207425_100004935	218
104	3300025254	Ga0209148_1000074	Ga0209148_1000074115	218
105	3300025258	Ga0209129_1010745	Ga0209129_10107455	218
106	3300025263	Ga0209565_1017864	Ga0209565_10178642	218
107	3300025292	Ga0209676_1034407	Ga0209676_10344071	218
108	3300025294	Ga0209025_1000068	Ga0209025_10000687	218
109	3300025297	Ga0209758_1000019	Ga0209758_1000019621	218
110	3300025298	Ga0209050_1000001	Ga0209050_10000011833	218
111	3300025298	Ga0209050_1000108	Ga0209050_1000108121	218
112	3300025303	Ga0209051_1005046	Ga0209051_100504612	218
113	3300025304	Ga0209257_1005464	Ga0209257_10054645	218
114	3300025304	Ga0209257_1022360	Ga0209257_10223602	218
115	3300025907	Ga0207645_10018561	Ga0207645_100185614	218
116	3300025909	Ga0207705_10000110	Ga0207705_1000011087	218
117	3300025909	Ga0207705_10179387	Ga0207705_101793872	218
118	3300025911	Ga0207654_10117340	Ga0207654_101173403	218
119	3300025919	Ga0207657_10010636	Ga0207657_100106363	218
120	3300025919	Ga0207657_10189940	Ga0207657_101899402	218
121	3300025920	Ga0207649_10151296	Ga0207649_101512963	218
122	3300025923	Ga0207681_10001962	Ga0207681_1000196210	218
123	3300025923	Ga0207681_10053262	Ga0207681_100532623	218
124	3300025926	Ga0207659_10010728	Ga0207659_100107285	218
125	3300025931	Ga0207644_10237009	Ga0207644_102370092	218
126	3300025931	Ga0207644_10337026	Ga0207644_103370262	218
127	3300025932	Ga0207690_10000522	Ga0207690_1000052230	218
128	3300025932	Ga0207690_10053450	Ga0207690_100534504	218
129	3300025937	Ga0207669_10016701	Ga0207669_100167014	218
130	3300025938	Ga0207704_10230891	Ga0207704_102308912	218
131	3300025941	Ga0207711_10010472	Ga0207711_100104722	218
132	3300025949	Ga0207667_10000071	Ga0207667_1000007134	218
133	3300025972	Ga0207668_10036787	Ga0207668_100367874	218
134	3300025981	Ga0207640_10041407	Ga0207640_100414073	218
135	3300025986	Ga0207658_10134198	Ga0207658_101341983	218
136	3300026041	Ga0207639_10054015	Ga0207639_100540153	218
137	3300026067	Ga0207678_10143071	Ga0207678_101430713	218
138	3300026078	Ga0207702_10027130	Ga0207702_100271302	218
139	3300026078	Ga0207702_10360483	Ga0207702_103604831	218
140	3300026088	Ga0207641_10003138	Ga0207641_1000313811	218
141	3300026116	Ga0207674_10010136	Ga0207674_100101367	218
142	3300026121	Ga0207683_10002781	Ga0207683_1000278121	218
143	3300026142	Ga0207698_10029224	Ga0207698_100292244	218
144	3300026142	Ga0207698_10330908	Ga0207698_103309082	218
145	3300028379	Ga0268266_10000198	Ga0268266_1000019820	218
146	3300028381	Ga0268264_10089449	Ga0268264_100894492	218
147	3300031824	Ga0307413_10489266	Ga0307413_104892661	218
148	3300031901	Ga0307406_10025759	Ga0307406_100257596	218
149	3300031903	Ga0307407_10001961	Ga0307407_100019618	218
150	3300031903	Ga0307407_10113594	Ga0307407_101135943	218
151	3300031995	Ga0307409_100221168	Ga0307409_1002211683	218
152	3300031995	Ga0307409_100241021	Ga0307409_1002410213	218
153	3300031995	Ga0307409_100268184	Ga0307409_1002681843	218
154	3300032004	Ga0307414_10017183	Ga0307414_100171836	218
155	3300032005	Ga0307411_10021932	Ga0307411_100219322	218
156	3300032005	Ga0307411_10450418	Ga0307411_104504182	218
157	3300032126	Ga0307415_100024609	Ga0307415_1000246096	218
158	3300039437	Ga0436365_1088341	Ga0436365_1088341_23860_24519	218
159	3300042006	Ga0439432_009122	Ga0439432_009122_852_1526	218
160	3300042007	Ga0439449_0010707	Ga0439449_0010707_303_977	218
161	3300042012	Ga0439455_0060834	Ga0439455_0060834_276_935	218
162	3300044658	Ga0466972_0001992	Ga0466972_0001992_4762_5421	218
163	3300044693	Ga0466961_0006506	Ga0466961_0006506_5761_6420	218
164	3300044694	Ga0466963_0004089	Ga0466963_0004089_6620_7285	218
165	3300044706	Ga0466964_0072670	Ga0466964_0072670_128_787	218
166	3300044719	Ga0466971_0013596	Ga0466971_0013596_383_1042	218
167	3300044735	Ga0466968_0052031	Ga0466968_0052031_452_1111	218
168	3300044765	Ga0466970_0001267	Ga0466970_0001267_2297_2956	218
169	3300044842	Ga0466957_0082442	Ga0466957_0082442_1130_1789	218
170	3300044901	Ga0466960_0005669	Ga0466960_0005669_444_1103	218
171	3300045049	Ga0466959_0001787	Ga0466959_0001787_12440_13099	218
172	3300045049	Ga0466959_0393682	Ga0466959_0393682_16_675	218
173	3300045836	Ga0466958_0025126	Ga0466958_0025126_743_1402	218
174	3300045836	Ga0466958_0063520	Ga0466958_0063520_974_1633	218
175	3300045976	Ga0466967_0139082	Ga0466967_0139082_1281_1946	218
176	3300047472	Ga0495686_0004626	Ga0495686_0004626_6487_7146	218
177	3300048905	Ga0496102_0342222	Ga0496102_0342222_58_717	218
178	3300048910	Ga0496107_0137126	Ga0496107_0137126_501_1166	218
179	3300048919	Ga0496116_0024692	Ga0496116_0024692_1208_1867	218
180	3300048921	Ga0496118_0041628	Ga0496118_0041628_2143_2802	218
181	3300048921	Ga0496118_0057330	Ga0496118_0057330_480_1139	218
182	3300048921	Ga0496118_0140822	Ga0496118_0140822_141_800	218
183	3300048922	Ga0496119_0065261	Ga0496119_0065261_687_1346	218
184	3300048924	Ga0496121_0007894	Ga0496121_0007894_6478_7137	218
185	3300048924	Ga0496121_0047915	Ga0496121_0047915_2253_2912	218
186	3300048924	Ga0496121_0138335	Ga0496121_0138335_205_864	218
187	3300048925	Ga0496122_0014706	Ga0496122_0014706_3660_4319	218
188	3300048925	Ga0496122_0265453	Ga0496122_0265453_219_878	218
189	3300048926	Ga0496123_0010591	Ga0496123_0010591_1683_2342	218
190	3300048928	Ga0496125_0040798	Ga0496125_0040798_2820_3479	218
191	3300048928	Ga0496125_0118873	Ga0496125_0118873_24_683	218
192	3300048928	Ga0496125_0205633	Ga0496125_0205633_143_802	218
193	3300048929	Ga0496126_0067839	Ga0496126_0067839_159_818	218
194	3300049770	Ga0501273_028961	Ga0501273_028961_69_743	218
195	3300053136	Ga0500559_0037315	Ga0500559_0037315_1182_1841	218
196	3300061719	Ga0466962_0024579	Ga0466962_0024579_1490_2149	218
197	2162886007	SwRhRL2b_contig_1450093	SwRhRL2b_0110.00010270	219
198	2162886007	SwRhRL2b_contig_922431	SwRhRL2b_0256.00001780	219
199	3300001915	JGI24741J21665_1000091	JGI24741J21665_100009110	219
200	3300001976	JGI24752J21851_1000568	JGI24752J21851_10005683	219
201	3300001979	JGI24740J21852_10001400	JGI24740J21852_100014006	219
202	3300001989	JGI24739J22299_10000493	JGI24739J22299_100004933	219
203	3300001990	JGI24737J22298_10078672	JGI24737J22298_100786722	219
204	3300002067	JGI24735J21928_10001087	JGI24735J21928_100010873	219
205	3300003771	Ga0055526_1004582	Ga0055526_10045825	219
206	3300003773	Ga0055537_1007931	Ga0055537_10079315	219
207	3300005295	Ga0065707_10179577	Ga0065707_101795772	219
208	3300005327	Ga0070658_10023792	Ga0070658_100237925	219
209	3300005331	Ga0070670_100010913	Ga0070670_1000109134	219
210	3300005335	Ga0070666_10008183	Ga0070666_100081837	219
211	3300005344	Ga0070661_100070276	Ga0070661_1000702762	219
212	3300005353	Ga0070669_100000012	Ga0070669_10000001218	219
213	3300005353	Ga0070669_100096434	Ga0070669_1000964342	219
214	3300005355	Ga0070671_100000019	Ga0070671_10000001918	219
215	3300005355	Ga0070671_100000469	Ga0070671_10000046919	219
216	3300005355	Ga0070671_100066072	Ga0070671_1000660723	219
217	3300005364	Ga0070673_100011976	Ga0070673_1000119766	219
218	3300005366	Ga0070659_100499782	Ga0070659_1004997822	219
219	3300005367	Ga0070667_100231297	Ga0070667_1002312972	219
220	3300005367	Ga0070667_100575820	Ga0070667_1005758202	219
221	3300005440	Ga0070705_100015450	Ga0070705_1000154504	219
222	3300005455	Ga0070663_100027909	Ga0070663_1000279093	219
223	3300005466	Ga0070685_10023857	Ga0070685_100238573	219
224	3300005535	Ga0070684_100395828	Ga0070684_1003958282	219
225	3300005539	Ga0068853_100060803	Ga0068853_1000608033	219
226	3300005544	Ga0070686_100078185	Ga0070686_1000781852	219
227	3300005548	Ga0070665_101046254	Ga0070665_1010462542	219
228	3300005563	Ga0068855_100412968	Ga0068855_1004129682	219
229	3300005564	Ga0070664_100065894	Ga0070664_1000658943	219
230	3300005564	Ga0070664_100107737	Ga0070664_1001077373	219
231	3300005577	Ga0068857_100127391	Ga0068857_1001273913	219
232	3300005577	Ga0068857_100162718	Ga0068857_1001627182	219
233	3300005578	Ga0068854_100092820	Ga0068854_1000928203	219
234	3300005614	Ga0068856_100109461	Ga0068856_1001094612	219
235	3300005616	Ga0068852_100250213	Ga0068852_1002502133	219
236	3300005617	Ga0068859_100001454	Ga0068859_10000145421	219
237	3300005618	Ga0068864_100001010	Ga0068864_10000101014	219
238	3300005618	Ga0068864_100014358	Ga0068864_1000143587	219
239	3300005719	Ga0068861_100007383	Ga0068861_1000073836	219
240	3300005834	Ga0068851_10025430	Ga0068851_100254302	219
241	3300005834	Ga0068851_10033866	Ga0068851_100338663	219
242	3300005841	Ga0068863_100003659	Ga0068863_10000365910	219
243	3300005841	Ga0068863_100181544	Ga0068863_1001815444	219
244	3300005842	Ga0068858_100002778	Ga0068858_10000277818	219
245	3300005842	Ga0068858_100113550	Ga0068858_1001135503	219
246	3300006042	Ga0075368_10002355	Ga0075368_100023559	219
247	3300006048	Ga0075363_100005360	Ga0075363_1000053606	219
248	3300006178	Ga0075367_10008705	Ga0075367_100087052	219
249	3300006353	Ga0075370_10044042	Ga0075370_100440423	219
250	3300006931	Ga0097620_100001454	Ga0097620_10000145421	219
251	3300009011	Ga0105251_10009719	Ga0105251_100097192	219
252	3300009011	Ga0105251_10075631	Ga0105251_100756312	219
253	3300009093	Ga0105240_10698645	Ga0105240_106986452	219
254	3300009093	Ga0105240_11064873	Ga0105240_110648732	219
255	3300009101	Ga0105247_10002750	Ga0105247_100027505	219
256	3300009147	Ga0114129_10243414	Ga0114129_102434142	219
257	3300009174	Ga0105241_10000807	Ga0105241_1000080730	219
258	3300009177	Ga0105248_10000928	Ga0105248_1000092824	219
259	3300009177	Ga0105248_10157075	Ga0105248_101570754	219
260	3300009545	Ga0105237_10039374	Ga0105237_100393742	219
261	3300009553	Ga0105249_10000553	Ga0105249_1000055343	219
262	3300009553	Ga0105249_10178935	Ga0105249_101789353	219
263	3300009978	Ga0105148_100060	Ga0105148_10006022	219
264	3300010375	Ga0105239_10361961	Ga0105239_103619613	219
265	3300012513	Ga0157326_1000067	Ga0157326_10000674	219
266	3300013100	Ga0157373_10082970	Ga0157373_100829703	219
267	3300013104	Ga0157370_10186804	Ga0157370_101868042	219
268	3300013306	Ga0163162_10001039	Ga0163162_1000103910	219
269	3300013307	Ga0157372_10100807	Ga0157372_101008072	219
270	3300014325	Ga0163163_10036136	Ga0163163_100361365	219
271	3300014968	Ga0157379_10072698	Ga0157379_100726984	219
272	3300017792	Ga0163161_10002388	Ga0163161_100023885	219
273	3300025229	Ga0209147_101887	Ga0209147_1018877	219
274	3300025263	Ga0209565_1001004	Ga0209565_10010041	219
275	3300025295	Ga0209564_1004346	Ga0209564_10043463	219
276	3300025297	Ga0209758_1017162	Ga0209758_10171623	219
277	3300025298	Ga0209050_1009946	Ga0209050_10099464	219
278	3300025304	Ga0209257_1032822	Ga0209257_10328222	219
279	3300025315	Ga0207697_10000372	Ga0207697_100003728	219
280	3300025900	Ga0207710_10028849	Ga0207710_100288492	219
281	3300025903	Ga0207680_10000142	Ga0207680_100001428	219
282	3300025904	Ga0207647_10006596	Ga0207647_100065968	219
283	3300025904	Ga0207647_10054444	Ga0207647_100544444	219
284	3300025909	Ga0207705_10021882	Ga0207705_100218824	219
285	3300025920	Ga0207649_10020288	Ga0207649_100202883	219
286	3300025923	Ga0207681_10000004	Ga0207681_10000004553	219
287	3300025923	Ga0207681_10088895	Ga0207681_100888953	219
288	3300025923	Ga0207681_10239658	Ga0207681_102396582	219
289	3300025923	Ga0207681_10410468	Ga0207681_104104682	219
290	3300025925	Ga0207650_10000706	Ga0207650_1000070622	219
291	3300025931	Ga0207644_10000031	Ga0207644_1000003119	219
292	3300025931	Ga0207644_10000514	Ga0207644_1000051414	219
293	3300025931	Ga0207644_10080856	Ga0207644_100808563	219
294	3300025933	Ga0207706_10032170	Ga0207706_100321702	219
295	3300025941	Ga0207711_10000243	Ga0207711_1000024330	219
296	3300025945	Ga0207679_10284528	Ga0207679_102845282	219
297	3300025960	Ga0207651_10009419	Ga0207651_100094197	219
298	3300025961	Ga0207712_10135710	Ga0207712_101357102	219
299	3300025972	Ga0207668_10000135	Ga0207668_1000013517	219
300	3300025981	Ga0207640_10077153	Ga0207640_100771532	219
301	3300025986	Ga0207658_10048711	Ga0207658_100487112	219
302	3300025986	Ga0207658_10256560	Ga0207658_102565603	219
303	3300026035	Ga0207703_10033576	Ga0207703_100335764	219
304	3300026035	Ga0207703_10091942	Ga0207703_100919423	219
305	3300026041	Ga0207639_10000138	Ga0207639_1000013862	219
306	3300026041	Ga0207639_10008360	Ga0207639_100083603	219
307	3300026067	Ga0207678_10003206	Ga0207678_100032065	219
308	3300026078	Ga0207702_10006612	Ga0207702_1000661214	219
309	3300026088	Ga0207641_10940446	Ga0207641_109404461	219
310	3300026095	Ga0207676_10000591	Ga0207676_1000059113	219
311	3300026095	Ga0207676_10004790	Ga0207676_1000479011	219
312	3300026116	Ga0207674_10028798	Ga0207674_100287989	219
313	3300026116	Ga0207674_10039836	Ga0207674_100398363	219
314	3300026116	Ga0207674_10116440	Ga0207674_101164404	219
315	3300026118	Ga0207675_100000684	Ga0207675_10000068425	219
316	3300026142	Ga0207698_10175480	Ga0207698_101754802	219
317	3300026142	Ga0207698_10535961	Ga0207698_105359612	219
318	3300027866	Ga0209813_10000036	Ga0209813_1000003628	219
319	3300028379	Ga0268266_10353047	Ga0268266_103530473	219
320	3300028380	Ga0268265_10001018	Ga0268265_100010188	219
321	3300028381	Ga0268264_10000483	Ga0268264_1000048347	219
322	3300031548	Ga0307408_100033828	Ga0307408_1000338283	219
323	3300031731	Ga0307405_10011171	Ga0307405_100111717	219
324	3300031852	Ga0307410_10396825	Ga0307410_103968251	219
325	3300031911	Ga0307412_10054161	Ga0307412_100541614	219
326	3300031995	Ga0307409_100314674	Ga0307409_1003146742	219
327	3300032004	Ga0307414_10034242	Ga0307414_100342422	219
328	3300032004	Ga0307414_10226756	Ga0307414_102267562	219
329	3300035692	Ga0373935_0315740	Ga0373935_0315740_198_863	219
330	3300046452	Ga0495617_110675	Ga0495617_110675_152_811	219
331	3300046460	Ga0495638_0000018	Ga0495638_0000018_168751_169410	219
332	3300046506	Ga0495583_0000559	Ga0495583_0000559_26304_26963	219
333	3300046519	Ga0495632_0000113	Ga0495632_0000113_77472_78131	219
334	3300046524	Ga0495648_0000018	Ga0495648_0000018_113081_113740	219
335	3300046524	Ga0495648_0036328	Ga0495648_0036328_1508_2167	219
336	3300046524	Ga0495648_0278753	Ga0495648_0278753_22_681	219
337	3300046542	Ga0495597_0094853	Ga0495597_0094853_284_943	219
338	3300046557	Ga0495622_0010748	Ga0495622_0010748_731_1390	219
339	3300046558	Ga0495633_0029161	Ga0495633_0029161_987_1646	219
340	3300046616	Ga0495668_0082616	Ga0495668_0082616_714_1373	219
341	3300046660	Ga0495625_0008029	Ga0495625_0008029_7876_8535	219
342	3300046692	Ga0495671_0000011	Ga0495671_0000011_231551_232210	219
343	3300046692	Ga0495671_0014862	Ga0495671_0014862_1447_2106	219
344	3300047469	Ga0495673_0000013	Ga0495673_0000013_499615_500274	219
345	3300048903	Ga0496100_0014427	Ga0496100_0014427_2604_3272	219
346	3300048904	Ga0496101_0004188	Ga0496101_0004188_2074_2742	219
347	3300048909	Ga0496106_0000666	Ga0496106_0000666_5741_6409	219
348	3300048910	Ga0496107_0000181	Ga0496107_0000181_17994_18662	219
349	3300048911	Ga0496108_0001061	Ga0496108_0001061_9893_10552	219
350	3300048911	Ga0496108_0101492	Ga0496108_0101492_807_1475	219
351	3300048911	Ga0496108_0178768	Ga0496108_0178768_955_1614	219
352	3300048911	Ga0496108_0393691	Ga0496108_0393691_91_780	219
353	3300048912	Ga0496109_0000774	Ga0496109_0000774_7963_8631	219
354	3300048913	Ga0496110_0000647	Ga0496110_0000647_7199_7867	219
355	3300048913	Ga0496110_0062416	Ga0496110_0062416_1236_1895	219
356	3300048913	Ga0496110_0283564	Ga0496110_0283564_484_1143	219
357	3300048914	Ga0496111_0010055	Ga0496111_0010055_3491_4159	219
358	3300048915	Ga0496112_0000354	Ga0496112_0000354_10902_11570	219
359	3300048916	Ga0496113_0012911	Ga0496113_0012911_3500_4168	219
360	3300048916	Ga0496113_0140727	Ga0496113_0140727_664_1323	219
361	3300048920	Ga0496117_0009129	Ga0496117_0009129_4087_4746	219
362	3300048921	Ga0496118_0148005	Ga0496118_0148005_231_890	219
363	3300048921	Ga0496118_0307576	Ga0496118_0307576_143_805	219
364	3300048922	Ga0496119_0102513	Ga0496119_0102513_547_1206	219
365	3300048924	Ga0496121_0012248	Ga0496121_0012248_4800_5459	219
366	3300048924	Ga0496121_0154506	Ga0496121_0154506_153_812	219
367	3300048925	Ga0496122_0000858	Ga0496122_0000858_24379_25038	219
368	3300048926	Ga0496123_0000431	Ga0496123_0000431_4291_4950	219
369	3300048927	Ga0496124_0016984	Ga0496124_0016984_892_1551	219
370	3300048927	Ga0496124_0049195	Ga0496124_0049195_325_984	219
371	3300048927	Ga0496124_0062711	Ga0496124_0062711_2281_2940	219
372	3300048928	Ga0496125_0016545	Ga0496125_0016545_967_1626	219
373	3300048928	Ga0496125_0053387	Ga0496125_0053387_70_729	219
374	3300048928	Ga0496125_0082967	Ga0496125_0082967_401_1060	219
375	3300048928	Ga0496125_0084193	Ga0496125_0084193_37_714	219
376	3300048929	Ga0496126_0007661	Ga0496126_0007661_4816_5475	219
377	3300048929	Ga0496126_0135810	Ga0496126_0135810_688_1347	219
378	3300049663	Ga0501223_000042	Ga0501223_000042_23473_24132	219
379	3300049705	Ga0501225_0000119	Ga0501225_0000119_18841_19500	219
380	3300049705	Ga0501225_0030159	Ga0501225_0030159_270_929	219
381	3300049705	Ga0501225_0040538	Ga0501225_0040538_494_1153	219
382	3300050490	nmdc:mga03n38_110521_c1	nmdc:mga03n38_110521_c1_292_951	219
383	3300050493	nmdc:mga0k408_110080_c1	nmdc:mga0k408_110080_c1_741_1421	219
384	3300050494	nmdc:mga06z11_1072_c1	nmdc:mga06z11_1072_c1_5616_6275	219
385	3300050495	nmdc:mga04h51_136_c1	nmdc:mga04h51_136_c1_1088_1747	219
386	3300050496	nmdc:mga07m45_93766_c1	nmdc:mga07m45_93766_c1_409_1068	219
387	3300053087	Ga0500643_018491	Ga0500643_018491_1030_1689	219
388	3300053098	Ga0500650_0065588	Ga0500650_0065588_738_1397	219
389	3300053104	Ga0500556_0000014	Ga0500556_0000014_119299_119958	219
390	3300053108	Ga0500562_047263	Ga0500562_047263_186_845	219
391	3300053118	Ga0500594_0003167	Ga0500594_0003167_2022_2681	219
392	3300053122	Ga0500608_020161	Ga0500608_020161_827_1486	219
393	3300053130	Ga0500642_0000001	Ga0500642_0000001_745829_746488	219
394	3300053136	Ga0500559_0051338	Ga0500559_0051338_186_845	219
395	3300053157	Ga0500624_000048	Ga0500624_000048_12436_13095	219
396	3300053177	Ga0500636_0022973	Ga0500636_0022973_815_1474	219
397	3300053177	Ga0500636_0061077	Ga0500636_0061077_714_1373	219
398	3300053730	Ga0500645_001534	Ga0500645_001534_3799_4521	219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

25

203

0.93 PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

27

209

0.91 PF13242

Hydrolase_like

HAD-hyrolase-like

163

234

0.88 PF12710

HAD

haloacid dehalogenase-like hydrolase

27

200

0.74 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3d6j-assembly1.cif.gz_A	crystal structure of putative haloacid dehalogenase-like hydrolase from bacteroides fragilis	0.9203	3	212
3d6j-assembly1.cif.gz_A	crystal structure of putative haloacid dehalogenase-like hydrolase from bacteroides fragilis	0.9077	3	212
2hdo-assembly1.cif.gz_A	crystal structure of putative phosphoglycolate phosphatase (np_784602.1) from lactobacillus plantarum at 1.50 a resolution	0.8945	1	212
3mc1-assembly1.cif.gz_A	crystal structure of a predicted phosphatase from clostridium acetobutylicum	0.8922	1	216
2ah5-assembly1.cif.gz_A	hydrolase, haloacid dehalogenase-like family protein sp0104 from streptococcus pneumoniae	0.8774	3	215

ID	Description	Score	Start	End	Superfamily
af_P32662_111_227_3.40.50.1000	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like	0.951	90	202	3.40.50.1000
af_Q652P6_229_339_3.40.50.1000	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like	0.9429	107	208	3.40.50.1000
4ex7A01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like	0.9375	3	216	3.40.50.1000
af_O17773_104_249_3.40.50.1000	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like	0.9353	95	218	3.40.50.1000
af_D7SFJ0_151_278_3.40.50.1000	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like	0.9287	95	210	3.40.50.1000

ID	Description	Score	Start	End	GO Terms
AF-A0A352GRB0-F1-model_v4	Haloacid dehalogenase	0.9797	28	216	GO:0005829 GO:0006281 GO:0008967
AF-A0A2D6FWS7-F1-model_v4	Haloacid dehalogenase	0.9772	3	216	GO:0005829 GO:0006281 GO:0008967
AF-A0A196M974-F1-model_v4	Haloacid dehalogenase	0.9768	1	219	GO:0005829 GO:0006281 GO:0008967
AF-A0A520GYT1-F1-model_v4	HAD family hydrolase	0.9766	1	216	GO:0005829 GO:0006281 GO:0008967
AF-A0A520HV79-F1-model_v4	HAD family hydrolase	0.9763	3	193	GO:0005829 GO:0006281 GO:0008967

Feature Viewer

pLDDT	pTM	Quality
96.81	0.92	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F434051

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

25

203

0.93

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

27

209

0.91

PF13242

Hydrolase_like

HAD-hyrolase-like

163

234

0.88

PF12710

HAD

haloacid dehalogenase-like hydrolase

27

200

0.74

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map