F434050

General Info

Members Datasets Scaffolds Average Seq Length
398 242 796 240

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10098654|Ga0213876_100986541
Length 284
Sequence MKLRAKRMTRDLFEIHVPVYVARAALSVQGFRMRFADRAFVVTGGSRGIGRGIVKRLVEEGARAAIIDTDVHAGRDAEEEYGDRVRFWRADISREPDVRKTLTAIVKWARRLDGLVNNAGIADPEVGPVDKLALATWQRFLDVNLTGAFLMTKHAVRHLAKTRGSIINISSTRALQSEPDTIAYAATKGGLVALTHALAVSLGPEVRVNCVSPGWIATSEYLPRDKRHPPELSKADHEQHPAGRVGTPEDIAGLCAYLLSEEAGFVTGANFTADGGMTRKMIYA

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
98 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
101 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
102 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
105 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
106 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
107 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
108 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
109 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
110 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
111 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
116 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
132 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
133 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
134 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
137 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
158 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
231 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
232 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
233 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
234 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
235 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
236 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
237 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
241 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
242 2857472729 Cohnella sp. R-74144 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.25
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.04
Nodule 0
Rhizoplane 7.54
Rhizosphere 82.41
Stem 0
Stem Tuber 0
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10098654 3300021384 Bacteria 1548
2 JGI25162J39368_1003086 3300002737 Bacteria 5339
3 Ga0055535_1002100 3300003761 Bacteria 7917
4 Ga0055542_1001142 3300003762 Bacteria 15639
5 Ga0068868_100641557 3300005338 Bacteria 945
6 Ga0070689_100399275 3300005340 Bacteria 1162
7 Ga0070675_100039694 3300005354 Bacteria 3842
8 Ga0070671_100532655 3300005355 Bacteria 1012
9 Ga0070674_100375598 3300005356 Bacteria 1155
10 Ga0070688_100236704 3300005365 Bacteria 1294
11 Ga0070709_10156289 3300005434 Bacteria 1581
12 Ga0070709_10169411 3300005434 Bacteria 1525
13 Ga0070714_100022081 3300005435 Bacteria 5215
14 Ga0070714_100747127 3300005435 Bacteria 945
15 Ga0070713_100020212 3300005436 Bacteria 5100
16 Ga0070713_100266994 3300005436 Bacteria 1566
17 Ga0070713_100667484 3300005436 Bacteria 991
18 Ga0070711_100014872 3300005439 Bacteria 4915
19 Ga0070694_100106414 3300005444 Bacteria 1992
20 Ga0070663_100179337 3300005455 Bacteria 1642
21 Ga0070663_100301817 3300005455 Bacteria 1282
22 Ga0070678_100042460 3300005456 Bacteria 3232
23 Ga0070681_10779292 3300005458 Bacteria 873
24 Ga0070698_100662991 3300005471 Bacteria 985
25 Ga0070679_100014345 3300005530 Bacteria 7610
26 Ga0070679_100033652 3300005530 Bacteria 5075
27 Ga0070672_100318406 3300005543 Bacteria 1322
28 Ga0070665_100361016 3300005548 Bacteria 1459
29 Ga0070704_100478400 3300005549 Bacteria 1077
30 Ga0068856_100066305 3300005614 Bacteria 3568
31 Ga0068864_100337535 3300005618 Bacteria 1419
32 Ga0068866_10332940 3300005718 Bacteria 959
33 Ga0068863_100403671 3300005841 Bacteria 1337
34 Ga0068863_100579854 3300005841 Bacteria 1109
35 Ga0068858_100164861 3300005842 Bacteria 2088
36 Ga0068862_100742696 3300005844 Bacteria 954
37 Ga0081455_10000022 3300005937 Bacteria 159620
38 Ga0081540_1000066 3300005983 Bacteria 115420
39 Ga0081539_10046384 3300005985 Bacteria 2490
40 Ga0070717_10112087 3300006028 Bacteria 2328
41 Ga0075365_10078843 3300006038 Bacteria 2228
42 Ga0075368_10097194 3300006042 Bacteria 1207
43 Ga0075363_100004062 3300006048 Bacteria 6335
44 Ga0075364_10049246 3300006051 Bacteria 2747
45 Ga0070712_100008517 3300006175 Bacteria 6453
46 Ga0075362_10097361 3300006177 Bacteria 1372
47 Ga0075369_10035951 3300006186 Bacteria 2106
48 Ga0075366_10020715 3300006195 Bacteria 3818
49 Ga0075366_10059544 3300006195 Bacteria 2268
50 Ga0075428_100084810 3300006844 Bacteria 3456
51 Ga0075428_100242243 3300006844 Bacteria 1945
52 Ga0075428_100519211 3300006844 Bacteria 1274
53 Ga0075430_100072205 3300006846 Bacteria 2895
54 Ga0075430_100129149 3300006846 Bacteria 2106
55 Ga0075430_100368382 3300006846 Bacteria 1186
56 Ga0075431_100016876 3300006847 Bacteria 7414
57 Ga0075431_100025052 3300006847 Bacteria 6117
58 Ga0075431_100055123 3300006847 Bacteria 4100
59 Ga0075431_100157347 3300006847 Bacteria 2338
60 Ga0075433_10002806 3300006852 Bacteria 13350
61 Ga0075433_10254619 3300006852 Bacteria 1557
62 Ga0075434_100000682 3300006871 Bacteria 26436
63 Ga0075434_100146296 3300006871 Bacteria 2383
64 Ga0075434_100518011 3300006871 Bacteria 1213
65 Ga0075429_100211068 3300006880 Bacteria 1701
66 Ga0075429_100266750 3300006880 Bacteria 1499
67 Ga0075436_100400758 3300006914 Bacteria 994
68 Ga0075435_100131164 3300007076 Bacteria 2097
69 Ga0075435_100391574 3300007076 Bacteria 1194
70 Ga0111539_10003925 3300009094 Bacteria 19546
71 Ga0111539_10009884 3300009094 Bacteria 12040
72 Ga0111539_10023642 3300009094 Bacteria 7551
73 Ga0111539_10027179 3300009094 Bacteria 6988
74 Ga0111539_10538238 3300009094 Bacteria 1360
75 Ga0105245_10030521 3300009098 Bacteria 4766
76 Ga0114129_10028613 3300009147 Bacteria 7895
77 Ga0114129_10209791 3300009147 Bacteria 2634
78 Ga0114129_10539160 3300009147 Bacteria 1519
79 Ga0114129_10569155 3300009147 Bacteria 1471
80 Ga0114129_10764826 3300009147 Bacteria 1235
81 Ga0114129_10822160 3300009147 Bacteria 1183
82 Ga0105248_10841971 3300009177 Bacteria 1035
83 Ga0105238_10735664 3300009551 Bacteria 1000
84 Ga0105246_10232953 3300011119 Bacteria 1451
85 Ga0157378_10290871 3300013297 Bacteria 1578
86 Ga0163163_10037370 3300014325 Bacteria 4724
87 Ga0157380_10022838 3300014326 Bacteria 4717
88 Ga0157380_10030058 3300014326 Bacteria 4157
89 Ga0157380_10343905 3300014326 Bacteria 1393
90 Ga0157380_10425075 3300014326 Bacteria 1268
91 Ga0182008_10066176 3300014497 Bacteria 1778
92 Ga0157379_10408756 3300014968 Bacteria 1249
93 Ga0157379_10422380 3300014968 Bacteria 1228
94 Ga0157376_10217962 3300014969 Bacteria 1766
95 Ga0163161_10406533 3300017792 Bacteria 1093
96 Ga0209672_101543 3300025228 Bacteria 7955
97 Ga0209258_100111 3300025242 Bacteria 197019
98 Ga0209148_1000099 3300025254 Bacteria 227713
99 Ga0207692_10177204 3300025898 Bacteria 1240
100 Ga0207693_10001446 3300025915 Bacteria 21017
101 Ga0207693_10022441 3300025915 Bacteria 5015
102 Ga0207663_10041558 3300025916 Bacteria 2803
103 Ga0207652_10027366 3300025921 Bacteria 4751
104 Ga0207650_10656209 3300025925 Bacteria 885
105 Ga0207659_10268344 3300025926 Bacteria 1391
106 Ga0207687_10706804 3300025927 Bacteria 856
107 Ga0207700_10044485 3300025928 Bacteria 3269
108 Ga0207700_10118307 3300025928 Bacteria 2144
109 Ga0207664_10195249 3300025929 Bacteria 1744
110 Ga0207664_10513314 3300025929 Bacteria 1074
111 Ga0207644_10402614 3300025931 Bacteria 1119
112 Ga0207709_10426927 3300025935 Bacteria 1019
113 Ga0207670_10065811 3300025936 Bacteria 2488
114 Ga0207670_10673573 3300025936 Bacteria 855
115 Ga0207669_10336210 3300025937 Bacteria 1161
116 Ga0207691_10330117 3300025940 Bacteria 1307
117 Ga0207711_10846336 3300025941 Bacteria 851
118 Ga0207712_10584527 3300025961 Bacteria 964
119 Ga0207677_10419198 3300026023 Bacteria 1140
120 Ga0207678_10196675 3300026067 Bacteria 1723
121 Ga0207708_10181863 3300026075 Bacteria 1669
122 Ga0207702_10049823 3300026078 Bacteria 3535
123 Ga0207641_10344612 3300026088 Bacteria 1419
124 Ga0207683_10004724 3300026121 Bacteria 11737
125 Ga0207683_10060743 3300026121 Bacteria 3323
126 Ga0207683_10487030 3300026121 Bacteria 1139
127 Ga0209999_1014272 3300027543 Bacteria 1442
128 Ga0209588_1020662 3300027671 Bacteria 2062
129 Ga0207428_10010757 3300027907 Bacteria 8160
130 Ga0207428_10071221 3300027907 Bacteria 2731
131 Ga0268266_10471726 3300028379 Bacteria 1195
132 Ga0268266_10810793 3300028379 Bacteria 904
133 Ga0268264_10322638 3300028381 Bacteria 1461
134 Ga0265338_10045999 3300028800 Bacteria 4005
135 Ga0265338_10188531 3300028800 Bacteria 1565
136 Ga0265760_10022639 3300031090 Bacteria 1821
137 Ga0265320_10103799 3300031240 Bacteria 1307
138 Ga0265316_10143946 3300031344 Unclassified 1789
139 Ga0316578_10014295 3300031728 Bacteria 4236
140 Ga0316578_10225151 3300031728 Bacteria 1127
141 Ga0307516_10032070 3300031730 Bacteria 5292
142 Ga0307416_100350697 3300032002 Bacteria 1493
143 Ga0373950_0019617 3300034818 Bacteria 1183
144 Ga0373944_0011778 3300035089 Bacteria 2401
145 Ga0373923_0079081 3300035111 Bacteria 1424
146 Ga0373936_0077900 3300035113 Bacteria 1376
147 Ga0373939_0019036 3300035114 Bacteria 1847
148 Ga0373941_0009386 3300035115 Bacteria 2463
149 Ga0373945_0041752 3300035116 Bacteria 1659
150 Ga0373953_0105343 3300035117 Bacteria 1189
151 Ga0373953_0149513 3300035117 Bacteria 1001
152 Ga0373954_0000006 3300035118 Bacteria 98573
153 Ga0373956_0025933 3300035119 Bacteria 2536
154 Ga0373957_0038910 3300035120 Bacteria 1782
155 Ga0373960_0018447 3300035121 Bacteria 1820
156 Ga0373943_0001944 3300035170 Bacteria 9358
157 Ga0373943_0080887 3300035170 Bacteria 1666
158 Ga0373946_0027558 3300035171 Bacteria 2248
159 Ga0373955_0014482 3300035172 Bacteria 3838
160 Ga0373955_0048526 3300035172 Bacteria 2303
161 Ga0373962_0085168 3300035242 Bacteria 965
162 Ga0373924_0048696 3300035410 Bacteria 1751
163 Ga0373924_0078586 3300035410 Bacteria 1401
164 Ga0373931_0001236 3300035691 Bacteria 10921
165 Ga0373931_0012356 3300035691 Bacteria 4137
166 Ga0373931_0051608 3300035691 Bacteria 2191
167 Ga0373935_0026987 3300035692 Bacteria 3549
168 Ga0373935_0418303 3300035692 Bacteria 964
169 Ga0373927_0013767 3300035695 Bacteria 5368
170 Ga0373927_0112319 3300035695 Bacteria 1776
171 Ga0373927_0160099 3300035695 Bacteria 1475
172 Ga0373927_0188629 3300035695 Bacteria 1353
173 Ga0373933_0003105 3300035724 Bacteria 9262
174 Ga0373933_0071692 3300035724 Bacteria 2109
175 Ga0373933_0086609 3300035724 Bacteria 1928
176 Ga0373947_0001044 3300035725 Bacteria 16908
177 Ga0373947_0077905 3300035725 Bacteria 2045
178 Ga0373947_0142924 3300035725 Bacteria 1536
179 Ga0373937_0004331 3300036401 Bacteria 12046
180 Ga0373937_0004767 3300036401 Bacteria 11518
181 Ga0373937_0039249 3300036401 Bacteria 4315
182 Ga0373937_0311284 3300036401 Bacteria 1489
183 Ga0373937_0940012 3300036401 Bacteria 813
184 Ga0316584_0006874 3300036712 Bacteria 7732
185 Ga0373925_0005123 3300037068 Bacteria 9818
186 Ga0373925_0024337 3300037068 Bacteria 4421
187 Ga0373925_0075023 3300037068 Bacteria 2562
188 Ga0373925_0080534 3300037068 Bacteria 2475
189 Ga0395899_0040260 3300037312 Bacteria 3496
190 Ga0395900_0324610 3300037418 Bacteria 1519
191 Ga0436364_0283460 3300037853 Bacteria 986
192 Ga0436364_0860903 3300037853 Bacteria 907
193 Ga0436365_0438120 3300039437 Bacteria 1428
194 Ga0436365_0538311 3300039437 Bacteria 2104
195 Ga0436365_1015051 3300039437 Bacteria 2621
196 Ga0436365_1700413 3300039437 Bacteria 1069
197 Ga0436365_1787026 3300039437 Bacteria 2444
198 Ga0436361_0539584 3300039447 Bacteria 2391
199 Ga0436363_0240572 3300039450 Bacteria 2430
200 Ga0439462_0028102 3300042015 Bacteria 1486
201 Ga0451577_0021396 3300042876 Bacteria 5920
202 Ga0451577_0100475 3300042876 Bacteria 2584
203 Ga0451577_0108079 3300042876 Bacteria 2487
204 Ga0466972_0065118 3300044658 Bacteria 1744
205 Ga0453683_0267560 3300044673 Bacteria 1091
206 Ga0453683_0307796 3300044673 Bacteria 1014
207 Ga0466961_0009362 3300044693 Bacteria 6239
208 Ga0453684_0059604 3300044712 Unclassified 4919
209 Ga0453684_0066933 3300044712 Bacteria 4572
210 Ga0466960_0030708 3300044901 Bacteria 2475
211 Ga0451576_0008546 3300045051 Bacteria 12006
212 Ga0451576_0034126 3300045051 Bacteria 5404
213 Ga0466958_0007723 3300045836 Bacteria 5934
214 Ga0466967_0124761 3300045976 Bacteria 2384
215 Ga0495629_0237452 3300046459 Bacteria 1255
216 Ga0495629_0376448 3300046459 Bacteria 966
217 Ga0495651_0011544 3300046462 Bacteria 6785
218 Ga0495651_0269681 3300046462 Bacteria 1154
219 Ga0495653_0076844 3300046463 Bacteria 2481
220 Ga0495653_0163937 3300046463 Bacteria 1541
221 Ga0495580_0527251 3300046472 Bacteria 786
222 Ga0495662_0088190 3300046476 Bacteria 1511
223 Ga0495664_0020299 3300046477 Bacteria 3831
224 Ga0495608_0043071 3300046511 Bacteria 3017
225 Ga0495608_0202939 3300046511 Bacteria 1248
226 Ga0495630_0055109 3300046517 Bacteria 2979
227 Ga0495630_0225987 3300046517 Bacteria 1429
228 Ga0495666_0022450 3300046526 Bacteria 3125
229 Ga0495665_0004921 3300046531 Bacteria 7200
230 Ga0495640_0011729 3300046533 Bacteria 6728
231 Ga0495640_0353538 3300046533 Bacteria 907
232 Ga0495587_0127361 3300046536 Bacteria 1456
233 Ga0495645_0000240 3300046543 Bacteria 40002
234 Ga0495667_0062234 3300046559 Bacteria 2446
235 Ga0495667_0073117 3300046559 Bacteria 2234
236 Ga0495634_0126030 3300046642 Bacteria 1636
237 Ga0495634_0187882 3300046642 Bacteria 1290
238 Ga0495634_0201080 3300046642 Bacteria 1238
239 Ga0495635_0175363 3300046663 Bacteria 1457
240 Ga0495635_0261150 3300046663 Bacteria 1166
241 Ga0495659_0210066 3300046664 Bacteria 801
242 Ga0495588_0260585 3300046674 Bacteria 914
243 Ga0495657_0045746 3300046675 Bacteria 2968
244 Ga0495599_0008099 3300046678 Bacteria 6382
245 Ga0495599_0039028 3300046678 Bacteria 2984
246 Ga0495623_0028759 3300046679 Bacteria 3576
247 Ga0495646_0090314 3300046680 Bacteria 1770
248 Ga0495613_0171432 3300046689 Bacteria 1540
249 Ga0495624_0004432 3300046690 Bacteria 10272
250 Ga0495581_0003767 3300047315 Bacteria 8729
251 Ga0495581_0397906 3300047315 Bacteria 803
252 Ga0495604_0005059 3300047317 Bacteria 10436
253 Ga0495674_0012480 3300047319 Bacteria 8005
254 Ga0495674_0444717 3300047319 Bacteria 1042
255 Ga0495680_0079412 3300047322 Bacteria 2481
256 Ga0495680_0173343 3300047322 Bacteria 1561
257 Ga0495675_0300318 3300047444 Bacteria 954
258 Ga0495684_0008545 3300047471 Bacteria 7929
259 Ga0495684_0031062 3300047471 Bacteria 4100
260 Ga0495593_0032314 3300047673 Bacteria 2854
261 Ga0495602_0000578 3300048088 Bacteria 34156
262 Ga0495602_0038363 3300048088 Bacteria 4430
263 Ga0495602_0127131 3300048088 Bacteria 2040
264 Ga0496100_0004683 3300048903 Bacteria 7291
265 Ga0496101_0028811 3300048904 Bacteria 3880
266 Ga0496102_0325976 3300048905 Bacteria 1446
267 Ga0496103_0175240 3300048906 Bacteria 1378
268 Ga0496104_0014190 3300048907 Bacteria 7189
269 Ga0496104_0074998 3300048907 Bacteria 3221
270 Ga0496104_0493961 3300048907 Bacteria 1135
271 Ga0496105_0062270 3300048908 Bacteria 3079
272 Ga0496106_0003917 3300048909 Bacteria 11114
273 Ga0496106_0054887 3300048909 Bacteria 3011
274 Ga0496107_0005506 3300048910 Bacteria 8665
275 Ga0496107_0016194 3300048910 Bacteria 5233
276 Ga0496108_0006217 3300048911 Bacteria 9669
277 Ga0496108_0022933 3300048911 Bacteria 5136
278 Ga0496108_0029504 3300048911 Bacteria 4543
279 Ga0496109_0021312 3300048912 Bacteria 5729
280 Ga0496109_0024379 3300048912 Bacteria 5378
281 Ga0496110_0004094 3300048913 Bacteria 11256
282 Ga0496110_0005148 3300048913 Bacteria 10218
283 Ga0496110_0081268 3300048913 Bacteria 2889
284 Ga0496110_0935191 3300048913 Bacteria 773
285 Ga0496111_0008094 3300048914 Bacteria 6942
286 Ga0496111_0087037 3300048914 Bacteria 2287
287 Ga0496112_0003442 3300048915 Bacteria 13072
288 Ga0496112_0026492 3300048915 Bacteria 5579
289 Ga0496112_0549228 3300048915 Bacteria 1089
290 Ga0496113_0023071 3300048916 Bacteria 4409
291 Ga0496113_0169208 3300048916 Bacteria 1730
292 Ga0496115_0023919 3300048918 Bacteria 4744
293 Ga0496115_0162377 3300048918 Bacteria 1847
294 Ga0496119_0005533 3300048922 Bacteria 12040
295 Ga0501031_0125346 3300049568 Bacteria 1678
296 Ga0501033_0081153 3300049570 Bacteria 2379
297 Ga0501036_0154949 3300049572 Bacteria 1932
298 Ga0501036_0475944 3300049572 Bacteria 1040
299 Ga0501037_0194364 3300049573 Bacteria 1436
300 Ga0501038_0198100 3300049574 Bacteria 1613
301 Ga0501039_0177345 3300049575 Bacteria 1676
302 Ga0501039_0451103 3300049575 Bacteria 1010
303 Ga0501039_0482592 3300049575 Bacteria 973
304 Ga0501040_0033180 3300049576 Bacteria 3496
305 Ga0501040_0058079 3300049576 Bacteria 2657
306 Ga0501042_0407652 3300049578 Bacteria 985
307 Ga0501046_0007029 3300049580 Bacteria 9916
308 Ga0501046_0093073 3300049580 Bacteria 2317
309 Ga0501046_0183564 3300049580 Bacteria 1563
310 Ga0501047_0015274 3300049581 Bacteria 7314
311 Ga0501047_0128854 3300049581 Bacteria 2411
312 Ga0501048_0016594 3300049582 Bacteria 5430
313 Ga0501048_0513542 3300049582 Bacteria 859
314 Ga0501070_0045900 3300049586 Bacteria 3633
315 Ga0501071_0000374 3300049587 Bacteria 21971
316 Ga0501071_0025173 3300049587 Bacteria 4167
317 Ga0501072_0033537 3300049588 Bacteria 4023
318 Ga0501072_0149149 3300049588 Bacteria 1865
319 Ga0501072_0181774 3300049588 Bacteria 1677
320 Ga0501074_0206530 3300049590 Bacteria 1399
321 Ga0501075_0004466 3300049591 Bacteria 9471
322 Ga0501075_0019899 3300049591 Bacteria 4875
323 Ga0501076_0002436 3300049592 Bacteria 12773
324 Ga0501076_0005318 3300049592 Bacteria 9238
325 Ga0501076_0111469 3300049592 Bacteria 2211
326 Ga0501076_0168721 3300049592 Bacteria 1784
327 Ga0501076_0199782 3300049592 Bacteria 1632
328 Ga0501077_0047207 3300049593 Bacteria 2736
329 Ga0501077_0055796 3300049593 Bacteria 2508
330 Ga0501077_0207687 3300049593 Bacteria 1244
331 Ga0501079_0011169 3300049741 Bacteria 6850
332 Ga0501079_0035780 3300049741 Bacteria 3823
333 Ga0501079_0066020 3300049741 Bacteria 2792
334 Ga0501079_0128605 3300049741 Bacteria 1971
335 Ga0501080_0022232 3300049742 Bacteria 5875
336 Ga0501080_0125797 3300049742 Bacteria 2374
337 Ga0501081_0005618 3300049743 Bacteria 8103
338 Ga0501081_0073812 3300049743 Bacteria 2379
339 Ga0501081_0281607 3300049743 Bacteria 1217
340 Ga0501035_0506482 3300049822 Bacteria 993
341 Ga0501044_0360037 3300049823 Bacteria 1373
342 Ga0501045_0000469 3300049824 Bacteria 25071
343 Ga0501045_0191482 3300049824 Bacteria 1524
344 Ga0501045_0255016 3300049824 Bacteria 1306
345 Ga0501045_0378798 3300049824 Bacteria 1053
346 nmdc:mga03683_40277_c1 3300050489 Bacteria 1596
347 nmdc:mga00v17_41936_c1 3300050491 Bacteria 2751
348 nmdc:mga0yw44_399775_c1 3300050492 Bacteria 929
349 nmdc:mga0k408_22427_c1 3300050493 Bacteria 3555
350 nmdc:mga0k408_34117_c1 3300050493 Bacteria 2912
351 nmdc:mga06z11_64841_c1 3300050494 Bacteria 1916
352 nmdc:mga05p37_35946_c1 3300050507 Bacteria 6078
353 nmdc:mga05p37_661821_c1 3300050507 Bacteria 1167
354 nmdc:mga09592_104876_c1 3300050508 Bacteria 2423
355 nmdc:mga09592_250316_c1 3300050508 Bacteria 1536
356 nmdc:mga09592_359587_c1 3300050508 Bacteria 1260
357 nmdc:mga09592_7087_c1 3300050508 Bacteria 9110
358 nmdc:mga0qj67_16463_c1 3300050509 Bacteria 5609
359 nmdc:mga0qj67_358703_c1 3300050509 Bacteria 1178
360 nmdc:mga06r32_102932_c1 3300050510 Bacteria 2803
361 nmdc:mga06r32_10669_c1 3300050510 Bacteria 8284
362 nmdc:mga06r32_177839_c1 3300050510 Bacteria 2113
363 nmdc:mga06r32_181890_c1 3300050510 Bacteria 2088
364 nmdc:mga06r32_50210_c1 3300050510 Bacteria 3990
365 nmdc:mga06r32_82088_c1 3300050510 Bacteria 3140
366 nmdc:mga08y16_139847_c1 3300050511 Bacteria 2517
367 nmdc:mga08y16_232894_c1 3300050511 Bacteria 1905
368 nmdc:mga08y16_589611_c1 3300050511 Bacteria 1121
369 nmdc:mga0n895_3101_c1 3300050512 Bacteria 13235
370 nmdc:mga0rr50_114940_c1 3300050513 Bacteria 2135
371 nmdc:mga0rr50_277697_c1 3300050513 Bacteria 1397
372 nmdc:mga0rr50_373476_c1 3300050513 Bacteria 1202
373 nmdc:mga08x19_217925_c1 3300050514 Bacteria 1311
374 nmdc:mga08x19_24144_c1 3300050514 Bacteria 3774
375 nmdc:mga08x19_309054_c1 3300050514 Bacteria 1099
376 nmdc:mga08x19_484480_c1 3300050514 Bacteria 872
377 nmdc:mga0a205_270860_c1 3300050515 Bacteria 1575
378 nmdc:mga0a205_3468_c1 3300050515 Bacteria 14083
379 Ga0495601_0008672 3300053077 Bacteria 6000
380 Ga0495595_0078735 3300053084 Bacteria 1567
381 Ga0495619_0025245 3300053085 Bacteria 3815
382 Ga0495619_0093505 3300053085 Bacteria 2038
383 Ga0500640_001356 3300053095 Bacteria 7342
384 Ga0500572_001097 3300053111 Bacteria 7937
385 Ga0500595_000124 3300053119 Bacteria 50847
386 Ga0500597_032461 3300053120 Bacteria 2158
387 Ga0500614_000109 3300053123 Bacteria 19858
388 Ga0500559_0034733 3300053136 Bacteria 2175
389 Ga0500564_143100 3300053138 Bacteria 1025
390 Ga0500627_0008201 3300053158 Bacteria 3695
391 Ga0501084_0000511 3300054114 Bacteria 29785
392 Ga0501084_0035263 3300054114 Bacteria 4182
393 Ga0501084_0314030 3300054114 Bacteria 1324
394 Ga0501082_0008241 3300060353 Bacteria 8986
395 Ga0501082_0102605 3300060353 Bacteria 2474
396 Ga0530510_0252067 3300061734 Bacteria 1315
397 2524191533 2524023129 Bacteria 6762600
398 2857478952 2857472729 Bacteria 6568124
399 Ga0213876_10098654
400 JGI25162J39368_1003086
401 Ga0055535_1002100
402 Ga0055542_1001142
403 Ga0068868_100641557
404 Ga0070689_100399275
405 Ga0070675_100039694
406 Ga0070671_100532655
407 Ga0070674_100375598
408 Ga0070688_100236704
409 Ga0070709_10156289
410 Ga0070709_10169411
411 Ga0070714_100022081
412 Ga0070714_100747127
413 Ga0070713_100020212
414 Ga0070713_100266994
415 Ga0070713_100667484
416 Ga0070711_100014872
417 Ga0070694_100106414
418 Ga0070663_100179337
419 Ga0070663_100301817
420 Ga0070678_100042460
421 Ga0070681_10779292
422 Ga0070698_100662991
423 Ga0070679_100014345
424 Ga0070679_100033652
425 Ga0070672_100318406
426 Ga0070665_100361016
427 Ga0070704_100478400
428 Ga0068856_100066305
429 Ga0068864_100337535
430 Ga0068866_10332940
431 Ga0068863_100403671
432 Ga0068863_100579854
433 Ga0068858_100164861
434 Ga0068862_100742696
435 Ga0081455_10000022
436 Ga0081540_1000066
437 Ga0081539_10046384
438 Ga0070717_10112087
439 Ga0075365_10078843
440 Ga0075368_10097194
441 Ga0075363_100004062
442 Ga0075364_10049246
443 Ga0070712_100008517
444 Ga0075362_10097361
445 Ga0075369_10035951
446 Ga0075366_10020715
447 Ga0075366_10059544
448 Ga0075428_100084810
449 Ga0075428_100242243
450 Ga0075428_100519211
451 Ga0075430_100072205
452 Ga0075430_100129149
453 Ga0075430_100368382
454 Ga0075431_100016876
455 Ga0075431_100025052
456 Ga0075431_100055123
457 Ga0075431_100157347
458 Ga0075433_10002806
459 Ga0075433_10254619
460 Ga0075434_100000682
461 Ga0075434_100146296
462 Ga0075434_100518011
463 Ga0075429_100211068
464 Ga0075429_100266750
465 Ga0075436_100400758
466 Ga0075435_100131164
467 Ga0075435_100391574
468 Ga0111539_10003925
469 Ga0111539_10009884
470 Ga0111539_10023642
471 Ga0111539_10027179
472 Ga0111539_10538238
473 Ga0105245_10030521
474 Ga0114129_10028613
475 Ga0114129_10209791
476 Ga0114129_10539160
477 Ga0114129_10569155
478 Ga0114129_10764826
479 Ga0114129_10822160
480 Ga0105248_10841971
481 Ga0105238_10735664
482 Ga0105246_10232953
483 Ga0157378_10290871
484 Ga0163163_10037370
485 Ga0157380_10022838
486 Ga0157380_10030058
487 Ga0157380_10343905
488 Ga0157380_10425075
489 Ga0182008_10066176
490 Ga0157379_10408756
491 Ga0157379_10422380
492 Ga0157376_10217962
493 Ga0163161_10406533
494 Ga0209672_101543
495 Ga0209258_100111
496 Ga0209148_1000099
497 Ga0207692_10177204
498 Ga0207693_10001446
499 Ga0207693_10022441
500 Ga0207663_10041558
501 Ga0207652_10027366
502 Ga0207650_10656209
503 Ga0207659_10268344
504 Ga0207687_10706804
505 Ga0207700_10044485
506 Ga0207700_10118307
507 Ga0207664_10195249
508 Ga0207664_10513314
509 Ga0207644_10402614
510 Ga0207709_10426927
511 Ga0207670_10065811
512 Ga0207670_10673573
513 Ga0207669_10336210
514 Ga0207691_10330117
515 Ga0207711_10846336
516 Ga0207712_10584527
517 Ga0207677_10419198
518 Ga0207678_10196675
519 Ga0207708_10181863
520 Ga0207702_10049823
521 Ga0207641_10344612
522 Ga0207683_10004724
523 Ga0207683_10060743
524 Ga0207683_10487030
525 Ga0209999_1014272
526 Ga0209588_1020662
527 Ga0207428_10010757
528 Ga0207428_10071221
529 Ga0268266_10471726
530 Ga0268266_10810793
531 Ga0268264_10322638
532 Ga0265338_10045999
533 Ga0265338_10188531
534 Ga0265760_10022639
535 Ga0265320_10103799
536 Ga0265316_10143946
537 Ga0316578_10014295
538 Ga0316578_10225151
539 Ga0307516_10032070
540 Ga0307416_100350697
541 Ga0373950_0019617
542 Ga0373944_0011778
543 Ga0373923_0079081
544 Ga0373936_0077900
545 Ga0373939_0019036
546 Ga0373941_0009386
547 Ga0373945_0041752
548 Ga0373953_0105343
549 Ga0373953_0149513
550 Ga0373954_0000006
551 Ga0373956_0025933
552 Ga0373957_0038910
553 Ga0373960_0018447
554 Ga0373943_0001944
555 Ga0373943_0080887
556 Ga0373946_0027558
557 Ga0373955_0014482
558 Ga0373955_0048526
559 Ga0373962_0085168
560 Ga0373924_0048696
561 Ga0373924_0078586
562 Ga0373931_0001236
563 Ga0373931_0012356
564 Ga0373931_0051608
565 Ga0373935_0026987
566 Ga0373935_0418303
567 Ga0373927_0013767
568 Ga0373927_0112319
569 Ga0373927_0160099
570 Ga0373927_0188629
571 Ga0373933_0003105
572 Ga0373933_0071692
573 Ga0373933_0086609
574 Ga0373947_0001044
575 Ga0373947_0077905
576 Ga0373947_0142924
577 Ga0373937_0004331
578 Ga0373937_0004767
579 Ga0373937_0039249
580 Ga0373937_0311284
581 Ga0373937_0940012
582 Ga0316584_0006874
583 Ga0373925_0005123
584 Ga0373925_0024337
585 Ga0373925_0075023
586 Ga0373925_0080534
587 Ga0395899_0040260
588 Ga0395900_0324610
589 Ga0436364_0283460
590 Ga0436364_0860903
591 Ga0436365_0438120
592 Ga0436365_0538311
593 Ga0436365_1015051
594 Ga0436365_1700413
595 Ga0436365_1787026
596 Ga0436361_0539584
597 Ga0436363_0240572
598 Ga0439462_0028102
599 Ga0451577_0021396
600 Ga0451577_0100475
601 Ga0451577_0108079
602 Ga0466972_0065118
603 Ga0453683_0267560
604 Ga0453683_0307796
605 Ga0466961_0009362
606 Ga0453684_0059604
607 Ga0453684_0066933
608 Ga0466960_0030708
609 Ga0451576_0008546
610 Ga0451576_0034126
611 Ga0466958_0007723
612 Ga0466967_0124761
613 Ga0495629_0237452
614 Ga0495629_0376448
615 Ga0495651_0011544
616 Ga0495651_0269681
617 Ga0495653_0076844
618 Ga0495653_0163937
619 Ga0495580_0527251
620 Ga0495662_0088190
621 Ga0495664_0020299
622 Ga0495608_0043071
623 Ga0495608_0202939
624 Ga0495630_0055109
625 Ga0495630_0225987
626 Ga0495666_0022450
627 Ga0495665_0004921
628 Ga0495640_0011729
629 Ga0495640_0353538
630 Ga0495587_0127361
631 Ga0495645_0000240
632 Ga0495667_0062234
633 Ga0495667_0073117
634 Ga0495634_0126030
635 Ga0495634_0187882
636 Ga0495634_0201080
637 Ga0495635_0175363
638 Ga0495635_0261150
639 Ga0495659_0210066
640 Ga0495588_0260585
641 Ga0495657_0045746
642 Ga0495599_0008099
643 Ga0495599_0039028
644 Ga0495623_0028759
645 Ga0495646_0090314
646 Ga0495613_0171432
647 Ga0495624_0004432
648 Ga0495581_0003767
649 Ga0495581_0397906
650 Ga0495604_0005059
651 Ga0495674_0012480
652 Ga0495674_0444717
653 Ga0495680_0079412
654 Ga0495680_0173343
655 Ga0495675_0300318
656 Ga0495684_0008545
657 Ga0495684_0031062
658 Ga0495593_0032314
659 Ga0495602_0000578
660 Ga0495602_0038363
661 Ga0495602_0127131
662 Ga0496100_0004683
663 Ga0496101_0028811
664 Ga0496102_0325976
665 Ga0496103_0175240
666 Ga0496104_0014190
667 Ga0496104_0074998
668 Ga0496104_0493961
669 Ga0496105_0062270
670 Ga0496106_0003917
671 Ga0496106_0054887
672 Ga0496107_0005506
673 Ga0496107_0016194
674 Ga0496108_0006217
675 Ga0496108_0022933
676 Ga0496108_0029504
677 Ga0496109_0021312
678 Ga0496109_0024379
679 Ga0496110_0004094
680 Ga0496110_0005148
681 Ga0496110_0081268
682 Ga0496110_0935191
683 Ga0496111_0008094
684 Ga0496111_0087037
685 Ga0496112_0003442
686 Ga0496112_0026492
687 Ga0496112_0549228
688 Ga0496113_0023071
689 Ga0496113_0169208
690 Ga0496115_0023919
691 Ga0496115_0162377
692 Ga0496119_0005533
693 Ga0501031_0125346
694 Ga0501033_0081153
695 Ga0501036_0154949
696 Ga0501036_0475944
697 Ga0501037_0194364
698 Ga0501038_0198100
699 Ga0501039_0177345
700 Ga0501039_0451103
701 Ga0501039_0482592
702 Ga0501040_0033180
703 Ga0501040_0058079
704 Ga0501042_0407652
705 Ga0501046_0007029
706 Ga0501046_0093073
707 Ga0501046_0183564
708 Ga0501047_0015274
709 Ga0501047_0128854
710 Ga0501048_0016594
711 Ga0501048_0513542
712 Ga0501070_0045900
713 Ga0501071_0000374
714 Ga0501071_0025173
715 Ga0501072_0033537
716 Ga0501072_0149149
717 Ga0501072_0181774
718 Ga0501074_0206530
719 Ga0501075_0004466
720 Ga0501075_0019899
721 Ga0501076_0002436
722 Ga0501076_0005318
723 Ga0501076_0111469
724 Ga0501076_0168721
725 Ga0501076_0199782
726 Ga0501077_0047207
727 Ga0501077_0055796
728 Ga0501077_0207687
729 Ga0501079_0011169
730 Ga0501079_0035780
731 Ga0501079_0066020
732 Ga0501079_0128605
733 Ga0501080_0022232
734 Ga0501080_0125797
735 Ga0501081_0005618
736 Ga0501081_0073812
737 Ga0501081_0281607
738 Ga0501035_0506482
739 Ga0501044_0360037
740 Ga0501045_0000469
741 Ga0501045_0191482
742 Ga0501045_0255016
743 Ga0501045_0378798
744 nmdc:mga03683_40277_c1
745 nmdc:mga00v17_41936_c1
746 nmdc:mga0yw44_399775_c1
747 nmdc:mga0k408_22427_c1
748 nmdc:mga0k408_34117_c1
749 nmdc:mga06z11_64841_c1
750 nmdc:mga05p37_35946_c1
751 nmdc:mga05p37_661821_c1
752 nmdc:mga09592_104876_c1
753 nmdc:mga09592_250316_c1
754 nmdc:mga09592_359587_c1
755 nmdc:mga09592_7087_c1
756 nmdc:mga0qj67_16463_c1
757 nmdc:mga0qj67_358703_c1
758 nmdc:mga06r32_102932_c1
759 nmdc:mga06r32_10669_c1
760 nmdc:mga06r32_177839_c1
761 nmdc:mga06r32_181890_c1
762 nmdc:mga06r32_50210_c1
763 nmdc:mga06r32_82088_c1
764 nmdc:mga08y16_139847_c1
765 nmdc:mga08y16_232894_c1
766 nmdc:mga08y16_589611_c1
767 nmdc:mga0n895_3101_c1
768 nmdc:mga0rr50_114940_c1
769 nmdc:mga0rr50_277697_c1
770 nmdc:mga0rr50_373476_c1
771 nmdc:mga08x19_217925_c1
772 nmdc:mga08x19_24144_c1
773 nmdc:mga08x19_309054_c1
774 nmdc:mga08x19_484480_c1
775 nmdc:mga0a205_270860_c1
776 nmdc:mga0a205_3468_c1
777 Ga0495601_0008672
778 Ga0495595_0078735
779 Ga0495619_0025245
780 Ga0495619_0093505
781 Ga0500640_001356
782 Ga0500572_001097
783 Ga0500595_000124
784 Ga0500597_032461
785 Ga0500614_000109
786 Ga0500559_0034733
787 Ga0500564_143100
788 Ga0500627_0008201
789 Ga0501084_0000511
790 Ga0501084_0035263
791 Ga0501084_0314030
792 Ga0501082_0008241
793 Ga0501082_0102605
794 Ga0530510_0252067
795 2524191533
796 2857478952

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

38

226

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

44

278

0.94

PF08659

KR

KR domain

39

209

0.88

PF23441

31

279

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t5q-assembly1.cif.gz_B crystal structure of short-chain dehydrogenase/reductase sdr:glucose/ribitol dehydrogenase from brucella melitensis 0.9542 14 259
3geg-assembly1.cif.gz_A fingerprint and structural analysis of a scor enzyme with its bound cofactor from clostridium thermocellum 0.9495 16 265
3ged-assembly1.cif.gz_B fingerprint and structural analysis of a apo scor enzyme from clostridium thermocellum 0.9495 16 265
8hs9-assembly3.cif.gz_C brucella melitensis 7-alpha-hydroxysteroid dehydrogenase mutant:i258m/k262t 0.9467 12 257
4bmn-assembly1.cif.gz_B apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9463 9 260
ID Description Score Start End Superfamily
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9511 6 196 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9442 12 262 3.40.50.720
af_Q54N15_5_159_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.942 65 187 3.40.50.720
3dijB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9417 16 265 3.40.50.720
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9364 9 260 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2D8RJA8-F1-model_v4 Oxidoreductase 0.9908 18 266 GO:0016491
AF-A0A7W8JJY3-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9888 1 266 GO:0016491
AF-A0A3R5XWQ0-F1-model_v4 SDR family oxidoreductase 0.9867 18 266
AF-A0A2P5Z2B3-F1-model_v4 Short-chain dehydrogenase 0.9861 1 266 GO:0016491
AF-A0A850GQ45-F1-model_v4 deleted 0.9856 18 266

Map