F434036

General Info

Members Datasets Scaffolds Average Seq Length
398 281 278 330

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10018604|Ga0157371_100186043
Length 347
Sequence MGRLDHMTAKTVTPRYIVPDVMKAIDPDAPGGPEVLVLVERAVPHPGAGXXXXKVAAAGVNRPEVMQRQGKYPPPPGAPSILGMEIAGTIVAVGDGVGEEQIGQRICALITGGAYAEYAVAPFGQCLSVPEALTMVEAAAMPETLFTVWTNLFERAYATEGDTVLVHGGTSGIGTMAIGLCSIFGIDIIVTAGSKAKCQAALSLGATHAIDYKTEDFVERVKQITGGKGVAAVLDMVGGDYVARNLQCLAEDGRHVSIAVQGGANATVPLFEIMRRRLTLTGSTLRPRDTAFKSLVADELARTVWPHVEAGKLKPVIDRVFAFADAPAAHARMEAGDHVGKIVLSMT

Samples

Sample ID Description Type Environment
1 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
2 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
3 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
4 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
5 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
6 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
7 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
8 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
9 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
10 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
11 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
12 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
13 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
14 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
15 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
16 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
17 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
18 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
19 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
20 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
21 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
22 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
23 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
24 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
25 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
26 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
27 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
28 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
29 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
30 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
31 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
32 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
33 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
34 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
35 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
36 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
37 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
38 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
39 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
40 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
41 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
42 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
43 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
44 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
45 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
46 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
47 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
48 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
49 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
50 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
51 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
52 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
53 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
54 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
55 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
56 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
57 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
58 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
59 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
60 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
61 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
62 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
63 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
64 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
65 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
66 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
67 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
68 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
69 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
70 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
71 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
72 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
73 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
74 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
75 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
76 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
77 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
78 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
79 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
80 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
81 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
82 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
83 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
84 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
85 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
86 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
87 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
88 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
89 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
90 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
91 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
92 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
93 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
94 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
95 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
96 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
97 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
98 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
99 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
100 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
101 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
102 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
103 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
104 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
105 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
106 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
107 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
108 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
109 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
110 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
111 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
112 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
113 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
114 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
115 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
116 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
117 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
118 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
119 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
120 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
121 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
122 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
123 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
124 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
125 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
126 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
127 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
128 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
129 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
130 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
131 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
132 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
133 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
134 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
135 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
136 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
137 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
138 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
139 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
140 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
141 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
142 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
143 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
144 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
145 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
146 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
147 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
148 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
149 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
150 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
151 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
152 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
153 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
154 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
155 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
156 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
157 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
158 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
159 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
160 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
161 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
162 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
163 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
164 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
165 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
166 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
167 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
168 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
169 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
170 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
171 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
172 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
173 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
174 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
175 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
176 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
177 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
178 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
179 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
180 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
181 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
182 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
183 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
184 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
187 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
189 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
191 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
220 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
222 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
223 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
224 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
225 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
226 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
227 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
228 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
229 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
230 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
231 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
232 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
233 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
234 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
235 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
236 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
237 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
238 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
239 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
240 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
241 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
242 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
243 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
244 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
245 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
246 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
247 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
248 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
249 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
250 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
251 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
252 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
253 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
254 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
257 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
258 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
259 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
260 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
267 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
268 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
269 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
272 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
273 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
274 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
275 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
276 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
277 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
278 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
279 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
280 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
281 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.85
Metatranscriptomes 0
Isolates 30.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.29
Nodule 27.89
Rhizoplane 1.76
Rhizosphere 57.79
Stem 0
Stem Tuber 0
Unclassified 5.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000519 3300001904 Bacteria 7186
2 JGI24736J21556_1002154 3300001904 Bacteria 3496
3 JGI24741J21665_1000583 3300001915 Bacteria 11060
4 JGI24740J21852_10005710 3300001979 Bacteria 5233
5 JGI24739J22299_10003840 3300001989 Bacteria 5732
6 JGI24735J21928_10000683 3300002067 Bacteria 12035
7 JGI25150J39212_1000886 3300002774 Bacteria 9837
8 JGI25151J46595_10026616 3300003187 Bacteria 2331
9 JGI25165J46597_1000024 3300003214 Bacteria 335150
10 JGI25153J46596_10000091 3300003215 Bacteria 105614
11 JGI25153J46596_10000186 3300003215 Bacteria 60427
12 rootH1_10006736 3300003316 Bacteria 1227
13 Ga0055526_1009414 3300003771 Bacteria 4701
14 Ga0055537_1001804 3300003773 Bacteria 7783
15 Ga0065165_1003640 3300005262 Bacteria 10533
16 Ga0065704_10001898 3300005289 Bacteria 6321
17 Ga0070658_10007316 3300005327 Bacteria 8916
18 Ga0070658_10019618 3300005327 Bacteria 5413
19 Ga0070683_100450155 3300005329 Bacteria 1228
20 Ga0070660_100001066 3300005339 Bacteria 18437
21 Ga0070660_100017115 3300005339 Bacteria 5278
22 Ga0070660_100073630 3300005339 Bacteria 2671
23 Ga0070661_100138020 3300005344 Bacteria 1836
24 Ga0070692_10034107 3300005345 Bacteria 2568
25 Ga0070668_100017467 3300005347 Bacteria 5378
26 Ga0070668_100039885 3300005347 Bacteria 3592
27 Ga0070675_100023581 3300005354 Bacteria 4921
28 Ga0070675_100038793 3300005354 Bacteria 3884
29 Ga0070673_100017391 3300005364 Bacteria 5111
30 Ga0070688_100014671 3300005365 Bacteria 4443
31 Ga0070659_100011540 3300005366 Bacteria 6537
32 Ga0070659_100017777 3300005366 Bacteria 5355
33 Ga0070659_100020518 3300005366 Bacteria 5021
34 Ga0070659_100132963 3300005366 Bacteria 2021
35 Ga0070659_100266432 3300005366 Bacteria 1422
36 Ga0070663_100012087 3300005455 Bacteria 5448
37 Ga0070678_100016484 3300005456 Bacteria 4729
38 Ga0070684_100105217 3300005535 Bacteria 2525
39 Ga0068853_100119786 3300005539 Bacteria 2346
40 Ga0068853_100174762 3300005539 Bacteria 1945
41 Ga0070672_100070368 3300005543 Bacteria 2780
42 Ga0070665_100006682 3300005548 Bacteria 11728
43 Ga0068855_100001731 3300005563 Bacteria 27264
44 Ga0068855_100116519 3300005563 Bacteria 3062
45 Ga0070664_100042633 3300005564 Bacteria 3830
46 Ga0070664_100072362 3300005564 Bacteria 2956
47 Ga0068857_100057636 3300005577 Bacteria 3448
48 Ga0068857_100093600 3300005577 Bacteria 2691
49 Ga0068854_100001958 3300005578 Bacteria 12586
50 Ga0068854_100066261 3300005578 Bacteria 2628
51 Ga0068856_100008682 3300005614 Bacteria 9884
52 Ga0068856_100169423 3300005614 Bacteria 2196
53 Ga0068852_100001847 3300005616 Bacteria 14394
54 Ga0068852_100007109 3300005616 Bacteria 8155
55 Ga0068852_100156132 3300005616 Bacteria 2126
56 Ga0068859_100021809 3300005617 Bacteria 6424
57 Ga0068861_100000349 3300005719 Bacteria 26297
58 Ga0068860_100080306 3300005843 Bacteria 3102
59 Ga0097620_100021809 3300006931 Bacteria 6424
60 Ga0097620_100155645 3300006931 Bacteria 2363
61 Ga0079104_1005018 3300006946 Bacteria 5419
62 Ga0105251_10054843 3300009011 Bacteria 1891
63 Ga0105240_10030389 3300009093 Bacteria 7021
64 Ga0105240_10086138 3300009093 Bacteria 3848
65 Ga0105240_10104563 3300009093 Bacteria 3439
66 Ga0105240_10236329 3300009093 Bacteria 2121
67 Ga0105245_10000853 3300009098 Bacteria 27630
68 Ga0105243_10060489 3300009148 Bacteria 3026
69 Ga0105243_10288583 3300009148 Bacteria 1481
70 Ga0105241_10024108 3300009174 Bacteria 4518
71 Ga0105248_10105518 3300009177 Bacteria 3177
72 Ga0105237_10090852 3300009545 Bacteria 3043
73 Ga0105238_10113404 3300009551 Bacteria 2690
74 Ga0105238_10346553 3300009551 Bacteria 1474
75 Ga0105238_10402577 3300009551 Bacteria 1362
76 Ga0105148_100223 3300009978 Bacteria 8086
77 Ga0105239_10086153 3300010375 Bacteria 3462
78 Ga0105239_10378907 3300010375 Bacteria 1599
79 Ga0105239_10492285 3300010375 Bacteria 1393
80 Ga0157373_10071651 3300013100 Bacteria 2447
81 Ga0157371_10009668 3300013102 Bacteria 7578
82 Ga0157371_10018604 3300013102 Bacteria 5132
83 Ga0157371_10024152 3300013102 Bacteria 4441
84 Ga0157371_10071085 3300013102 Bacteria 2463
85 Ga0157371_10155777 3300013102 Bacteria 1630
86 Ga0157370_10037708 3300013104 Bacteria 4682
87 Ga0157370_10197891 3300013104 Bacteria 1865
88 Ga0157369_10001843 3300013105 Bacteria 25619
89 Ga0157369_10004559 3300013105 Bacteria 16291
90 Ga0157369_10068681 3300013105 Bacteria 3807
91 Ga0157369_10108914 3300013105 Bacteria 2946
92 Ga0157374_10010254 3300013296 Bacteria 8058
93 Ga0163162_10068828 3300013306 Bacteria 3592
94 Ga0157372_10042339 3300013307 Bacteria 5036
95 Ga0157372_10087458 3300013307 Bacteria 3536
96 Ga0163163_10113021 3300014325 Bacteria 2745
97 Ga0163161_10083831 3300017792 Bacteria 2350
98 Ga0163161_10097758 3300017792 Bacteria 2181
99 Ga0213875_10000230 3300021388 Bacteria 56647
100 Ga0209437_104090 3300025233 Bacteria 2585
101 Ga0207425_1000049 3300025245 Bacteria 180735
102 Ga0209129_1001567 3300025258 Bacteria 12551
103 Ga0209233_1000084 3300025261 Bacteria 335222
104 Ga0209565_1000170 3300025263 Bacteria 84580
105 Ga0209673_1011318 3300025273 Bacteria 3686
106 Ga0209025_1000068 3300025294 Bacteria 294129
107 Ga0209564_1000335 3300025295 Bacteria 91079
108 Ga0209758_1000019 3300025297 Bacteria 743682
109 Ga0209050_1000001 3300025298 Bacteria 3563507
110 Ga0209050_1000108 3300025298 Bacteria 222534
111 Ga0207426_1014823 3300025302 Bacteria 2847
112 Ga0209051_1000239 3300025303 Bacteria 92575
113 Ga0207647_10009334 3300025904 Bacteria 6974
114 Ga0207647_10016410 3300025904 Bacteria 5055
115 Ga0207647_10039536 3300025904 Bacteria 2975
116 Ga0207705_10000003 3300025909 Bacteria 709270
117 Ga0207705_10000046 3300025909 Bacteria 177574
118 Ga0207705_10000215 3300025909 Bacteria 57467
119 Ga0207705_10000849 3300025909 Bacteria 25053
120 Ga0207705_10003040 3300025909 Bacteria 12799
121 Ga0207705_10039675 3300025909 Bacteria 3375
122 Ga0207705_10087451 3300025909 Bacteria 2279
123 Ga0207654_10008029 3300025911 Bacteria 5320
124 Ga0207695_10003916 3300025913 Bacteria 20603
125 Ga0207695_10040354 3300025913 Bacteria 5007
126 Ga0207671_10013100 3300025914 Bacteria 6625
127 Ga0207671_10364792 3300025914 Bacteria 1147
128 Ga0207657_10001406 3300025919 Bacteria 25663
129 Ga0207657_10008313 3300025919 Bacteria 10560
130 Ga0207657_10008667 3300025919 Bacteria 10298
131 Ga0207657_10009957 3300025919 Bacteria 9515
132 Ga0207649_10053969 3300025920 Bacteria 2500
133 Ga0207652_10111263 3300025921 Bacteria 2429
134 Ga0207694_10351768 3300025924 Bacteria 1220
135 Ga0207659_10005781 3300025926 Bacteria 7537
136 Ga0207690_10012871 3300025932 Bacteria 5013
137 Ga0207690_10038294 3300025932 Bacteria 3119
138 Ga0207690_10096183 3300025932 Bacteria 2105
139 Ga0207706_10013110 3300025933 Bacteria 7540
140 Ga0207709_10073199 3300025935 Bacteria 2182
141 Ga0207704_10242743 3300025938 Bacteria 1347
142 Ga0207711_10055027 3300025941 Bacteria 3416
143 Ga0207661_10407854 3300025944 Bacteria 1233
144 Ga0207679_10235233 3300025945 Bacteria 1549
145 Ga0207679_10284863 3300025945 Bacteria 1418
146 Ga0207667_10011763 3300025949 Bacteria 10146
147 Ga0207651_10018208 3300025960 Bacteria 4173
148 Ga0207668_10010040 3300025972 Bacteria 5701
149 Ga0207668_10394490 3300025972 Bacteria 1168
150 Ga0207640_10006808 3300025981 Bacteria 6286
151 Ga0207640_10072907 3300025981 Bacteria 2318
152 Ga0207640_10416154 3300025981 Bacteria 1099
153 Ga0207639_10013261 3300026041 Bacteria 5763
154 Ga0207639_10091721 3300026041 Bacteria 2433
155 Ga0207678_10000084 3300026067 Bacteria 76874
156 Ga0207678_10014541 3300026067 Bacteria 6923
157 Ga0207702_10003656 3300026078 Bacteria 13929
158 Ga0207702_10011897 3300026078 Bacteria 7243
159 Ga0207702_10069389 3300026078 Bacteria 3030
160 Ga0207702_10122053 3300026078 Bacteria 2333
161 Ga0207674_10016841 3300026116 Bacteria 7988
162 Ga0207674_10233693 3300026116 Bacteria 1786
163 Ga0207675_100006464 3300026118 Bacteria 11097
164 Ga0207698_10001653 3300026142 Bacteria 13007
165 Ga0207698_10008368 3300026142 Bacteria 6539
166 Ga0207698_10025524 3300026142 Bacteria 4165
167 Ga0207698_10034492 3300026142 Bacteria 3689
168 Ga0209281_1005626 3300027111 Bacteria 3436
169 Ga0268266_10021864 3300028379 Bacteria 5450
170 Ga0307405_10066420 3300031731 Bacteria 2299
171 Ga0307405_10069373 3300031731 Bacteria 2259
172 Ga0307410_10002245 3300031852 Bacteria 9229
173 Ga0307410_10038892 3300031852 Bacteria 3119
174 Ga0307407_10044364 3300031903 Bacteria 2505
175 Ga0307412_10046715 3300031911 Bacteria 2839
176 Ga0307412_10278765 3300031911 Bacteria 1311
177 Ga0307409_100077810 3300031995 Bacteria 2666
178 Ga0307416_100008803 3300032002 Bacteria 6546
179 Ga0307416_100110027 3300032002 Bacteria 2425
180 Ga0307414_10051900 3300032004 Bacteria 2850
181 Ga0307414_10123197 3300032004 Bacteria 1997
182 Ga0307411_10010511 3300032005 Bacteria 4938
183 Ga0307411_10306807 3300032005 Bacteria 1275
184 Ga0307415_100131959 3300032126 Bacteria 1893
185 Ga0307415_100296032 3300032126 Bacteria 1338
186 Ga0395899_0000825 3300037312 Bacteria 30147
187 Ga0395899_0012651 3300037312 Bacteria 6468
188 Ga0395900_0000031 3300037418 Bacteria 262393
189 Ga0395900_0049098 3300037418 Bacteria 4347
190 Ga0395900_0055371 3300037418 Bacteria 4084
191 Ga0395900_0195009 3300037418 Bacteria 2052
192 Ga0395900_0232446 3300037418 Bacteria 1853
193 Ga0395900_0268092 3300037418 Bacteria 1703
194 Ga0395900_0333378 3300037418 Bacteria 1494
195 Ga0395900_0342082 3300037418 Bacteria 1471
196 Ga0395900_0484075 3300037418 Bacteria 1189
197 Ga0395898_0004862 3300037466 Bacteria 14588
198 Ga0395898_0022516 3300037466 Bacteria 6381
199 Ga0395898_0038832 3300037466 Bacteria 4715
200 Ga0395898_0120076 3300037466 Bacteria 2518
201 Ga0395898_0228050 3300037466 Bacteria 1776
202 Ga0395898_0467473 3300037466 Bacteria 1200
203 Ga0395905_0047664 3300037471 Bacteria 4015
204 Ga0395905_0108076 3300037471 Bacteria 2611
205 Ga0395905_0220075 3300037471 Bacteria 1777
206 Ga0436364_1120654 3300037853 Bacteria 86811
207 Ga0395901_0000260 3300038443 Bacteria 66084
208 Ga0395901_0046372 3300038443 Bacteria 4514
209 Ga0395901_0062897 3300038443 Bacteria 3862
210 Ga0395901_0105084 3300038443 Bacteria 2964
211 Ga0439461_0000634 3300041410 Bacteria 5067
212 Ga0439461_0000778 3300041410 Bacteria 4674
213 Ga0439465_0000274 3300041413 Bacteria 14388
214 Ga0439431_0000103 3300041997 Bacteria 14374
215 Ga0439442_003667 3300042002 Bacteria 3042
216 Ga0439445_0000055 3300042004 Bacteria 16763
217 Ga0439432_000219 3300042006 Bacteria 20597
218 Ga0439432_016344 3300042006 Bacteria 2499
219 Ga0439457_003225 3300042014 Bacteria 4482
220 Ga0439462_0002177 3300042015 Bacteria 4517
221 Ga0439462_0003426 3300042015 Bacteria 3807
222 Ga0439434_0008358 3300042435 Bacteria 3034
223 Ga0466969_0013373 3300044656 Bacteria 4321
224 Ga0466972_0017055 3300044658 Bacteria 3633
225 Ga0466966_0000010 3300044684 Bacteria 150868
226 Ga0466966_0011880 3300044684 Bacteria 5768
227 Ga0466966_0065786 3300044684 Bacteria 2279
228 Ga0466961_0013583 3300044693 Bacteria 5214
229 Ga0466961_0015301 3300044693 Bacteria 4927
230 Ga0466963_0005683 3300044694 Bacteria 7326
231 Ga0466971_0001547 3300044719 Bacteria 9696
232 Ga0466971_0117367 3300044719 Bacteria 1230
233 Ga0466968_0028188 3300044735 Bacteria 2315
234 Ga0466957_0005415 3300044842 Bacteria 7165
235 Ga0466959_0003693 3300045049 Bacteria 10097
236 Ga0466959_0017441 3300045049 Bacteria 5263
237 Ga0466958_0006384 3300045836 Bacteria 6412
238 Ga0466958_0029737 3300045836 Bacteria 3242
239 Ga0466967_0039447 3300045976 Bacteria 4060
240 Ga0466967_0594529 3300045976 Bacteria 1092
241 Ga0495638_0003984 3300046460 Bacteria 11359
242 Ga0495625_0001071 3300046660 Bacteria 35534
243 Ga0495670_0000028 3300046691 Bacteria 90085
244 Ga0495686_0014672 3300047472 Bacteria 5387
245 Ga0495615_0000230 3300048090 Bacteria 11820
246 Ga0496102_0447401 3300048905 Bacteria 1212
247 Ga0496104_0503705 3300048907 Bacteria 1122
248 Ga0496108_0040070 3300048911 Bacteria 3904
249 Ga0496108_0221914 3300048911 Bacteria 1642
250 Ga0496111_0302230 3300048914 Bacteria 1186
251 Ga0496121_0002011 3300048924 Bacteria 32308
252 Ga0496121_0003564 3300048924 Bacteria 22015
253 Ga0496122_0021820 3300048925 Bacteria 5715
254 Ga0496122_0028808 3300048925 Bacteria 4700
255 Ga0496122_0051412 3300048925 Bacteria 3131
256 Ga0496123_0031243 3300048926 Bacteria 3878
257 Ga0496123_0039052 3300048926 Bacteria 3325
258 Ga0496123_0053700 3300048926 Bacteria 2660
259 Ga0496123_0061356 3300048926 Bacteria 2416
260 Ga0496124_0035559 3300048927 Bacteria 4356
261 Ga0496124_0080806 3300048927 Bacteria 2674
262 Ga0496124_0254756 3300048927 Bacteria 1295
263 Ga0496124_0311248 3300048927 Bacteria 1132
264 Ga0496125_0031167 3300048928 Bacteria 4756
265 Ga0501069_0012332 3300049585 Bacteria 4541
266 Ga0501223_000015 3300049663 Bacteria 68826
267 Ga0501225_0000832 3300049705 Bacteria 9604
268 Ga0501225_0003443 3300049705 Bacteria 4794
269 Ga0500635_0000192 3300053080 Bacteria 31343
270 Ga0500566_0057276 3300053094 Bacteria 2213
271 Ga0500562_001810 3300053108 Bacteria 5357
272 Ga0500618_000214 3300053125 Bacteria 45376
273 Ga0500658_0006179 3300053134 Bacteria 4454
274 Ga0500658_0016069 3300053134 Bacteria 2786
275 Ga0500658_0020457 3300053134 Bacteria 2499
276 Ga0500645_001144 3300053730 Bacteria 14373
277 Ga0466962_0000549 3300061719 Bacteria 16555
278 Ga0466962_0011648 3300061719 Bacteria 4235

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2967762386 2967768863 289
2 3300009098 Ga0105245_10000853 Ga0105245_1000085331 291
3 3300005577 Ga0068857_100057636 Ga0068857_1000576363 298
4 3300005578 Ga0068854_100066261 Ga0068854_1000662614 298
5 3300025981 Ga0207640_10072907 Ga0207640_100729072 298
6 3300026116 Ga0207674_10233693 Ga0207674_102336932 298
7 3300048925 Ga0496122_0051412 Ga0496122_0051412_1451_2461 298
8 3300048926 Ga0496123_0053700 Ga0496123_0053700_1613_2623 298
9 3300048927 Ga0496124_0035559 Ga0496124_0035559_3309_4319 298
10 3300048927 Ga0496124_0311248 Ga0496124_0311248_39_1049 300
11 3300005327 Ga0070658_10019618 Ga0070658_100196183 303
12 3300005339 Ga0070660_100017115 Ga0070660_1000171153 303
13 3300025909 Ga0207705_10000215 Ga0207705_1000021551 303
14 3300025919 Ga0207657_10009957 Ga0207657_1000995710 303
15 3300005329 Ga0070683_100450155 Ga0070683_1004501551 305
16 3300005563 Ga0068855_100116519 Ga0068855_1001165193 305
17 3300005614 Ga0068856_100169423 Ga0068856_1001694233 305
18 3300009551 Ga0105238_10346553 Ga0105238_103465532 305
19 3300010375 Ga0105239_10378907 Ga0105239_103789072 305
20 3300013105 Ga0157369_10108914 Ga0157369_101089142 305
21 3300013307 Ga0157372_10042339 Ga0157372_100423393 305
22 3300025944 Ga0207661_10407854 Ga0207661_104078542 305
23 3300026078 Ga0207702_10069389 Ga0207702_100693892 305
24 3300005616 Ga0068852_100001847 Ga0068852_10000184711 307
25 3300026078 Ga0207702_10122053 Ga0207702_101220533 307
26 3300026142 Ga0207698_10001653 Ga0207698_100016533 307
27 3300053080 Ga0500635_0000192 Ga0500635_0000192_6671_7651 313
28 iso_pu_bacteria 2964678106 2964678400 314
29 3300005366 Ga0070659_100020518 Ga0070659_1000205183 315
30 3300025932 Ga0207690_10012871 Ga0207690_100128713 315
31 3300026118 Ga0207675_100006464 Ga0207675_1000064644 315
32 3300044658 Ga0466972_0017055 Ga0466972_0017055_1110_2105 319
33 3300044735 Ga0466968_0028188 Ga0466968_0028188_902_1897 319
34 iso_pu_bacteria 2551306090 2551721468 320
35 3300041410 Ga0439461_0000778 Ga0439461_0000778_2061_3059 321
36 3300041413 Ga0439465_0000274 Ga0439465_0000274_7211_8209 321
37 3300041997 Ga0439431_0000103 Ga0439431_0000103_10884_11882 321
38 3300042002 Ga0439442_003667 Ga0439442_003667_1830_2828 321
39 3300042004 Ga0439445_0000055 Ga0439445_0000055_13701_14699 321
40 3300042006 Ga0439432_000219 Ga0439432_000219_17712_18710 321
41 3300042015 Ga0439462_0003426 Ga0439462_0003426_1308_2306 321
42 3300048911 Ga0496108_0040070 Ga0496108_0040070_977_2080 321
43 3300048924 Ga0496121_0003564 Ga0496121_0003564_17503_18606 321
44 3300005347 Ga0070668_100039885 Ga0070668_1000398852 322
45 iso_pu_bacteria 2551306087 2551700814 322
46 3300005354 Ga0070675_100023581 Ga0070675_1000235813 323
47 3300005456 Ga0070678_100016484 Ga0070678_1000164844 323
48 3300014325 Ga0163163_10113021 Ga0163163_101130216 323
49 3300031995 Ga0307409_100077810 Ga0307409_1000778103 323
50 3300053134 Ga0500658_0020457 Ga0500658_0020457_463_1461 323
51 3300005339 Ga0070660_100001066 Ga0070660_1000010667 324
52 3300005344 Ga0070661_100138020 Ga0070661_1001380202 324
53 3300005354 Ga0070675_100038793 Ga0070675_1000387934 324
54 3300005364 Ga0070673_100017391 Ga0070673_1000173911 324
55 3300005366 Ga0070659_100266432 Ga0070659_1002664321 324
56 3300005548 Ga0070665_100006682 Ga0070665_1000066823 324
57 3300005563 Ga0068855_100001731 Ga0068855_10000173128 324
58 3300005564 Ga0070664_100072362 Ga0070664_1000723624 324
59 3300005578 Ga0068854_100001958 Ga0068854_1000019585 324
60 3300005616 Ga0068852_100007109 Ga0068852_1000071098 324
61 3300005616 Ga0068852_100156132 Ga0068852_1001561322 324
62 3300005617 Ga0068859_100021809 Ga0068859_1000218093 324
63 3300005719 Ga0068861_100000349 Ga0068861_10000034923 324
64 3300005843 Ga0068860_100080306 Ga0068860_1000803065 324
65 3300006931 Ga0097620_100021809 Ga0097620_1000218093 324
66 3300009093 Ga0105240_10030389 Ga0105240_100303895 324
67 3300009093 Ga0105240_10104563 Ga0105240_101045633 324
68 3300009148 Ga0105243_10288583 Ga0105243_102885831 324
69 3300009177 Ga0105248_10105518 Ga0105248_101055183 324
70 3300009551 Ga0105238_10113404 Ga0105238_101134042 324
71 3300010375 Ga0105239_10492285 Ga0105239_104922851 324
72 3300013102 Ga0157371_10009668 Ga0157371_100096683 324
73 3300013104 Ga0157370_10037708 Ga0157370_100377083 324
74 3300013105 Ga0157369_10001843 Ga0157369_1000184312 324
75 3300013105 Ga0157369_10004559 Ga0157369_100045598 324
76 3300013105 Ga0157369_10068681 Ga0157369_100686814 324
77 3300013306 Ga0163162_10068828 Ga0163162_100688283 324
78 3300017792 Ga0163161_10083831 Ga0163161_100838313 324
79 3300025904 Ga0207647_10009334 Ga0207647_100093342 324
80 3300025909 Ga0207705_10000849 Ga0207705_100008498 324
81 3300025913 Ga0207695_10003916 Ga0207695_100039165 324
82 3300025919 Ga0207657_10008313 Ga0207657_1000831313 324
83 3300025920 Ga0207649_10053969 Ga0207649_100539692 324
84 3300025921 Ga0207652_10111263 Ga0207652_101112632 324
85 3300025932 Ga0207690_10096183 Ga0207690_100961831 324
86 3300025935 Ga0207709_10073199 Ga0207709_100731993 324
87 3300025938 Ga0207704_10242743 Ga0207704_102427432 324
88 3300025941 Ga0207711_10055027 Ga0207711_100550273 324
89 3300025945 Ga0207679_10235233 Ga0207679_102352332 324
90 3300025949 Ga0207667_10011763 Ga0207667_100117637 324
91 3300025960 Ga0207651_10018208 Ga0207651_100182085 324
92 3300025981 Ga0207640_10006808 Ga0207640_100068084 324
93 3300025981 Ga0207640_10416154 Ga0207640_104161541 324
94 3300026041 Ga0207639_10091721 Ga0207639_100917213 324
95 3300026142 Ga0207698_10008368 Ga0207698_100083687 324
96 3300026142 Ga0207698_10034492 Ga0207698_100344925 324
97 3300028379 Ga0268266_10021864 Ga0268266_100218642 324
98 3300031852 Ga0307410_10002245 Ga0307410_1000224510 324
99 3300031852 Ga0307410_10038892 Ga0307410_100388923 324
100 3300031903 Ga0307407_10044364 Ga0307407_100443643 324
101 3300031911 Ga0307412_10046715 Ga0307412_100467152 324
102 3300032002 Ga0307416_100110027 Ga0307416_1001100271 324
103 3300032004 Ga0307414_10051900 Ga0307414_100519003 324
104 3300032005 Ga0307411_10010511 Ga0307411_100105113 324
105 3300032005 Ga0307411_10306807 Ga0307411_103068071 324
106 3300032126 Ga0307415_100131959 Ga0307415_1001319593 324
107 3300032126 Ga0307415_100296032 Ga0307415_1002960322 324
108 3300037312 Ga0395899_0012651 Ga0395899_0012651_579_1556 324
109 3300037418 Ga0395900_0055371 Ga0395900_0055371_1565_2542 324
110 3300037418 Ga0395900_0268092 Ga0395900_0268092_167_1144 324
111 3300037418 Ga0395900_0333378 Ga0395900_0333378_493_1473 324
112 3300037418 Ga0395900_0342082 Ga0395900_0342082_370_1347 324
113 3300037418 Ga0395900_0484075 Ga0395900_0484075_87_1064 324
114 3300037466 Ga0395898_0038832 Ga0395898_0038832_61_1038 324
115 3300037466 Ga0395898_0120076 Ga0395898_0120076_850_1830 324
116 3300037466 Ga0395898_0228050 Ga0395898_0228050_93_1070 324
117 3300037466 Ga0395898_0467473 Ga0395898_0467473_131_1108 324
118 3300037471 Ga0395905_0047664 Ga0395905_0047664_2314_3294 324
119 3300037471 Ga0395905_0108076 Ga0395905_0108076_950_1930 324
120 3300037471 Ga0395905_0220075 Ga0395905_0220075_520_1497 324
121 3300038443 Ga0395901_0046372 Ga0395901_0046372_3494_4471 324
122 3300038443 Ga0395901_0062897 Ga0395901_0062897_462_1442 324
123 3300038443 Ga0395901_0105084 Ga0395901_0105084_76_1056 324
124 3300044684 Ga0466966_0000010 Ga0466966_0000010_129755_130732 324
125 3300044684 Ga0466966_0065786 Ga0466966_0065786_1263_2240 324
126 3300044693 Ga0466961_0015301 Ga0466961_0015301_3006_3983 324
127 3300044719 Ga0466971_0117367 Ga0466971_0117367_154_1131 324
128 3300045049 Ga0466959_0017441 Ga0466959_0017441_1838_2815 324
129 3300045836 Ga0466958_0029737 Ga0466958_0029737_2138_3115 324
130 3300045976 Ga0466967_0039447 Ga0466967_0039447_885_1865 324
131 3300045976 Ga0466967_0594529 Ga0466967_0594529_16_996 324
132 3300048090 Ga0495615_0000230 Ga0495615_0000230_7846_8823 324
133 3300048911 Ga0496108_0221914 Ga0496108_0221914_568_1548 324
134 3300048925 Ga0496122_0028808 Ga0496122_0028808_801_1778 324
135 3300048926 Ga0496123_0039052 Ga0496123_0039052_1091_2068 324
136 3300048927 Ga0496124_0080806 Ga0496124_0080806_1266_2243 324
137 3300049585 Ga0501069_0012332 Ga0501069_0012332_2185_3162 324
138 3300053094 Ga0500566_0057276 Ga0500566_0057276_247_1227 324
139 3300061719 Ga0466962_0011648 Ga0466962_0011648_2801_3778 324
140 iso_pu_bacteria 2510065057 2510307569 324
141 iso_pu_bacteria 2511231052 2511499510 324
142 iso_pu_bacteria 2513237086 2513586214 324
143 iso_pu_bacteria 2513237091 2513619901 324
144 iso_pu_bacteria 2516653046 2516897777 324
145 iso_pu_bacteria 2551306084 2551676095 324
146 iso_pu_bacteria 2551306085 2551683904 324
147 iso_pu_bacteria 2551306086 2551693279 324
148 iso_pu_bacteria 2551306093 2551739659 324
149 iso_pu_bacteria 2855825444 2855830301 324
150 iso_pu_bacteria 2855839649 2855845918 324
151 iso_pu_bacteria 2858800743 2858805291 324
152 iso_pu_bacteria 2915986958 2915988732 324
153 iso_pu_bacteria 2915993759 2915995882 324
154 iso_pu_bacteria 2916007675 2916012845 324
155 iso_pu_bacteria 2916014648 2916017668 324
156 iso_pu_bacteria 2916021584 2916027124 324
157 iso_pu_bacteria 2916028427 2916028653 324
158 iso_pu_bacteria 2916035215 2916038746 324
159 iso_pu_bacteria 2916041962 2916048305 324
160 iso_pu_bacteria 2916048683 2916052774 324
161 iso_pu_bacteria 2916055098 2916056043 324
162 iso_pu_bacteria 2916068649 2916070199 324
163 iso_pu_bacteria 2916076590 2916080970 324
164 iso_pu_bacteria 2921201388 2921206810 324
165 iso_pu_bacteria 2921208531 2921214697 324
166 iso_pu_bacteria 2921237296 2921243320 324
167 iso_pu_bacteria 2921263974 2921264277 324
168 iso_pu_bacteria 2921289301 2921293889 324
169 iso_pu_bacteria 2921296804 2921302334 324
170 iso_pu_bacteria 2924150972 2924155623 324
171 iso_pu_bacteria 2924158325 2924162915 324
172 iso_pu_bacteria 2924165586 2924169629 324
173 iso_pu_bacteria 2924172951 2924179482 324
174 iso_pu_bacteria 2924186466 2924190070 324
175 iso_pu_bacteria 2924207177 2924213248 324
176 iso_pu_bacteria 2924214083 2924220370 324
177 iso_pu_bacteria 2924221636 2924224579 324
178 iso_pu_bacteria 2924228884 2924233325 324
179 iso_pu_bacteria 2937002841 2937006572 324
180 iso_pu_bacteria 2937009748 2937013186 324
181 iso_pu_bacteria 2937042894 2937047639 324
182 iso_pu_bacteria 2937049772 2937055841 324
183 iso_pu_bacteria 2937056579 2937061231 324
184 iso_pu_bacteria 2937071275 2937075844 324
185 iso_pu_bacteria 2937091812 2937096273 324
186 iso_pu_bacteria 2937098957 2937103891 324
187 iso_pu_bacteria 2937106411 2937110438 324
188 iso_pu_bacteria 2937119839 2937122280 324
189 iso_pu_bacteria 2937126314 2937126593 324
190 iso_pu_bacteria 2957382221 2957385420 324
191 iso_pu_bacteria 2957388812 2957391231 324
192 iso_pu_bacteria 2957402308 2957406012 324
193 iso_pu_bacteria 2957422303 2957428772 324
194 iso_pu_bacteria 2957430029 2957436664 324
195 iso_pu_bacteria 2957450854 2957453657 324
196 iso_pu_bacteria 2957457609 2957458277 324
197 iso_pu_bacteria 2957471148 2957474991 324
198 iso_pu_bacteria 2957478035 2957478268 324
199 iso_pu_bacteria 2957484790 2957485363 324
200 iso_pu_bacteria 2957498199 2957503172 324
201 iso_pu_bacteria 2957505466 2957509549 324
202 iso_pu_bacteria 2960603979 2960608219 324
203 iso_pu_bacteria 2960610863 2960616051 324
204 iso_pu_bacteria 2960624210 2960630743 324
205 iso_pu_bacteria 2960645483 2960649304 324
206 iso_pu_bacteria 2960652885 2960655792 324
207 iso_pu_bacteria 2960687367 2960691338 324
208 iso_pu_bacteria 2964607997 2964612628 324
209 iso_pu_bacteria 2964628898 2964633463 324
210 iso_pu_bacteria 2964636051 2964640563 324
211 iso_pu_bacteria 2964643177 2964644933 324
212 iso_pu_bacteria 2964649959 2964654206 324
213 iso_pu_bacteria 2964656573 2964661340 324
214 iso_pu_bacteria 2964663802 2964670070 324
215 iso_pu_bacteria 2964698721 2964701257 324
216 iso_pu_bacteria 2964712639 2964714585 324
217 iso_pu_bacteria 2967664464 2967670888 324
218 iso_pu_bacteria 2967678726 2967683596 324
219 iso_pu_bacteria 2967693043 2967695870 324
220 iso_pu_bacteria 2967706974 2967713620 324
221 iso_pu_bacteria 2967714385 2967719156 324
222 iso_pu_bacteria 2967721400 2967725634 324
223 iso_pu_bacteria 2967735183 2967739111 324
224 iso_pu_bacteria 2967775926 2967780348 324
225 iso_pu_bacteria 2970040964 2970043119 324
226 iso_pu_bacteria 2970047711 2970047735 324
227 iso_pu_bacteria 2970054988 2970058108 324
228 iso_pu_bacteria 2970061556 2970066076 324
229 iso_pu_bacteria 2970076120 2970077663 324
230 iso_pu_bacteria 2970088815 2970092984 324
231 iso_pu_bacteria 2970109326 2970114846 324
232 iso_pu_bacteria 2970116247 2970117503 324
233 iso_pu_bacteria 2970129317 2970132364 324
234 iso_pu_bacteria 2970136068 2970139491 324
235 iso_pu_bacteria 2970149975 2970150956 324
236 iso_pu_bacteria 2970164137 2970168014 324
237 iso_pu_bacteria 2970170962 2970176682 324
238 iso_pu_bacteria 2970184632 2970189084 324
239 iso_pu_bacteria 2970191845 2970195525 324
240 iso_pu_bacteria 2977523885 2977528250 324
241 iso_pu_bacteria 2977537788 2977542144 324
242 iso_pu_bacteria 2977551784 2977556588 324
243 iso_pu_bacteria 2977565890 2977571416 324
244 iso_pu_bacteria 2977572785 2977575815 324
245 iso_pu_bacteria 2977579622 2977581928 324
246 iso_pu_bacteria 8003992118 8003997614 324
247 3300013102 Ga0157371_10024152 Ga0157371_100241524 325
248 3300025909 Ga0207705_10000046 Ga0207705_10000046120 325
249 3300037312 Ga0395899_0000825 Ga0395899_0000825_16380_17363 325
250 3300037418 Ga0395900_0000031 Ga0395900_0000031_22306_23289 325
251 3300037466 Ga0395898_0004862 Ga0395898_0004862_10592_11575 325
252 3300038443 Ga0395901_0000260 Ga0395901_0000260_46777_47760 325
253 3300047472 Ga0495686_0014672 Ga0495686_0014672_1875_2876 325
254 3300048924 Ga0496121_0002011 Ga0496121_0002011_1369_2376 326
255 iso_pu_bacteria 2599185359 2600228184 326
256 iso_pu_bacteria 2818991466 2819716229 326
257 iso_pu_bacteria 2879163058 2879163807 326
258 iso_pu_bacteria 2928526807 2928528969 326
259 iso_pu_bacteria 2928968154 2928971203 326
260 3300009011 Ga0105251_10054843 Ga0105251_100548432 327
261 3300017792 Ga0163161_10097758 Ga0163161_100977583 327
262 3300048907 Ga0496104_0503705 Ga0496104_0503705_73_1089 327
263 3300048925 Ga0496122_0021820 Ga0496122_0021820_3090_4205 327
264 3300048926 Ga0496123_0031243 Ga0496123_0031243_1860_2975 327
265 3300048928 Ga0496125_0031167 Ga0496125_0031167_1500_2615 327
266 iso_pu_bacteria 8057101203 8057101639 327
267 3300005539 Ga0068853_100174762 Ga0068853_1001747622 328
268 3300006946 Ga0079104_1005018 Ga0079104_10050183 328
269 3300027111 Ga0209281_1005626 Ga0209281_10056262 328
270 3300042435 Ga0439434_0008358 Ga0439434_0008358_1395_2387 328
271 3300053125 Ga0500618_000214 Ga0500618_000214_29236_30237 328
272 3300048914 Ga0496111_0302230 Ga0496111_0302230_175_1164 329
273 iso_pu_bacteria 2599185354 2600202810 329
274 3300002067 JGI24735J21928_10000683 JGI24735J21928_100006833 330
275 3300003316 rootH1_10006736 rootH1_100067361 330
276 3300005262 Ga0065165_1003640 Ga0065165_10036408 330
277 3300005366 Ga0070659_100132963 Ga0070659_1001329633 330
278 3300005543 Ga0070672_100070368 Ga0070672_1000703682 330
279 3300006931 Ga0097620_100155645 Ga0097620_1001556453 330
280 3300009093 Ga0105240_10236329 Ga0105240_102363292 330
281 3300013296 Ga0157374_10010254 Ga0157374_100102549 330
282 3300025914 Ga0207671_10013100 Ga0207671_100131003 330
283 3300025926 Ga0207659_10005781 Ga0207659_100057814 330
284 3300025945 Ga0207679_10284863 Ga0207679_102848632 330
285 3300041410 Ga0439461_0000634 Ga0439461_0000634_2814_3812 330
286 3300042006 Ga0439432_016344 Ga0439432_016344_1268_2266 330
287 3300042014 Ga0439457_003225 Ga0439457_003225_1648_2646 330
288 3300042015 Ga0439462_0002177 Ga0439462_0002177_535_1533 330
289 3300046691 Ga0495670_0000028 Ga0495670_0000028_51319_52329 330
290 3300048926 Ga0496123_0061356 Ga0496123_0061356_940_1950 330
291 3300048927 Ga0496124_0254756 Ga0496124_0254756_38_1048 330
292 3300053134 Ga0500658_0006179 Ga0500658_0006179_1616_2614 330
293 3300053730 Ga0500645_001144 Ga0500645_001144_12034_13032 330
294 3300003214 JGI25165J46597_1000024 JGI25165J46597_100002422 331
295 3300005347 Ga0070668_100017467 Ga0070668_1000174675 331
296 3300009148 Ga0105243_10060489 Ga0105243_100604894 331
297 3300021388 Ga0213875_10000230 Ga0213875_1000023039 331
298 3300025233 Ga0209437_104090 Ga0209437_1040903 331
299 3300025261 Ga0209233_1000084 Ga0209233_1000084287 331
300 3300025972 Ga0207668_10010040 Ga0207668_100100403 331
301 3300037853 Ga0436364_1120654 Ga0436364_1120654_14389_15396 331
302 3300046460 Ga0495638_0003984 Ga0495638_0003984_1356_2435 331
303 3300046660 Ga0495625_0001071 Ga0495625_0001071_33281_34282 331
304 3300053134 Ga0500658_0016069 Ga0500658_0016069_1335_2336 331
305 3300002774 JGI25150J39212_1000886 JGI25150J39212_10008869 332
306 3300003187 JGI25151J46595_10026616 JGI25151J46595_100266163 332
307 3300003215 JGI25153J46596_10000091 JGI25153J46596_100000912 332
308 3300003215 JGI25153J46596_10000186 JGI25153J46596_1000018616 332
309 3300003771 Ga0055526_1009414 Ga0055526_10094142 332
310 3300003773 Ga0055537_1001804 Ga0055537_10018048 332
311 3300025245 Ga0207425_1000049 Ga0207425_100004973 332
312 3300025258 Ga0209129_1001567 Ga0209129_10015679 332
313 3300025263 Ga0209565_1000170 Ga0209565_100017061 332
314 3300025273 Ga0209673_1011318 Ga0209673_10113183 332
315 3300025294 Ga0209025_1000068 Ga0209025_100006845 332
316 3300025295 Ga0209564_1000335 Ga0209564_10003352 332
317 3300025297 Ga0209758_1000019 Ga0209758_1000019659 332
318 3300025298 Ga0209050_1000001 Ga0209050_10000011873 332
319 3300025298 Ga0209050_1000108 Ga0209050_1000108161 332
320 3300025302 Ga0207426_1014823 Ga0207426_10148233 332
321 3300025303 Ga0209051_1000239 Ga0209051_100023949 332
322 3300048905 Ga0496102_0447401 Ga0496102_0447401_61_1065 332
323 3300053108 Ga0500562_001810 Ga0500562_001810_2669_3667 332
324 3300005365 Ga0070688_100014671 Ga0070688_1000146712 333
325 3300005577 Ga0068857_100093600 Ga0068857_1000936003 333
326 3300026116 Ga0207674_10016841 Ga0207674_100168417 333
327 iso_pu_bacteria 2946787523 2946787635 333
328 3300005289 Ga0065704_10001898 Ga0065704_100018984 334
329 3300009978 Ga0105148_100223 Ga0105148_1002235 334
330 3300025972 Ga0207668_10394490 Ga0207668_103944901 334
331 3300049663 Ga0501223_000015 Ga0501223_000015_6254_7258 334
332 3300049705 Ga0501225_0000832 Ga0501225_0000832_6259_7263 334
333 3300049705 Ga0501225_0003443 Ga0501225_0003443_1546_2550 334
334 iso_pu_bacteria 2775507255 2778123601 334
335 3300001904 JGI24736J21556_1000519 JGI24736J21556_10005196 338
336 3300001904 JGI24736J21556_1002154 JGI24736J21556_10021542 338
337 3300001915 JGI24741J21665_1000583 JGI24741J21665_10005834 338
338 3300001979 JGI24740J21852_10005710 JGI24740J21852_100057104 338
339 3300001989 JGI24739J22299_10003840 JGI24739J22299_100038403 338
340 3300005327 Ga0070658_10007316 Ga0070658_100073166 338
341 3300005339 Ga0070660_100073630 Ga0070660_1000736302 338
342 3300005345 Ga0070692_10034107 Ga0070692_100341072 338
343 3300005366 Ga0070659_100011540 Ga0070659_1000115408 338
344 3300005366 Ga0070659_100017777 Ga0070659_1000177774 338
345 3300005455 Ga0070663_100012087 Ga0070663_1000120875 338
346 3300005535 Ga0070684_100105217 Ga0070684_1001052174 338
347 3300005539 Ga0068853_100119786 Ga0068853_1001197863 338
348 3300005564 Ga0070664_100042633 Ga0070664_1000426332 338
349 3300005614 Ga0068856_100008682 Ga0068856_1000086828 338
350 3300009093 Ga0105240_10086138 Ga0105240_100861381 338
351 3300009174 Ga0105241_10024108 Ga0105241_100241083 338
352 3300009545 Ga0105237_10090852 Ga0105237_100908523 338
353 3300009551 Ga0105238_10402577 Ga0105238_104025772 338
354 3300010375 Ga0105239_10086153 Ga0105239_100861533 338
355 3300013100 Ga0157373_10071651 Ga0157373_100716513 338
356 3300013102 Ga0157371_10018604 Ga0157371_100186043 338
357 3300013102 Ga0157371_10071085 Ga0157371_100710851 338
358 3300013102 Ga0157371_10155777 Ga0157371_101557772 338
359 3300013104 Ga0157370_10197891 Ga0157370_101978913 338
360 3300013307 Ga0157372_10087458 Ga0157372_100874582 338
361 3300025904 Ga0207647_10016410 Ga0207647_100164106 338
362 3300025904 Ga0207647_10039536 Ga0207647_100395361 338
363 3300025909 Ga0207705_10000003 Ga0207705_10000003398 338
364 3300025909 Ga0207705_10003040 Ga0207705_1000304010 338
365 3300025909 Ga0207705_10039675 Ga0207705_100396753 338
366 3300025909 Ga0207705_10087451 Ga0207705_100874512 338
367 3300025911 Ga0207654_10008029 Ga0207654_100080292 338
368 3300025913 Ga0207695_10040354 Ga0207695_100403547 338
369 3300025914 Ga0207671_10364792 Ga0207671_103647921 338
370 3300025919 Ga0207657_10001406 Ga0207657_1000140619 338
371 3300025919 Ga0207657_10008667 Ga0207657_100086676 338
372 3300025924 Ga0207694_10351768 Ga0207694_103517681 338
373 3300025932 Ga0207690_10038294 Ga0207690_100382943 338
374 3300025933 Ga0207706_10013110 Ga0207706_100131105 338
375 3300026041 Ga0207639_10013261 Ga0207639_100132614 338
376 3300026067 Ga0207678_10000084 Ga0207678_1000008430 338
377 3300026067 Ga0207678_10014541 Ga0207678_100145416 338
378 3300026078 Ga0207702_10003656 Ga0207702_100036569 338
379 3300026078 Ga0207702_10011897 Ga0207702_100118979 338
380 3300026142 Ga0207698_10025524 Ga0207698_100255241 338
381 3300031731 Ga0307405_10066420 Ga0307405_100664203 338
382 3300031731 Ga0307405_10069373 Ga0307405_100693733 338
383 3300031911 Ga0307412_10278765 Ga0307412_102787651 338
384 3300032002 Ga0307416_100008803 Ga0307416_1000088034 338
385 3300032004 Ga0307414_10123197 Ga0307414_101231972 338
386 3300037418 Ga0395900_0049098 Ga0395900_0049098_348_1376 338
387 3300037418 Ga0395900_0195009 Ga0395900_0195009_606_1634 338
388 3300037418 Ga0395900_0232446 Ga0395900_0232446_621_1649 338
389 3300037466 Ga0395898_0022516 Ga0395898_0022516_2908_3936 338
390 3300044656 Ga0466969_0013373 Ga0466969_0013373_73_1101 338
391 3300044684 Ga0466966_0011880 Ga0466966_0011880_3163_4191 338
392 3300044693 Ga0466961_0013583 Ga0466961_0013583_3151_4179 338
393 3300044694 Ga0466963_0005683 Ga0466963_0005683_1909_2937 338
394 3300044719 Ga0466971_0001547 Ga0466971_0001547_2451_3479 338
395 3300044842 Ga0466957_0005415 Ga0466957_0005415_5353_6381 338
396 3300045049 Ga0466959_0003693 Ga0466959_0003693_8096_9124 338
397 3300045836 Ga0466958_0006384 Ga0466958_0006384_3061_4089 338
398 3300061719 Ga0466962_0000549 Ga0466962_0000549_7784_8812 338

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

172

302

0.92

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

204

344

0.9

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

47

131

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2j8z-assembly1.cif.gz_A-2 crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) 0.9756 14 335
2oby-assembly2.cif.gz_C crystal structure of human p53 inducible oxidoreductase (tp53i3,pig3) 0.9656 14 335
4dup-assembly1.cif.gz_A crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.9649 11 336
4dup-assembly1.cif.gz_B crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.9571 11 336
4dup-assembly1.cif.gz_B crystal structure of a quinone oxidoreductase from rhizobium etli cfn 42 0.9541 11 336
ID Description Score Start End Superfamily
af_O65423_126_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9848 138 273 3.40.50.720
af_A0A1D6HNQ2_126_296_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9807 134 291 3.40.50.720
af_Q75JT6_1_334_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9768 14 335 3.90.180.10
af_O65423_126_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9707 138 273 3.40.50.720
af_A0A286Y901_130_273_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9702 131 273 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2E6BLH0-F1-model_v4 NAD(P)H-quinone oxidoreductase 0.9811 11 335 GO:0016651
GO:0070402
AF-B9JTA9-F1-model_v4 Quinone oxidoreductase 0.9791 7 336 GO:0016651
GO:0070402
AF-A0A251X6J7-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9777 14 335 GO:0016651
GO:0070402
AF-A0A7Y5K1F7-F1-model_v4 NAD(P)H-quinone oxidoreductase 0.9763 14 335 GO:0016020
GO:0016651
GO:0070402
AF-S9V5M4-F1-model_v4 NADPH2:quinone reductase 0.9763 167 336 GO:0016651
GO:0070402

Feature Viewer

pLDDT pTM Quality
94.56 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map