F433896

General Info

Members Datasets Scaffolds Average Seq Length
397 225 794 129

Family's Representative Sequence

Representative Sequence 3300053085|Ga0495619_0619062|Ga0495619_0619062_224_652
Length 142
Sequence LFSVTVRDSMMIAHSFSGAVFGPAQRLHGATFVVDATFRSEKLDSDNIVVDIGKAAEQLHSVVGELSYRNLDDEPAFTGMNTTTEALAKVIADRLADRVLAGGMGDAGRRLAGIAVTLHESHVAWASFERALQNSGIADPQA

Samples

Sample ID Description Type Environment
1 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
120 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
121 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
131 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
132 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
139 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
140 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
141 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
142 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
143 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
144 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
168 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
182 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
221 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
223 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
224 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
225 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 0.76
Isolates 0.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 14.86
Rhizosphere 81.36
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495619_0619062 3300053085 Bacteria 740
2 rootL2_10014765 3300003322 Bacteria 2358
3 Ga0070658_10582783 3300005327 Bacteria 969
4 Ga0070658_10878937 3300005327 Bacteria 779
5 Ga0070683_100016184 3300005329 Bacteria 6569
6 Ga0070683_100061690 3300005329 Bacteria 3486
7 Ga0070690_100146445 3300005330 Bacteria 1607
8 Ga0068869_100200799 3300005334 Bacteria 1572
9 Ga0070680_100003669 3300005336 Bacteria 11465
10 Ga0070680_100311485 3300005336 Bacteria 1336
11 Ga0070680_100508852 3300005336 Bacteria 1031
12 Ga0070682_100316665 3300005337 Bacteria 1151
13 Ga0068868_101084665 3300005338 Bacteria 736
14 Ga0068868_101134138 3300005338 Bacteria 721
15 Ga0070660_100005389 3300005339 Bacteria 8854
16 Ga0070661_100020851 3300005344 Bacteria 4676
17 Ga0070661_100428821 3300005344 Bacteria 1049
18 Ga0070669_101220539 3300005353 Bacteria 650
19 Ga0070675_101246358 3300005354 Bacteria 685
20 Ga0070674_100505614 3300005356 Bacteria 1007
21 Ga0070659_100002112 3300005366 Bacteria 14160
22 Ga0070714_100393883 3300005435 Bacteria 1308
23 Ga0070714_100456436 3300005435 Bacteria 1214
24 Ga0070714_101612169 3300005435 Bacteria 634
25 Ga0070714_101636499 3300005435 Bacteria 629
26 Ga0070713_100420560 3300005436 Bacteria 1251
27 Ga0070711_100577313 3300005439 Bacteria 935
28 Ga0070711_100935999 3300005439 Bacteria 741
29 Ga0070711_100982849 3300005439 Bacteria 723
30 Ga0070700_100076807 3300005441 Bacteria 2146
31 Ga0070700_100393806 3300005441 Bacteria 1040
32 Ga0070663_100947345 3300005455 Bacteria 746
33 Ga0070662_100067461 3300005457 Bacteria 2627
34 Ga0070681_10022549 3300005458 Bacteria 6323
35 Ga0070681_10419776 3300005458 Bacteria 1250
36 Ga0070706_100734804 3300005467 Bacteria 915
37 Ga0070679_100016072 3300005530 Bacteria 7209
38 Ga0070679_100272992 3300005530 Bacteria 1644
39 Ga0070679_100416568 3300005530 Bacteria 1289
40 Ga0070684_100008789 3300005535 Bacteria 7920
41 Ga0070684_100010334 3300005535 Bacteria 7394
42 Ga0068853_100235560 3300005539 Bacteria 1676
43 Ga0068853_101161906 3300005539 Bacteria 745
44 Ga0070686_101169482 3300005544 Bacteria 638
45 Ga0070696_100453205 3300005546 Bacteria 1013
46 Ga0070665_101259615 3300005548 Bacteria 750
47 Ga0070704_100053276 3300005549 Bacteria 2859
48 Ga0070704_100364327 3300005549 Bacteria 1224
49 Ga0068855_100411317 3300005563 Bacteria 1481
50 Ga0068855_100964363 3300005563 Bacteria 897
51 Ga0070664_100007062 3300005564 Bacteria 9060
52 Ga0070664_100027200 3300005564 Bacteria 4752
53 Ga0068857_100040837 3300005577 Bacteria 4113
54 Ga0068857_100091340 3300005577 Bacteria 2725
55 Ga0068857_100416531 3300005577 Bacteria 1252
56 Ga0068854_100149274 3300005578 Bacteria 1801
57 Ga0068854_100752258 3300005578 Bacteria 846
58 Ga0068856_100013828 3300005614 Bacteria 7802
59 Ga0070702_100202329 3300005615 Bacteria 1315
60 Ga0070702_100292017 3300005615 Bacteria 1124
61 Ga0068852_100009339 3300005616 Bacteria 7280
62 Ga0068852_100233166 3300005616 Bacteria 1755
63 Ga0068861_100312296 3300005719 Bacteria 1366
64 Ga0068870_10309395 3300005840 Bacteria 1000
65 Ga0068870_10728645 3300005840 Bacteria 687
66 Ga0081455_10005080 3300005937 Bacteria 14528
67 Ga0081455_10039565 3300005937 Bacteria 4166
68 Ga0070717_11617474 3300006028 Bacteria 587
69 Ga0075428_100297064 3300006844 Bacteria 1737
70 Ga0075433_10468505 3300006852 Bacteria 1110
71 Ga0075434_100022375 3300006871 Bacteria 6156
72 Ga0068865_100132906 3300006881 Bacteria 1866
73 Ga0068865_100306895 3300006881 Bacteria 1272
74 Ga0075436_100132098 3300006914 Bacteria 1751
75 Ga0099795_10463750 3300007788 Bacteria 585
76 Ga0105240_10058663 3300009093 Bacteria 4805
77 Ga0111539_10385501 3300009094 Bacteria 1632
78 Ga0111539_13474512 3300009094 Bacteria 506
79 Ga0105245_10024857 3300009098 Bacteria 5264
80 Ga0105245_10772511 3300009098 Bacteria 998
81 Ga0105245_11427559 3300009098 Bacteria 742
82 Ga0105245_11672054 3300009098 Bacteria 689
83 Ga0105247_10212718 3300009101 Bacteria 1305
84 Ga0114129_10910682 3300009147 Bacteria 1114
85 Ga0114129_10936940 3300009147 Bacteria 1095
86 Ga0105243_10086315 3300009148 Bacteria 2574
87 Ga0105243_10144297 3300009148 Bacteria 2035
88 Ga0105243_12451363 3300009148 Bacteria 560
89 Ga0105243_12832467 3300009148 Bacteria 525
90 Ga0105241_10284099 3300009174 Bacteria 1414
91 Ga0105242_10437393 3300009176 Bacteria 1230
92 Ga0105242_11426345 3300009176 Bacteria 721
93 Ga0105242_12413087 3300009176 Bacteria 573
94 Ga0105248_10199301 3300009177 Bacteria 2255
95 Ga0105248_10792157 3300009177 Bacteria 1070
96 Ga0105237_10996102 3300009545 Bacteria 845
97 Ga0105249_12525788 3300009553 Bacteria 586
98 Ga0105239_10295813 3300010375 Bacteria 1823
99 Ga0105239_10537682 3300010375 Bacteria 1330
100 Ga0105246_10086287 3300011119 Bacteria 2250
101 Ga0105246_10331387 3300011119 Bacteria 1241
102 Ga0157371_10102946 3300013102 Bacteria 2026
103 Ga0157370_10020385 3300013104 Bacteria 6623
104 Ga0157378_11699548 3300013297 Bacteria 678
105 Ga0163162_12602855 3300013306 Bacteria 582
106 Ga0157372_10034956 3300013307 Bacteria 5530
107 Ga0157372_10357492 3300013307 Bacteria 1702
108 Ga0157372_11444936 3300013307 Bacteria 793
109 Ga0157375_10395997 3300013308 Bacteria 1548
110 Ga0163163_12025520 3300014325 Bacteria 635
111 Ga0157380_11377043 3300014326 Bacteria 755
112 Ga0157377_10386619 3300014745 Bacteria 949
113 Ga0157377_10574901 3300014745 Bacteria 800
114 Ga0157377_11331893 3300014745 Bacteria 563
115 Ga0157376_10449941 3300014969 Bacteria 1256
116 Ga0157376_10622387 3300014969 Bacteria 1077
117 Ga0206354_10651389 3300020081 Bacteria 843
118 Ga0206354_10998578 3300020081 Bacteria 588
119 Ga0206353_10905806 3300020082 Bacteria 4713
120 Ga0207642_10819553 3300025899 Bacteria 593
121 Ga0207688_10108802 3300025901 Bacteria 1607
122 Ga0207688_10390941 3300025901 Bacteria 861
123 Ga0207688_10502645 3300025901 Bacteria 759
124 Ga0207688_10604436 3300025901 Bacteria 691
125 Ga0207680_10022804 3300025903 Bacteria 3410
126 Ga0207705_10158428 3300025909 Bacteria 1699
127 Ga0207705_10688915 3300025909 Bacteria 795
128 Ga0207654_10109892 3300025911 Bacteria 1713
129 Ga0207707_10006640 3300025912 Bacteria 10096
130 Ga0207707_10635884 3300025912 Bacteria 900
131 Ga0207695_10338030 3300025913 Bacteria 1394
132 Ga0207671_10126885 3300025914 Bacteria 1955
133 Ga0207693_10169515 3300025915 Bacteria 1719
134 Ga0207693_10367607 3300025915 Bacteria 1125
135 Ga0207663_10299653 3300025916 Bacteria 1201
136 Ga0207663_10844791 3300025916 Bacteria 731
137 Ga0207660_10055271 3300025917 Bacteria 2836
138 Ga0207660_10920299 3300025917 Bacteria 713
139 Ga0207662_10054938 3300025918 Bacteria 2375
140 Ga0207662_10534070 3300025918 Bacteria 811
141 Ga0207662_10744600 3300025918 Bacteria 689
142 Ga0207657_10037555 3300025919 Bacteria 4323
143 Ga0207649_10011900 3300025920 Bacteria 4814
144 Ga0207652_10003326 3300025921 Bacteria 13311
145 Ga0207652_10368358 3300025921 Bacteria 1297
146 Ga0207652_11091766 3300025921 Bacteria 698
147 Ga0207681_11024014 3300025923 Bacteria 693
148 Ga0207687_10061377 3300025927 Bacteria 2655
149 Ga0207687_10062769 3300025927 Bacteria 2629
150 Ga0207687_10784433 3300025927 Bacteria 812
151 Ga0207687_10870542 3300025927 Bacteria 770
152 Ga0207664_10405376 3300025929 Bacteria 1213
153 Ga0207664_11964410 3300025929 Bacteria 508
154 Ga0207644_10684576 3300025931 Bacteria 855
155 Ga0207706_10091591 3300025933 Bacteria 2673
156 Ga0207706_11279844 3300025933 Bacteria 607
157 Ga0207686_10304755 3300025934 Bacteria 1184
158 Ga0207686_10369585 3300025934 Bacteria 1085
159 Ga0207686_11305254 3300025934 Bacteria 596
160 Ga0207709_10116167 3300025935 Bacteria 1798
161 Ga0207709_10124367 3300025935 Bacteria 1747
162 Ga0207709_10292362 3300025935 Bacteria 1208
163 Ga0207669_10419543 3300025937 Bacteria 1053
164 Ga0207669_10428669 3300025937 Bacteria 1043
165 Ga0207669_11892407 3300025937 Bacteria 510
166 Ga0207704_10073559 3300025938 Bacteria 2177
167 Ga0207704_10087659 3300025938 Bacteria 2033
168 Ga0207704_10305447 3300025938 Bacteria 1221
169 Ga0207704_11239862 3300025938 Bacteria 637
170 Ga0207711_10175582 3300025941 Bacteria 1946
171 Ga0207689_10268900 3300025942 Bacteria 1411
172 Ga0207689_10537230 3300025942 Bacteria 981
173 Ga0207661_10012056 3300025944 Bacteria 6280
174 Ga0207661_10125372 3300025944 Bacteria 2192
175 Ga0207679_10028481 3300025945 Bacteria 3877
176 Ga0207679_10057703 3300025945 Bacteria 2873
177 Ga0207679_10373953 3300025945 Bacteria 1248
178 Ga0207667_10469317 3300025949 Bacteria 1278
179 Ga0207712_10223493 3300025961 Bacteria 1507
180 Ga0207640_10017332 3300025981 Bacteria 4214
181 Ga0207640_10485285 3300025981 Bacteria 1026
182 Ga0207658_10480805 3300025986 Bacteria 1104
183 Ga0207677_10068320 3300026023 Bacteria 2493
184 Ga0207703_11517967 3300026035 Bacteria 645
185 Ga0207639_10149453 3300026041 Bacteria 1955
186 Ga0207639_11325692 3300026041 Bacteria 676
187 Ga0207678_10025129 3300026067 Bacteria 5200
188 Ga0207678_10219338 3300026067 Bacteria 1628
189 Ga0207678_10519673 3300026067 Bacteria 1039
190 Ga0207708_10010964 3300026075 Bacteria 6743
191 Ga0207708_10087381 3300026075 Bacteria 2400
192 Ga0207708_10147094 3300026075 Bacteria 1852
193 Ga0207708_10507980 3300026075 Bacteria 1011
194 Ga0207702_10079355 3300026078 Bacteria 2845
195 Ga0207648_10050972 3300026089 Bacteria 3618
196 Ga0207648_10677027 3300026089 Bacteria 955
197 Ga0207674_10033832 3300026116 Bacteria 5348
198 Ga0207674_10446016 3300026116 Bacteria 1251
199 Ga0207683_10275920 3300026121 Bacteria 1536
200 Ga0207698_10005457 3300026142 Bacteria 7863
201 Ga0207428_10388581 3300027907 Bacteria 1023
202 Ga0268265_11616799 3300028380 Bacteria 653
203 Ga0265318_10011459 3300028577 Bacteria 3816
204 Ga0265318_10238436 3300028577 Bacteria 664
205 Ga0307515_10001123 3300028794 Bacteria 61209
206 Ga0307515_10033517 3300028794 Bacteria 8448
207 Ga0265320_10063270 3300031240 Bacteria 1760
208 Ga0307508_10020219 3300031616 Bacteria 6047
209 Ga0307508_10047087 3300031616 Bacteria 3848
210 Ga0307516_10001181 3300031730 Bacteria 36511
211 Ga0307405_10265726 3300031731 Bacteria 1284
212 Ga0307405_10326228 3300031731 Bacteria 1175
213 Ga0307405_10737073 3300031731 Bacteria 820
214 Ga0307410_10321337 3300031852 Bacteria 1228
215 Ga0307410_10652765 3300031852 Bacteria 883
216 Ga0307410_11424833 3300031852 Bacteria 609
217 Ga0307407_10211864 3300031903 Bacteria 1305
218 Ga0307407_10527058 3300031903 Bacteria 870
219 Ga0307412_10177137 3300031911 Bacteria 1600
220 Ga0307412_10425390 3300031911 Bacteria 1087
221 Ga0307409_100103215 3300031995 Bacteria 2371
222 Ga0307409_100698941 3300031995 Unclassified 1013
223 Ga0307409_101548601 3300031995 Bacteria 691
224 Ga0307416_100320495 3300032002 Bacteria 1552
225 Ga0307416_102433752 3300032002 Bacteria 623
226 Ga0307414_11234154 3300032004 Bacteria 693
227 Ga0307415_100371022 3300032126 Bacteria 1212
228 Ga0307415_101145783 3300032126 Bacteria 730
229 Ga0307415_101388990 3300032126 Bacteria 668
230 Ga0307415_102133421 3300032126 Bacteria 547
231 Ga0373938_0064034 3300034957 Bacteria 866
232 Ga0373945_0207728 3300035116 Bacteria 815
233 Ga0373960_0101900 3300035121 Bacteria 932
234 Ga0373937_1692231 3300036401 Bacteria 579
235 Ga0395899_0751936 3300037312 Bacteria 607
236 Ga0395898_0022090 3300037466 Bacteria 6446
237 Ga0395898_1663283 3300037466 Bacteria 562
238 Ga0395901_0018791 3300038443 Bacteria 7062
239 Ga0395901_1711375 3300038443 Bacteria 580
240 Ga0436365_1405597 3300039437 Bacteria 3901
241 Ga0439465_0176350 3300041413 Bacteria 772
242 Ga0439465_0178476 3300041413 Bacteria 768
243 Ga0439465_0179285 3300041413 Bacteria 766
244 Ga0451807_0206446 3300041486 Bacteria 1911
245 Ga0451807_2719724 3300041486 Bacteria 577
246 Ga0451833_1223111 3300041491 Bacteria 512
247 Ga0451853_1266442 3300041512 Bacteria 923
248 Ga0451853_3989427 3300041512 Bacteria 615
249 Ga0439458_0009880 3300042157 Bacteria 2125
250 Ga0439459_0172497 3300042438 Bacteria 577
251 Ga0439464_0012571 3300042439 Bacteria 2256
252 Ga0466966_0109205 3300044684 Bacteria 1706
253 Ga0466966_0272225 3300044684 Bacteria 1019
254 Ga0466966_0491736 3300044684 Bacteria 738
255 Ga0466966_0705725 3300044684 Bacteria 608
256 Ga0466961_0963185 3300044693 Bacteria 507
257 Ga0466963_0228020 3300044694 Bacteria 1305
258 Ga0466968_0088470 3300044735 Bacteria 1369
259 Ga0466970_0174435 3300044765 Bacteria 1192
260 Ga0466957_0270237 3300044842 Bacteria 1135
261 Ga0466957_1120132 3300044842 Bacteria 568
262 Ga0466960_0063866 3300044901 Bacteria 1814
263 Ga0466960_0140504 3300044901 Bacteria 1282
264 Ga0466959_0184398 3300045049 Bacteria 1459
265 Ga0466959_0399799 3300045049 Bacteria 934
266 Ga0466959_0451509 3300045049 Bacteria 871
267 Ga0466958_0033031 3300045836 Bacteria 3082
268 Ga0466958_0036294 3300045836 Bacteria 2950
269 Ga0466958_0477792 3300045836 Bacteria 808
270 Ga0466967_0134684 3300045976 Bacteria 2297
271 Ga0466967_1008711 3300045976 Bacteria 829
272 Ga0466967_1248247 3300045976 Bacteria 740
273 Ga0495603_0099937 3300046455 Bacteria 1694
274 Ga0495629_0188776 3300046459 Bacteria 1427
275 Ga0495629_0489835 3300046459 Bacteria 830
276 Ga0495641_0202079 3300046461 Bacteria 891
277 Ga0495651_0422819 3300046462 Bacteria 866
278 Ga0495653_0322410 3300046463 Bacteria 1001
279 Ga0495582_0176323 3300046473 Bacteria 1218
280 Ga0495639_0188745 3300046475 Bacteria 1006
281 Ga0495662_0304614 3300046476 Bacteria 784
282 Ga0495664_0207541 3300046477 Bacteria 1187
283 Ga0495594_0341934 3300046499 Bacteria 852
284 Ga0495594_0405268 3300046499 Bacteria 776
285 Ga0495607_0451702 3300046501 Bacteria 577
286 Ga0495583_0285254 3300046506 Bacteria 658
287 Ga0495620_0134225 3300046515 Bacteria 970
288 Ga0495620_0230434 3300046515 Bacteria 708
289 Ga0495632_0212543 3300046519 Bacteria 877
290 Ga0495652_0074629 3300046529 Bacteria 2820
291 Ga0495665_0178636 3300046531 Bacteria 1104
292 Ga0495622_0218441 3300046557 Bacteria 845
293 Ga0495667_0252549 3300046559 Bacteria 1122
294 Ga0495656_0139002 3300046615 Bacteria 1163
295 Ga0495656_0202257 3300046615 Bacteria 986
296 Ga0495635_0476978 3300046663 Bacteria 823
297 Ga0495588_0248954 3300046674 Bacteria 937
298 Ga0495599_0696766 3300046678 Bacteria 586
299 Ga0495646_0365208 3300046680 Bacteria 754
300 Ga0495658_0589006 3300046683 Bacteria 712
301 Ga0495658_0831579 3300046683 Bacteria 591
302 Ga0495669_0463222 3300046684 Bacteria 616
303 Ga0495670_0351247 3300046691 Bacteria 794
304 Ga0495671_0171807 3300046692 Bacteria 1054
305 Ga0495589_0256575 3300046794 Bacteria 816
306 Ga0495600_0072388 3300046809 Bacteria 2252
307 Ga0495600_0200929 3300046809 Bacteria 1280
308 Ga0495674_0215362 3300047319 Bacteria 1590
309 Ga0495680_0347744 3300047322 Bacteria 1033
310 Ga0495686_0406533 3300047472 Bacteria 730
311 Ga0495593_0097179 3300047673 Bacteria 1513
312 Ga0495593_0405713 3300047673 Bacteria 682
313 Ga0496100_0165512 3300048903 Bacteria 1588
314 Ga0496100_0217737 3300048903 Bacteria 1400
315 Ga0496100_0425794 3300048903 Bacteria 1014
316 Ga0496101_0825950 3300048904 Bacteria 731
317 Ga0496102_0027979 3300048905 Bacteria 5037
318 Ga0496102_0109047 3300048905 Bacteria 2579
319 Ga0496102_0377636 3300048905 Bacteria 1334
320 Ga0496102_1191225 3300048905 Bacteria 681
321 Ga0496102_1333688 3300048905 Bacteria 637
322 Ga0496103_0299932 3300048906 Bacteria 1034
323 Ga0496104_0013602 3300048907 Bacteria 7336
324 Ga0496104_0014409 3300048907 Bacteria 7145
325 Ga0496104_0017818 3300048907 Bacteria 6476
326 Ga0496105_0018647 3300048908 Bacteria 5585
327 Ga0496105_0041416 3300048908 Bacteria 3797
328 Ga0496105_0689264 3300048908 Bacteria 785
329 Ga0496106_0824782 3300048909 Bacteria 735
330 Ga0496108_0014293 3300048911 Bacteria 6478
331 Ga0496108_0014676 3300048911 Bacteria 6395
332 Ga0496108_0072924 3300048911 Bacteria 2899
333 Ga0496108_0077519 3300048911 Bacteria 2811
334 Ga0496108_0320838 3300048911 Bacteria 1351
335 Ga0496108_0332998 3300048911 Bacteria 1324
336 Ga0496109_0001181 3300048912 Bacteria 21688
337 Ga0496109_0002763 3300048912 Bacteria 14695
338 Ga0496109_0078131 3300048912 Bacteria 3047
339 Ga0496109_0300546 3300048912 Bacteria 1513
340 Ga0496109_0330551 3300048912 Bacteria 1439
341 Ga0496109_0555786 3300048912 Bacteria 1083
342 Ga0496109_1168310 3300048912 Bacteria 706
343 Ga0496109_1826178 3300048912 Bacteria 541
344 Ga0496110_0044815 3300048913 Bacteria 3864
345 Ga0496110_0098769 3300048913 Bacteria 2617
346 Ga0496110_0105613 3300048913 Bacteria 2527
347 Ga0496110_0175806 3300048913 Bacteria 1943
348 Ga0496110_0334365 3300048913 Bacteria 1380
349 Ga0496110_0563851 3300048913 Bacteria 1035
350 Ga0496110_0600327 3300048913 Bacteria 999
351 Ga0496110_0836439 3300048913 Bacteria 825
352 Ga0496111_0001238 3300048914 Bacteria 14284
353 Ga0496111_0015637 3300048914 Bacteria 5214
354 Ga0496111_0106293 3300048914 Bacteria 2066
355 Ga0496111_0299566 3300048914 Bacteria 1192
356 Ga0496112_0001773 3300048915 Bacteria 16945
357 Ga0496112_0387622 3300048915 Bacteria 1338
358 Ga0496112_0455696 3300048915 Bacteria 1217
359 Ga0496113_0215417 3300048916 Bacteria 1529
360 Ga0496113_0470097 3300048916 Bacteria 1010
361 Ga0496114_0015453 3300048917 Bacteria 6140
362 Ga0496114_0041425 3300048917 Bacteria 3817
363 Ga0496114_0041581 3300048917 Bacteria 3810
364 Ga0496114_0282609 3300048917 Bacteria 1463
365 Ga0496114_0408493 3300048917 Bacteria 1202
366 Ga0496114_0962047 3300048917 Bacteria 736
367 Ga0496114_1047204 3300048917 Bacteria 700
368 Ga0496114_1207403 3300048917 Bacteria 642
369 Ga0496115_0081827 3300048918 Bacteria 2630
370 Ga0496119_0270576 3300048922 Bacteria 849
371 Ga0496126_0050096 3300048929 Bacteria 3808
372 Ga0501031_0102192 3300049568 Bacteria 1870
373 Ga0501039_0981300 3300049575 Bacteria 657
374 Ga0501039_1011654 3300049575 Bacteria 646
375 Ga0501040_0033787 3300049576 Bacteria 3467
376 Ga0501043_1108838 3300049579 Bacteria 559
377 Ga0501048_0232302 3300049582 Bacteria 1309
378 Ga0501071_0518298 3300049587 Bacteria 915
379 Ga0501044_0002696 3300049823 Bacteria 20180
380 Ga0501045_0275448 3300049824 Bacteria 1253
381 nmdc:mga07m45_468592_c1 3300050496 Bacteria 730
382 nmdc:mga05p37_739391_c1 3300050507 Bacteria 1086
383 nmdc:mga08y16_407646_c1 3300050511 Bacteria 1390
384 nmdc:mga0n895_14986_c1 3300050512 Bacteria 7061
385 nmdc:mga0n895_162702_c1 3300050512 Bacteria 2263
386 nmdc:mga08x19_98351_c1 3300050514 Bacteria 1938
387 nmdc:mga0a205_93800_c1 3300050515 Bacteria 2900
388 Ga0495601_0623245 3300053077 Bacteria 691
389 Ga0495595_0116349 3300053084 Bacteria 1300
390 Ga0495619_0163069 3300053085 Bacteria 1540
391 Ga0495619_0645715 3300053085 Bacteria 722
392 Ga0466962_0587143 3300061719 Bacteria 567
393 Ga0466962_0660267 3300061719 Bacteria 535
394 Ga0530510_0041059 3300061734 Bacteria 3340
395 2643850082 2643221567 Bacteria 4163945
396 2819425915 2818991318 Bacteria 5266538
397 2819665003 2818991458 Bacteria 4794049
398 Ga0495619_0619062
399 rootL2_10014765
400 Ga0070658_10582783
401 Ga0070658_10878937
402 Ga0070683_100016184
403 Ga0070683_100061690
404 Ga0070690_100146445
405 Ga0068869_100200799
406 Ga0070680_100003669
407 Ga0070680_100311485
408 Ga0070680_100508852
409 Ga0070682_100316665
410 Ga0068868_101084665
411 Ga0068868_101134138
412 Ga0070660_100005389
413 Ga0070661_100020851
414 Ga0070661_100428821
415 Ga0070669_101220539
416 Ga0070675_101246358
417 Ga0070674_100505614
418 Ga0070659_100002112
419 Ga0070714_100393883
420 Ga0070714_100456436
421 Ga0070714_101612169
422 Ga0070714_101636499
423 Ga0070713_100420560
424 Ga0070711_100577313
425 Ga0070711_100935999
426 Ga0070711_100982849
427 Ga0070700_100076807
428 Ga0070700_100393806
429 Ga0070663_100947345
430 Ga0070662_100067461
431 Ga0070681_10022549
432 Ga0070681_10419776
433 Ga0070706_100734804
434 Ga0070679_100016072
435 Ga0070679_100272992
436 Ga0070679_100416568
437 Ga0070684_100008789
438 Ga0070684_100010334
439 Ga0068853_100235560
440 Ga0068853_101161906
441 Ga0070686_101169482
442 Ga0070696_100453205
443 Ga0070665_101259615
444 Ga0070704_100053276
445 Ga0070704_100364327
446 Ga0068855_100411317
447 Ga0068855_100964363
448 Ga0070664_100007062
449 Ga0070664_100027200
450 Ga0068857_100040837
451 Ga0068857_100091340
452 Ga0068857_100416531
453 Ga0068854_100149274
454 Ga0068854_100752258
455 Ga0068856_100013828
456 Ga0070702_100202329
457 Ga0070702_100292017
458 Ga0068852_100009339
459 Ga0068852_100233166
460 Ga0068861_100312296
461 Ga0068870_10309395
462 Ga0068870_10728645
463 Ga0081455_10005080
464 Ga0081455_10039565
465 Ga0070717_11617474
466 Ga0075428_100297064
467 Ga0075433_10468505
468 Ga0075434_100022375
469 Ga0068865_100132906
470 Ga0068865_100306895
471 Ga0075436_100132098
472 Ga0099795_10463750
473 Ga0105240_10058663
474 Ga0111539_10385501
475 Ga0111539_13474512
476 Ga0105245_10024857
477 Ga0105245_10772511
478 Ga0105245_11427559
479 Ga0105245_11672054
480 Ga0105247_10212718
481 Ga0114129_10910682
482 Ga0114129_10936940
483 Ga0105243_10086315
484 Ga0105243_10144297
485 Ga0105243_12451363
486 Ga0105243_12832467
487 Ga0105241_10284099
488 Ga0105242_10437393
489 Ga0105242_11426345
490 Ga0105242_12413087
491 Ga0105248_10199301
492 Ga0105248_10792157
493 Ga0105237_10996102
494 Ga0105249_12525788
495 Ga0105239_10295813
496 Ga0105239_10537682
497 Ga0105246_10086287
498 Ga0105246_10331387
499 Ga0157371_10102946
500 Ga0157370_10020385
501 Ga0157378_11699548
502 Ga0163162_12602855
503 Ga0157372_10034956
504 Ga0157372_10357492
505 Ga0157372_11444936
506 Ga0157375_10395997
507 Ga0163163_12025520
508 Ga0157380_11377043
509 Ga0157377_10386619
510 Ga0157377_10574901
511 Ga0157377_11331893
512 Ga0157376_10449941
513 Ga0157376_10622387
514 Ga0206354_10651389
515 Ga0206354_10998578
516 Ga0206353_10905806
517 Ga0207642_10819553
518 Ga0207688_10108802
519 Ga0207688_10390941
520 Ga0207688_10502645
521 Ga0207688_10604436
522 Ga0207680_10022804
523 Ga0207705_10158428
524 Ga0207705_10688915
525 Ga0207654_10109892
526 Ga0207707_10006640
527 Ga0207707_10635884
528 Ga0207695_10338030
529 Ga0207671_10126885
530 Ga0207693_10169515
531 Ga0207693_10367607
532 Ga0207663_10299653
533 Ga0207663_10844791
534 Ga0207660_10055271
535 Ga0207660_10920299
536 Ga0207662_10054938
537 Ga0207662_10534070
538 Ga0207662_10744600
539 Ga0207657_10037555
540 Ga0207649_10011900
541 Ga0207652_10003326
542 Ga0207652_10368358
543 Ga0207652_11091766
544 Ga0207681_11024014
545 Ga0207687_10061377
546 Ga0207687_10062769
547 Ga0207687_10784433
548 Ga0207687_10870542
549 Ga0207664_10405376
550 Ga0207664_11964410
551 Ga0207644_10684576
552 Ga0207706_10091591
553 Ga0207706_11279844
554 Ga0207686_10304755
555 Ga0207686_10369585
556 Ga0207686_11305254
557 Ga0207709_10116167
558 Ga0207709_10124367
559 Ga0207709_10292362
560 Ga0207669_10419543
561 Ga0207669_10428669
562 Ga0207669_11892407
563 Ga0207704_10073559
564 Ga0207704_10087659
565 Ga0207704_10305447
566 Ga0207704_11239862
567 Ga0207711_10175582
568 Ga0207689_10268900
569 Ga0207689_10537230
570 Ga0207661_10012056
571 Ga0207661_10125372
572 Ga0207679_10028481
573 Ga0207679_10057703
574 Ga0207679_10373953
575 Ga0207667_10469317
576 Ga0207712_10223493
577 Ga0207640_10017332
578 Ga0207640_10485285
579 Ga0207658_10480805
580 Ga0207677_10068320
581 Ga0207703_11517967
582 Ga0207639_10149453
583 Ga0207639_11325692
584 Ga0207678_10025129
585 Ga0207678_10219338
586 Ga0207678_10519673
587 Ga0207708_10010964
588 Ga0207708_10087381
589 Ga0207708_10147094
590 Ga0207708_10507980
591 Ga0207702_10079355
592 Ga0207648_10050972
593 Ga0207648_10677027
594 Ga0207674_10033832
595 Ga0207674_10446016
596 Ga0207683_10275920
597 Ga0207698_10005457
598 Ga0207428_10388581
599 Ga0268265_11616799
600 Ga0265318_10011459
601 Ga0265318_10238436
602 Ga0307515_10001123
603 Ga0307515_10033517
604 Ga0265320_10063270
605 Ga0307508_10020219
606 Ga0307508_10047087
607 Ga0307516_10001181
608 Ga0307405_10265726
609 Ga0307405_10326228
610 Ga0307405_10737073
611 Ga0307410_10321337
612 Ga0307410_10652765
613 Ga0307410_11424833
614 Ga0307407_10211864
615 Ga0307407_10527058
616 Ga0307412_10177137
617 Ga0307412_10425390
618 Ga0307409_100103215
619 Ga0307409_100698941
620 Ga0307409_101548601
621 Ga0307416_100320495
622 Ga0307416_102433752
623 Ga0307414_11234154
624 Ga0307415_100371022
625 Ga0307415_101145783
626 Ga0307415_101388990
627 Ga0307415_102133421
628 Ga0373938_0064034
629 Ga0373945_0207728
630 Ga0373960_0101900
631 Ga0373937_1692231
632 Ga0395899_0751936
633 Ga0395898_0022090
634 Ga0395898_1663283
635 Ga0395901_0018791
636 Ga0395901_1711375
637 Ga0436365_1405597
638 Ga0439465_0176350
639 Ga0439465_0178476
640 Ga0439465_0179285
641 Ga0451807_0206446
642 Ga0451807_2719724
643 Ga0451833_1223111
644 Ga0451853_1266442
645 Ga0451853_3989427
646 Ga0439458_0009880
647 Ga0439459_0172497
648 Ga0439464_0012571
649 Ga0466966_0109205
650 Ga0466966_0272225
651 Ga0466966_0491736
652 Ga0466966_0705725
653 Ga0466961_0963185
654 Ga0466963_0228020
655 Ga0466968_0088470
656 Ga0466970_0174435
657 Ga0466957_0270237
658 Ga0466957_1120132
659 Ga0466960_0063866
660 Ga0466960_0140504
661 Ga0466959_0184398
662 Ga0466959_0399799
663 Ga0466959_0451509
664 Ga0466958_0033031
665 Ga0466958_0036294
666 Ga0466958_0477792
667 Ga0466967_0134684
668 Ga0466967_1008711
669 Ga0466967_1248247
670 Ga0495603_0099937
671 Ga0495629_0188776
672 Ga0495629_0489835
673 Ga0495641_0202079
674 Ga0495651_0422819
675 Ga0495653_0322410
676 Ga0495582_0176323
677 Ga0495639_0188745
678 Ga0495662_0304614
679 Ga0495664_0207541
680 Ga0495594_0341934
681 Ga0495594_0405268
682 Ga0495607_0451702
683 Ga0495583_0285254
684 Ga0495620_0134225
685 Ga0495620_0230434
686 Ga0495632_0212543
687 Ga0495652_0074629
688 Ga0495665_0178636
689 Ga0495622_0218441
690 Ga0495667_0252549
691 Ga0495656_0139002
692 Ga0495656_0202257
693 Ga0495635_0476978
694 Ga0495588_0248954
695 Ga0495599_0696766
696 Ga0495646_0365208
697 Ga0495658_0589006
698 Ga0495658_0831579
699 Ga0495669_0463222
700 Ga0495670_0351247
701 Ga0495671_0171807
702 Ga0495589_0256575
703 Ga0495600_0072388
704 Ga0495600_0200929
705 Ga0495674_0215362
706 Ga0495680_0347744
707 Ga0495686_0406533
708 Ga0495593_0097179
709 Ga0495593_0405713
710 Ga0496100_0165512
711 Ga0496100_0217737
712 Ga0496100_0425794
713 Ga0496101_0825950
714 Ga0496102_0027979
715 Ga0496102_0109047
716 Ga0496102_0377636
717 Ga0496102_1191225
718 Ga0496102_1333688
719 Ga0496103_0299932
720 Ga0496104_0013602
721 Ga0496104_0014409
722 Ga0496104_0017818
723 Ga0496105_0018647
724 Ga0496105_0041416
725 Ga0496105_0689264
726 Ga0496106_0824782
727 Ga0496108_0014293
728 Ga0496108_0014676
729 Ga0496108_0072924
730 Ga0496108_0077519
731 Ga0496108_0320838
732 Ga0496108_0332998
733 Ga0496109_0001181
734 Ga0496109_0002763
735 Ga0496109_0078131
736 Ga0496109_0300546
737 Ga0496109_0330551
738 Ga0496109_0555786
739 Ga0496109_1168310
740 Ga0496109_1826178
741 Ga0496110_0044815
742 Ga0496110_0098769
743 Ga0496110_0105613
744 Ga0496110_0175806
745 Ga0496110_0334365
746 Ga0496110_0563851
747 Ga0496110_0600327
748 Ga0496110_0836439
749 Ga0496111_0001238
750 Ga0496111_0015637
751 Ga0496111_0106293
752 Ga0496111_0299566
753 Ga0496112_0001773
754 Ga0496112_0387622
755 Ga0496112_0455696
756 Ga0496113_0215417
757 Ga0496113_0470097
758 Ga0496114_0015453
759 Ga0496114_0041425
760 Ga0496114_0041581
761 Ga0496114_0282609
762 Ga0496114_0408493
763 Ga0496114_0962047
764 Ga0496114_1047204
765 Ga0496114_1207403
766 Ga0496115_0081827
767 Ga0496119_0270576
768 Ga0496126_0050096
769 Ga0501031_0102192
770 Ga0501039_0981300
771 Ga0501039_1011654
772 Ga0501040_0033787
773 Ga0501043_1108838
774 Ga0501048_0232302
775 Ga0501071_0518298
776 Ga0501044_0002696
777 Ga0501045_0275448
778 nmdc:mga07m45_468592_c1
779 nmdc:mga05p37_739391_c1
780 nmdc:mga08y16_407646_c1
781 nmdc:mga0n895_14986_c1
782 nmdc:mga0n895_162702_c1
783 nmdc:mga08x19_98351_c1
784 nmdc:mga0a205_93800_c1
785 Ga0495601_0623245
786 Ga0495595_0116349
787 Ga0495619_0163069
788 Ga0495619_0645715
789 Ga0466962_0587143
790 Ga0466962_0660267
791 Ga0530510_0041059
792 2643850082
793 2819425915
794 2819665003

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

3

131

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d7j-assembly1.cif.gz_D sco6650, a 6-pyruvoyltetrahydropterin synthase homolog from streptomyces coelicolor 0.9657 2 127
3d7j-assembly1.cif.gz_D sco6650, a 6-pyruvoyltetrahydropterin synthase homolog from streptomyces coelicolor 0.9508 2 127
2oba-assembly1.cif.gz_D pseudomonas aeruginosa 6-pyruvoyl tetrahydrobiopterin synthase 0.8644 2 126
2g64-assembly1.cif.gz_A structure of caenorhabditis elegans 6-pyruvoyl tetrahydropterin synthase 0.8583 2 125
2oba-assembly1.cif.gz_D pseudomonas aeruginosa 6-pyruvoyl tetrahydrobiopterin synthase 0.8448 2 126
ID Description Score Start End Superfamily
3d7jC00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9576 2 127 3.30.479.10
3d7jC00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9428 2 127 3.30.479.10
2g64A00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8583 2 125 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8498 1 125 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8429 1 125 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A7K2MGU2-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9968 1 89 GO:0046872
GO:0070497
AF-A0A558ACM0-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9916 1 127 GO:0046872
GO:0070497
AF-A0A1Q9SV15-F1-model_v4 deleted 0.9901 1 127
AF-A0A5S4VAQ5-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9886 2 126 GO:0046872
GO:0070497
AF-A0A1H1SLV2-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9886 2 127 GO:0046872
GO:0070497

Map