F433831

General Info

Members Datasets Scaffolds Average Seq Length
397 234 794 129

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1714545|Ga0436365_1714545_273_722
Length 149
Sequence MMPAMKKLDSTDWRGFKAPSLSEFEELAEAAYARLPTRFRKLCEHVIIRVEDFPTEDVLEEMNLESPFEILGLFTGVGLAQGGAVDESGKLPNMVHLFRRPILDYWAEHEETLDSIVTHVLVHEIGHHFGLSDADMERIEGESDAVQKH

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
60 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
89 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
90 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
91 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
95 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
96 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
99 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
102 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
124 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
125 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
147 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
162 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
210 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
211 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
225 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
230 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
231 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
232 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
233 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
234 2904699407

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 0
Isolates 1.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.02
Nodule 0.5
Rhizoplane 5.29
Rhizosphere 86.9
Stem 0
Stem Tuber 0
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1714545 3300039437 Bacteria 1648
2 Ga0065715_10337500 3300005293 Bacteria 970
3 Ga0070683_100088547 3300005329 Bacteria 2904
4 Ga0070690_100155519 3300005330 Bacteria 1563
5 Ga0070666_10402957 3300005335 Bacteria 984
6 Ga0070680_100055433 3300005336 Bacteria 3239
7 Ga0070680_100148851 3300005336 Bacteria 1965
8 Ga0070660_100001075 3300005339 Bacteria 18360
9 Ga0070691_10072232 3300005341 Bacteria 1676
10 Ga0070673_100239824 3300005364 Bacteria 1576
11 Ga0070659_100344428 3300005366 Bacteria 1249
12 Ga0070667_101234969 3300005367 Bacteria 700
13 Ga0070709_10017595 3300005434 Bacteria 4102
14 Ga0070709_10144054 3300005434 Bacteria 1640
15 Ga0070709_10203754 3300005434 Bacteria 1402
16 Ga0070709_10542341 3300005434 Bacteria 889
17 Ga0070714_100518272 3300005435 Bacteria 1139
18 Ga0070713_100165932 3300005436 Bacteria 1975
19 Ga0070713_100567484 3300005436 Bacteria 1076
20 Ga0070713_100585756 3300005436 Bacteria 1059
21 Ga0070710_10027648 3300005437 Bacteria 3026
22 Ga0070711_100014987 3300005439 Bacteria 4898
23 Ga0070711_100113483 3300005439 Bacteria 1993
24 Ga0070711_101077481 3300005439 Bacteria 692
25 Ga0070663_100661453 3300005455 Bacteria 884
26 Ga0070663_101214955 3300005455 Bacteria 663
27 Ga0070681_10022117 3300005458 Bacteria 6382
28 Ga0070681_10089400 3300005458 Bacteria 3031
29 Ga0070681_10152711 3300005458 Bacteria 2235
30 Ga0070681_10807047 3300005458 Bacteria 856
31 Ga0070706_100342554 3300005467 Bacteria 1394
32 Ga0070706_100354445 3300005467 Bacteria 1367
33 Ga0070679_100078787 3300005530 Bacteria 3284
34 Ga0070679_100102846 3300005530 Bacteria 2843
35 Ga0070679_100358582 3300005530 Bacteria 1405
36 Ga0070679_100399898 3300005530 Bacteria 1319
37 Ga0070679_101250481 3300005530 Bacteria 688
38 Ga0070679_101706074 3300005530 Bacteria 578
39 Ga0070684_100011685 3300005535 Bacteria 7001
40 Ga0070684_100071164 3300005535 Bacteria 3061
41 Ga0070684_100233727 3300005535 Bacteria 1679
42 Ga0070697_100013361 3300005536 Bacteria 6440
43 Ga0068853_100144171 3300005539 Bacteria 2139
44 Ga0068853_100499285 3300005539 Bacteria 1148
45 Ga0068853_100643275 3300005539 Bacteria 1009
46 Ga0068853_101939161 3300005539 Bacteria 571
47 Ga0068855_100867525 3300005563 Bacteria 955
48 Ga0068857_100185143 3300005577 Bacteria 1895
49 Ga0068856_100071502 3300005614 Bacteria 3435
50 Ga0068856_102020361 3300005614 Bacteria 587
51 Ga0068852_100082459 3300005616 Bacteria 2857
52 Ga0068866_10255831 3300005718 Bacteria 1074
53 Ga0068866_10819986 3300005718 Bacteria 648
54 Ga0068851_10068621 3300005834 Bacteria 1830
55 Ga0070717_10144411 3300006028 Bacteria 2054
56 Ga0070717_11804418 3300006028 Bacteria 553
57 Ga0075365_10166786 3300006038 Bacteria 1536
58 Ga0070716_100058614 3300006173 Bacteria 2216
59 Ga0070716_100522671 3300006173 Bacteria 880
60 Ga0070716_100536575 3300006173 Bacteria 870
61 Ga0070716_101170655 3300006173 Unclassified 616
62 Ga0070712_100126263 3300006175 Bacteria 1933
63 Ga0075367_10578027 3300006178 Bacteria 714
64 Ga0075366_10378188 3300006195 Bacteria 871
65 Ga0075370_10249158 3300006353 Bacteria 1052
66 Ga0075434_100281059 3300006871 Bacteria 1684
67 Ga0075436_100141370 3300006914 Bacteria 1692
68 Ga0075435_102023350 3300007076 Bacteria 506
69 Ga0099794_10216977 3300007265 Bacteria 982
70 Ga0099794_10435382 3300007265 Bacteria 687
71 Ga0099795_10016564 3300007788 Bacteria 2333
72 Ga0105240_10018930 3300009093 Bacteria 9221
73 Ga0105240_10070025 3300009093 Bacteria 4340
74 Ga0105240_10146885 3300009093 Bacteria 2813
75 Ga0105240_10155770 3300009093 Bacteria 2717
76 Ga0105240_10567994 3300009093 Bacteria 1253
77 Ga0105240_11563877 3300009093 Bacteria 691
78 Ga0105247_10119594 3300009101 Bacteria 1705
79 Ga0105243_10347988 3300009148 Bacteria 1360
80 Ga0105242_12166026 3300009176 Bacteria 601
81 Ga0105237_10162525 3300009545 Bacteria 2232
82 Ga0105237_11042192 3300009545 Bacteria 825
83 Ga0105238_10005612 3300009551 Bacteria 12402
84 Ga0105238_10115156 3300009551 Bacteria 2668
85 Ga0105238_10409258 3300009551 Bacteria 1350
86 Ga0105238_10915105 3300009551 Bacteria 896
87 Ga0099796_10022250 3300010159 Bacteria 1964
88 Ga0105239_10089616 3300010375 Bacteria 3392
89 Ga0105239_11598174 3300010375 Bacteria 754
90 Ga0105239_12889761 3300010375 Bacteria 560
91 Ga0157373_10061669 3300013100 Bacteria 2656
92 Ga0157370_10070601 3300013104 Bacteria 3296
93 Ga0157370_10461766 3300013104 Bacteria 1167
94 Ga0157370_10526208 3300013104 Bacteria 1085
95 Ga0157370_10548597 3300013104 Bacteria 1060
96 Ga0157369_10110009 3300013105 Bacteria 2929
97 Ga0157369_10116396 3300013105 Bacteria 2838
98 Ga0157369_10978385 3300013105 Bacteria 867
99 Ga0157369_11877535 3300013105 Bacteria 608
100 Ga0157378_11352173 3300013297 Bacteria 754
101 Ga0163162_11224813 3300013306 Bacteria 852
102 Ga0157372_10513669 3300013307 Bacteria 1397
103 Ga0157372_10575051 3300013307 Bacteria 1313
104 Ga0157372_10660876 3300013307 Bacteria 1217
105 Ga0157372_10839212 3300013307 Bacteria 1067
106 Ga0157372_10961372 3300013307 Bacteria 990
107 Ga0157372_11110781 3300013307 Bacteria 914
108 Ga0163163_11063437 3300014325 Bacteria 872
109 Ga0182008_10369063 3300014497 Bacteria 765
110 Ga0157379_11098313 3300014968 Bacteria 762
111 Ga0157379_11561513 3300014968 Bacteria 643
112 Ga0213872_10025106 3300021361 Bacteria 2740
113 Ga0213874_10292273 3300021377 Bacteria 611
114 Ga0213876_10112359 3300021384 Bacteria 1446
115 Ga0213876_10168192 3300021384 Bacteria 1166
116 Ga0213876_10214947 3300021384 Bacteria 1022
117 Ga0213875_10012827 3300021388 Bacteria 4129
118 Ga0207656_10039857 3300025321 Bacteria 1989
119 Ga0207692_10079109 3300025898 Bacteria 1753
120 Ga0207692_10154056 3300025898 Bacteria 1319
121 Ga0207699_10006629 3300025906 Bacteria 5618
122 Ga0207699_10168399 3300025906 Bacteria 1464
123 Ga0207705_10339460 3300025909 Bacteria 1156
124 Ga0207684_11152878 3300025910 Bacteria 643
125 Ga0207707_10004159 3300025912 Bacteria 12822
126 Ga0207707_10067456 3300025912 Bacteria 3116
127 Ga0207707_10074311 3300025912 Bacteria 2964
128 Ga0207707_10123192 3300025912 Bacteria 2267
129 Ga0207695_10033885 3300025913 Bacteria 5560
130 Ga0207695_10106551 3300025913 Bacteria 2789
131 Ga0207695_10191988 3300025913 Bacteria 1960
132 Ga0207695_10331010 3300025913 Bacteria 1412
133 Ga0207671_10083329 3300025914 Bacteria 2401
134 Ga0207693_10101159 3300025915 Bacteria 2260
135 Ga0207693_10126715 3300025915 Bacteria 2007
136 Ga0207693_11075283 3300025915 Bacteria 612
137 Ga0207663_10006822 3300025916 Bacteria 5878
138 Ga0207660_10050092 3300025917 Bacteria 2964
139 Ga0207660_10128907 3300025917 Bacteria 1924
140 Ga0207657_10002658 3300025919 Bacteria 19293
141 Ga0207657_10003784 3300025919 Bacteria 16083
142 Ga0207649_10706355 3300025920 Bacteria 782
143 Ga0207652_10229691 3300025921 Bacteria 1672
144 Ga0207652_10599600 3300025921 Bacteria 988
145 Ga0207694_10094349 3300025924 Bacteria 2364
146 Ga0207694_10652523 3300025924 Bacteria 887
147 Ga0207700_10876089 3300025928 Bacteria 803
148 Ga0207700_10879664 3300025928 Bacteria 802
149 Ga0207664_10363240 3300025929 Bacteria 1283
150 Ga0207665_10038518 3300025939 Bacteria 3184
151 Ga0207665_10107206 3300025939 Bacteria 1958
152 Ga0207661_10016574 3300025944 Bacteria 5438
153 Ga0207661_11628249 3300025944 Bacteria 590
154 Ga0207667_10179726 3300025949 Bacteria 2173
155 Ga0207667_10257261 3300025949 Bacteria 1786
156 Ga0207639_10066593 3300026041 Bacteria 2800
157 Ga0207639_10706336 3300026041 Bacteria 936
158 Ga0207639_12283851 3300026041 Bacteria 502
159 Ga0207678_10705811 3300026067 Bacteria 888
160 Ga0207702_10239936 3300026078 Bacteria 1698
161 Ga0207674_10224747 3300026116 Bacteria 1826
162 Ga0207698_10181001 3300026142 Bacteria 1867
163 Ga0265325_10161409 3300031241 Bacteria 1054
164 Ga0265340_10030670 3300031247 Bacteria 2694
165 Ga0265331_10312126 3300031250 Bacteria 704
166 Ga0307508_10000045 3300031616 Bacteria 142824
167 Ga0265314_10011119 3300031711 Bacteria 7459
168 Ga0265314_10344251 3300031711 Bacteria 822
169 Ga0307415_100422993 3300032126 Bacteria 1144
170 Ga0373926_0391390 3300035083 Bacteria 548
171 Ga0373944_0047032 3300035089 Bacteria 1351
172 Ga0373923_0436178 3300035111 Unclassified 634
173 Ga0373923_0440888 3300035111 Bacteria 630
174 Ga0373936_0021542 3300035113 Bacteria 2507
175 Ga0373936_0138162 3300035113 Bacteria 1051
176 Ga0373941_0146119 3300035115 Bacteria 864
177 Ga0373945_0006256 3300035116 Bacteria 3834
178 Ga0373954_0058534 3300035118 Bacteria 1815
179 Ga0373954_0432264 3300035118 Bacteria 651
180 Ga0373956_0204028 3300035119 Bacteria 937
181 Ga0373956_0332930 3300035119 Bacteria 723
182 Ga0373960_0278016 3300035121 Bacteria 616
183 Ga0373943_0004587 3300035170 Bacteria 6242
184 Ga0373946_0001716 3300035171 Bacteria 7640
185 Ga0373946_0310674 3300035171 Bacteria 781
186 Ga0373955_0022637 3300035172 Bacteria 3190
187 Ga0373955_0907582 3300035172 Bacteria 542
188 Ga0373924_0033706 3300035410 Bacteria 2069
189 Ga0373931_0467376 3300035691 Bacteria 809
190 Ga0373931_0524392 3300035691 Bacteria 767
191 Ga0373935_0001683 3300035692 Bacteria 12361
192 Ga0373935_0685980 3300035692 Bacteria 753
193 Ga0373927_0001064 3300035695 Bacteria 20972
194 Ga0373927_0316572 3300035695 Bacteria 1027
195 Ga0373927_0939914 3300035695 Bacteria 570
196 Ga0373933_0087503 3300035724 Bacteria 1919
197 Ga0373933_0341983 3300035724 Bacteria 971
198 Ga0373933_0437924 3300035724 Bacteria 854
199 Ga0373947_0002167 3300035725 Bacteria 11925
200 Ga0373947_0064946 3300035725 Bacteria 2226
201 Ga0373947_0364115 3300035725 Bacteria 971
202 Ga0373937_0126446 3300036401 Bacteria 2385
203 Ga0373937_0402609 3300036401 Bacteria 1299
204 Ga0373937_0908489 3300036401 Bacteria 829
205 Ga0373937_0953564 3300036401 Bacteria 807
206 Ga0373925_0004723 3300037068 Bacteria 10276
207 Ga0373925_0197937 3300037068 Bacteria 1597
208 Ga0373925_0341694 3300037068 Bacteria 1214
209 Ga0373925_0984320 3300037068 Bacteria 695
210 Ga0395899_0064877 3300037312 Bacteria 2684
211 Ga0395900_0015450 3300037418 Bacteria 7783
212 Ga0395898_0182405 3300037466 Bacteria 2006
213 Ga0395905_0977682 3300037471 Bacteria 749
214 Ga0436364_0195053 3300037853 Bacteria 995
215 Ga0436364_0976416 3300037853 Bacteria 7958
216 Ga0395901_0128913 3300038443 Bacteria 2659
217 Ga0395901_0474568 3300038443 Bacteria 1277
218 Ga0395901_0874549 3300038443 Bacteria 882
219 Ga0436365_0464973 3300039437 Bacteria 1293
220 Ga0436365_0880454 3300039437 Bacteria 3346
221 Ga0436365_1109567 3300039437 Bacteria 1395
222 Ga0436365_1326155 3300039437 Bacteria 6909
223 Ga0436360_0755583 3300039438 Bacteria 768
224 Ga0436361_0430718 3300039447 Bacteria 3841
225 Ga0436363_0070046 3300039450 Bacteria 1049
226 Ga0436363_1320543 3300039450 Bacteria 887
227 Ga0436362_0767248 3300039453 Bacteria 1163
228 Ga0451804_0797213 3300041463 Bacteria 1200
229 Ga0451807_1340129 3300041486 Bacteria 694
230 Ga0466963_0558320 3300044694 Bacteria 809
231 Ga0466963_1142487 3300044694 Bacteria 548
232 Ga0466964_0308774 3300044706 Bacteria 800
233 Ga0466968_0062879 3300044735 Bacteria 1604
234 Ga0466957_0539834 3300044842 Bacteria 812
235 Ga0466959_0040063 3300045049 Bacteria 3461
236 Ga0466958_0054521 3300045836 Bacteria 2425
237 Ga0466958_0436631 3300045836 Bacteria 847
238 Ga0466967_0052224 3300045976 Bacteria 3587
239 Ga0466967_0168601 3300045976 Bacteria 2058
240 Ga0495592_0012829 3300046454 Bacteria 6371
241 Ga0495603_0005523 3300046455 Bacteria 7543
242 Ga0495603_0022697 3300046455 Bacteria 3797
243 Ga0495629_0003619 3300046459 Bacteria 11680
244 Ga0495641_0002985 3300046461 Bacteria 12986
245 Ga0495641_0190467 3300046461 Bacteria 919
246 Ga0495651_0430723 3300046462 Bacteria 856
247 Ga0495580_0001546 3300046472 Bacteria 20242
248 Ga0495582_0000535 3300046473 Bacteria 20995
249 Ga0495582_0503167 3300046473 Bacteria 700
250 Ga0495639_0001501 3300046475 Bacteria 10399
251 Ga0495662_0000510 3300046476 Bacteria 17683
252 Ga0495664_0579364 3300046477 Bacteria 668
253 Ga0495594_0000467 3300046499 Bacteria 20554
254 Ga0495628_0374014 3300046516 Bacteria 1044
255 Ga0495630_0009913 3300046517 Bacteria 6861
256 Ga0495648_0002812 3300046524 Bacteria 15664
257 Ga0495666_0008155 3300046526 Bacteria 5252
258 Ga0495652_0075106 3300046529 Bacteria 2809
259 Ga0495665_0000128 3300046531 Bacteria 36043
260 Ga0495640_0007295 3300046533 Bacteria 8711
261 Ga0495645_0018010 3300046543 Bacteria 5068
262 Ga0495622_0002649 3300046557 Bacteria 8603
263 Ga0495667_0122957 3300046559 Bacteria 1675
264 Ga0495668_0381904 3300046616 Bacteria 774
265 Ga0495668_0650044 3300046616 Bacteria 583
266 Ga0495634_0004246 3300046642 Bacteria 11306
267 Ga0495625_0243445 3300046660 Bacteria 1170
268 Ga0495635_0000564 3300046663 Bacteria 23651
269 Ga0495635_0324058 3300046663 Bacteria 1031
270 Ga0495588_0123118 3300046674 Bacteria 1367
271 Ga0495657_0254963 3300046675 Bacteria 1055
272 Ga0495599_0206619 3300046678 Bacteria 1205
273 Ga0495646_0131973 3300046680 Bacteria 1405
274 Ga0495647_0000600 3300046681 Bacteria 10656
275 Ga0495658_0001083 3300046683 Bacteria 14340
276 Ga0495613_0005438 3300046689 Bacteria 9568
277 Ga0495624_0005136 3300046690 Bacteria 9454
278 Ga0495581_0003213 3300047315 Bacteria 9361
279 Ga0495674_0010035 3300047319 Bacteria 8975
280 Ga0495674_0266384 3300047319 Bacteria 1407
281 Ga0495674_0809130 3300047319 Bacteria 728
282 Ga0495676_0007949 3300047321 Bacteria 9724
283 Ga0495680_0153823 3300047322 Bacteria 1675
284 Ga0495684_0008298 3300047471 Bacteria 8046
285 Ga0495684_0214960 3300047471 Bacteria 1412
286 Ga0495593_0003034 3300047673 Bacteria 10117
287 Ga0495614_0110911 3300048089 Bacteria 1204
288 Ga0496101_0061673 3300048904 Bacteria 2724
289 Ga0496103_0541049 3300048906 Bacteria 744
290 Ga0496104_0356378 3300048907 Bacteria 1375
291 Ga0496105_0170174 3300048908 Bacteria 1786
292 Ga0496106_0089041 3300048909 Bacteria 2380
293 Ga0496107_0498619 3300048910 Bacteria 903
294 Ga0496108_0176906 3300048911 Bacteria 1847
295 Ga0496108_1219088 3300048911 Bacteria 636
296 Ga0496110_0034064 3300048913 Bacteria 4409
297 Ga0496110_1226819 3300048913 Bacteria 659
298 Ga0496111_0011315 3300048914 Bacteria 6006
299 Ga0496112_0143302 3300048915 Bacteria 2358
300 Ga0496112_0244952 3300048915 Bacteria 1745
301 Ga0496112_0449530 3300048915 Bacteria 1226
302 Ga0496112_1706503 3300048915 Bacteria 542
303 Ga0496113_0602777 3300048916 Bacteria 879
304 Ga0496114_0285764 3300048917 Bacteria 1455
305 Ga0496115_0200585 3300048918 Bacteria 1648
306 Ga0496115_0940592 3300048918 Bacteria 664
307 Ga0496126_0009942 3300048929 Bacteria 10046
308 Ga0496126_0145632 3300048929 Bacteria 2034
309 Ga0496126_0633106 3300048929 Bacteria 839
310 Ga0501031_0021525 3300049568 Bacteria 4203
311 Ga0501031_0117224 3300049568 Bacteria 1740
312 Ga0501031_0126322 3300049568 Bacteria 1671
313 Ga0501032_0151855 3300049569 Bacteria 1522
314 Ga0501032_0221447 3300049569 Bacteria 1231
315 Ga0501032_0279218 3300049569 Bacteria 1081
316 Ga0501033_0111163 3300049570 Bacteria 1994
317 Ga0501033_1121996 3300049570 Bacteria 522
318 Ga0501034_0031861 3300049571 Bacteria 5355
319 Ga0501034_0137550 3300049571 Bacteria 2423
320 Ga0501034_0177067 3300049571 Bacteria 2098
321 Ga0501034_0516700 3300049571 Bacteria 1106
322 Ga0501034_0582820 3300049571 Bacteria 1025
323 Ga0501036_0268637 3300049572 Bacteria 1428
324 Ga0501036_0289543 3300049572 Bacteria 1370
325 Ga0501037_0057209 3300049573 Bacteria 2847
326 Ga0501037_0080378 3300049573 Bacteria 2365
327 Ga0501037_0084364 3300049573 Bacteria 2300
328 Ga0501037_0231414 3300049573 Bacteria 1297
329 Ga0501037_0381638 3300049573 Bacteria 968
330 Ga0501038_0010520 3300049574 Bacteria 8462
331 Ga0501038_0015906 3300049574 Bacteria 6835
332 Ga0501038_0064524 3300049574 Bacteria 3122
333 Ga0501038_0169805 3300049574 Bacteria 1766
334 Ga0501039_0072368 3300049575 Bacteria 2678
335 Ga0501039_0218220 3300049575 Bacteria 1499
336 Ga0501039_0701091 3300049575 Bacteria 791
337 Ga0501041_0282006 3300049577 Bacteria 1046
338 Ga0501042_0061263 3300049578 Bacteria 2688
339 Ga0501043_0008468 3300049579 Bacteria 8095
340 Ga0501043_0086548 3300049579 Bacteria 2462
341 Ga0501043_0107553 3300049579 Bacteria 2190
342 Ga0501046_0114028 3300049580 Bacteria 2062
343 Ga0501046_1063369 3300049580 Bacteria 560
344 Ga0501047_0025713 3300049581 Bacteria 5661
345 Ga0501047_0129752 3300049581 Bacteria 2401
346 Ga0501047_0384099 3300049581 Bacteria 1238
347 Ga0501047_0896727 3300049581 Bacteria 700
348 Ga0501048_0043030 3300049582 Bacteria 3232
349 Ga0501067_0008550 3300049583 Bacteria 5678
350 Ga0501068_0089059 3300049584 Bacteria 1902
351 Ga0501068_0116180 3300049584 Bacteria 1666
352 Ga0501069_0124537 3300049585 Bacteria 1473
353 Ga0501070_0052323 3300049586 Bacteria 3389
354 Ga0501070_1005395 3300049586 Bacteria 646
355 Ga0501072_0336080 3300049588 Bacteria 1200
356 Ga0501073_0081770 3300049589 Bacteria 2247
357 Ga0501074_0064851 3300049590 Bacteria 2629
358 Ga0501076_1553280 3300049592 Bacteria 543
359 Ga0501079_0110449 3300049741 Bacteria 2136
360 Ga0501079_0429274 3300049741 Bacteria 1037
361 Ga0501080_0082618 3300049742 Bacteria 2983
362 Ga0501080_0144588 3300049742 Bacteria 2198
363 Ga0501080_0561338 3300049742 Bacteria 1016
364 Ga0501083_0059161 3300049744 Bacteria 2563
365 Ga0501035_0220246 3300049822 Bacteria 1620
366 Ga0501035_0624698 3300049822 Bacteria 876
367 Ga0501035_1025921 3300049822 Bacteria 647
368 Ga0501044_0066455 3300049823 Bacteria 3676
369 Ga0501044_0277683 3300049823 Bacteria 1610
370 Ga0501044_0516391 3300049823 Bacteria 1094
371 Ga0501044_1063228 3300049823 Bacteria 679
372 Ga0501045_0010340 3300049824 Bacteria 6535
373 Ga0501045_0490578 3300049824 Bacteria 912
374 Ga0501045_0520059 3300049824 Bacteria 883
375 nmdc:mga0yw44_208622_c1 3300050492 Bacteria 1292
376 nmdc:mga06z11_323428_c1 3300050494 Bacteria 920
377 nmdc:mga0qj67_695362_c1 3300050509 Bacteria 809
378 nmdc:mga0n895_673664_c1 3300050512 Bacteria 1032
379 nmdc:mga0a205_202430_c1 3300050515 Bacteria 1875
380 Ga0495601_0536192 3300053077 Bacteria 754
381 Ga0495601_0700235 3300053077 Bacteria 646
382 Ga0495612_0019395 3300053078 Bacteria 2723
383 Ga0495595_0083267 3300053084 Bacteria 1527
384 Ga0495619_0054954 3300053085 Bacteria 2636
385 Ga0495619_0473324 3300053085 Bacteria 863
386 Ga0500646_0164582 3300053090 Bacteria 742
387 Ga0500616_0000244 3300053153 Bacteria 85079
388 Ga0501084_0028201 3300054114 Bacteria 4691
389 Ga0501082_0010641 3300060353 Bacteria 7919
390 Ga0466962_0014122 3300061719 Bacteria 3848
391 Ga0530510_0238648 3300061734 Bacteria 1353
392 Ga0530510_1275620 3300061734 Bacteria 563
393 2509152139 2508501128 Bacteria 8613869
394 2728748473 2728368998 Bacteria 8720350
395 2874621244 2874620515 Bacteria 8290088
396 2904667789 2904666416 Bacteria 8226587
397 2904708454
398 Ga0436365_1714545
399 Ga0065715_10337500
400 Ga0070683_100088547
401 Ga0070690_100155519
402 Ga0070666_10402957
403 Ga0070680_100055433
404 Ga0070680_100148851
405 Ga0070660_100001075
406 Ga0070691_10072232
407 Ga0070673_100239824
408 Ga0070659_100344428
409 Ga0070667_101234969
410 Ga0070709_10017595
411 Ga0070709_10144054
412 Ga0070709_10203754
413 Ga0070709_10542341
414 Ga0070714_100518272
415 Ga0070713_100165932
416 Ga0070713_100567484
417 Ga0070713_100585756
418 Ga0070710_10027648
419 Ga0070711_100014987
420 Ga0070711_100113483
421 Ga0070711_101077481
422 Ga0070663_100661453
423 Ga0070663_101214955
424 Ga0070681_10022117
425 Ga0070681_10089400
426 Ga0070681_10152711
427 Ga0070681_10807047
428 Ga0070706_100342554
429 Ga0070706_100354445
430 Ga0070679_100078787
431 Ga0070679_100102846
432 Ga0070679_100358582
433 Ga0070679_100399898
434 Ga0070679_101250481
435 Ga0070679_101706074
436 Ga0070684_100011685
437 Ga0070684_100071164
438 Ga0070684_100233727
439 Ga0070697_100013361
440 Ga0068853_100144171
441 Ga0068853_100499285
442 Ga0068853_100643275
443 Ga0068853_101939161
444 Ga0068855_100867525
445 Ga0068857_100185143
446 Ga0068856_100071502
447 Ga0068856_102020361
448 Ga0068852_100082459
449 Ga0068866_10255831
450 Ga0068866_10819986
451 Ga0068851_10068621
452 Ga0070717_10144411
453 Ga0070717_11804418
454 Ga0075365_10166786
455 Ga0070716_100058614
456 Ga0070716_100522671
457 Ga0070716_100536575
458 Ga0070716_101170655
459 Ga0070712_100126263
460 Ga0075367_10578027
461 Ga0075366_10378188
462 Ga0075370_10249158
463 Ga0075434_100281059
464 Ga0075436_100141370
465 Ga0075435_102023350
466 Ga0099794_10216977
467 Ga0099794_10435382
468 Ga0099795_10016564
469 Ga0105240_10018930
470 Ga0105240_10070025
471 Ga0105240_10146885
472 Ga0105240_10155770
473 Ga0105240_10567994
474 Ga0105240_11563877
475 Ga0105247_10119594
476 Ga0105243_10347988
477 Ga0105242_12166026
478 Ga0105237_10162525
479 Ga0105237_11042192
480 Ga0105238_10005612
481 Ga0105238_10115156
482 Ga0105238_10409258
483 Ga0105238_10915105
484 Ga0099796_10022250
485 Ga0105239_10089616
486 Ga0105239_11598174
487 Ga0105239_12889761
488 Ga0157373_10061669
489 Ga0157370_10070601
490 Ga0157370_10461766
491 Ga0157370_10526208
492 Ga0157370_10548597
493 Ga0157369_10110009
494 Ga0157369_10116396
495 Ga0157369_10978385
496 Ga0157369_11877535
497 Ga0157378_11352173
498 Ga0163162_11224813
499 Ga0157372_10513669
500 Ga0157372_10575051
501 Ga0157372_10660876
502 Ga0157372_10839212
503 Ga0157372_10961372
504 Ga0157372_11110781
505 Ga0163163_11063437
506 Ga0182008_10369063
507 Ga0157379_11098313
508 Ga0157379_11561513
509 Ga0213872_10025106
510 Ga0213874_10292273
511 Ga0213876_10112359
512 Ga0213876_10168192
513 Ga0213876_10214947
514 Ga0213875_10012827
515 Ga0207656_10039857
516 Ga0207692_10079109
517 Ga0207692_10154056
518 Ga0207699_10006629
519 Ga0207699_10168399
520 Ga0207705_10339460
521 Ga0207684_11152878
522 Ga0207707_10004159
523 Ga0207707_10067456
524 Ga0207707_10074311
525 Ga0207707_10123192
526 Ga0207695_10033885
527 Ga0207695_10106551
528 Ga0207695_10191988
529 Ga0207695_10331010
530 Ga0207671_10083329
531 Ga0207693_10101159
532 Ga0207693_10126715
533 Ga0207693_11075283
534 Ga0207663_10006822
535 Ga0207660_10050092
536 Ga0207660_10128907
537 Ga0207657_10002658
538 Ga0207657_10003784
539 Ga0207649_10706355
540 Ga0207652_10229691
541 Ga0207652_10599600
542 Ga0207694_10094349
543 Ga0207694_10652523
544 Ga0207700_10876089
545 Ga0207700_10879664
546 Ga0207664_10363240
547 Ga0207665_10038518
548 Ga0207665_10107206
549 Ga0207661_10016574
550 Ga0207661_11628249
551 Ga0207667_10179726
552 Ga0207667_10257261
553 Ga0207639_10066593
554 Ga0207639_10706336
555 Ga0207639_12283851
556 Ga0207678_10705811
557 Ga0207702_10239936
558 Ga0207674_10224747
559 Ga0207698_10181001
560 Ga0265325_10161409
561 Ga0265340_10030670
562 Ga0265331_10312126
563 Ga0307508_10000045
564 Ga0265314_10011119
565 Ga0265314_10344251
566 Ga0307415_100422993
567 Ga0373926_0391390
568 Ga0373944_0047032
569 Ga0373923_0436178
570 Ga0373923_0440888
571 Ga0373936_0021542
572 Ga0373936_0138162
573 Ga0373941_0146119
574 Ga0373945_0006256
575 Ga0373954_0058534
576 Ga0373954_0432264
577 Ga0373956_0204028
578 Ga0373956_0332930
579 Ga0373960_0278016
580 Ga0373943_0004587
581 Ga0373946_0001716
582 Ga0373946_0310674
583 Ga0373955_0022637
584 Ga0373955_0907582
585 Ga0373924_0033706
586 Ga0373931_0467376
587 Ga0373931_0524392
588 Ga0373935_0001683
589 Ga0373935_0685980
590 Ga0373927_0001064
591 Ga0373927_0316572
592 Ga0373927_0939914
593 Ga0373933_0087503
594 Ga0373933_0341983
595 Ga0373933_0437924
596 Ga0373947_0002167
597 Ga0373947_0064946
598 Ga0373947_0364115
599 Ga0373937_0126446
600 Ga0373937_0402609
601 Ga0373937_0908489
602 Ga0373937_0953564
603 Ga0373925_0004723
604 Ga0373925_0197937
605 Ga0373925_0341694
606 Ga0373925_0984320
607 Ga0395899_0064877
608 Ga0395900_0015450
609 Ga0395898_0182405
610 Ga0395905_0977682
611 Ga0436364_0195053
612 Ga0436364_0976416
613 Ga0395901_0128913
614 Ga0395901_0474568
615 Ga0395901_0874549
616 Ga0436365_0464973
617 Ga0436365_0880454
618 Ga0436365_1109567
619 Ga0436365_1326155
620 Ga0436360_0755583
621 Ga0436361_0430718
622 Ga0436363_0070046
623 Ga0436363_1320543
624 Ga0436362_0767248
625 Ga0451804_0797213
626 Ga0451807_1340129
627 Ga0466963_0558320
628 Ga0466963_1142487
629 Ga0466964_0308774
630 Ga0466968_0062879
631 Ga0466957_0539834
632 Ga0466959_0040063
633 Ga0466958_0054521
634 Ga0466958_0436631
635 Ga0466967_0052224
636 Ga0466967_0168601
637 Ga0495592_0012829
638 Ga0495603_0005523
639 Ga0495603_0022697
640 Ga0495629_0003619
641 Ga0495641_0002985
642 Ga0495641_0190467
643 Ga0495651_0430723
644 Ga0495580_0001546
645 Ga0495582_0000535
646 Ga0495582_0503167
647 Ga0495639_0001501
648 Ga0495662_0000510
649 Ga0495664_0579364
650 Ga0495594_0000467
651 Ga0495628_0374014
652 Ga0495630_0009913
653 Ga0495648_0002812
654 Ga0495666_0008155
655 Ga0495652_0075106
656 Ga0495665_0000128
657 Ga0495640_0007295
658 Ga0495645_0018010
659 Ga0495622_0002649
660 Ga0495667_0122957
661 Ga0495668_0381904
662 Ga0495668_0650044
663 Ga0495634_0004246
664 Ga0495625_0243445
665 Ga0495635_0000564
666 Ga0495635_0324058
667 Ga0495588_0123118
668 Ga0495657_0254963
669 Ga0495599_0206619
670 Ga0495646_0131973
671 Ga0495647_0000600
672 Ga0495658_0001083
673 Ga0495613_0005438
674 Ga0495624_0005136
675 Ga0495581_0003213
676 Ga0495674_0010035
677 Ga0495674_0266384
678 Ga0495674_0809130
679 Ga0495676_0007949
680 Ga0495680_0153823
681 Ga0495684_0008298
682 Ga0495684_0214960
683 Ga0495593_0003034
684 Ga0495614_0110911
685 Ga0496101_0061673
686 Ga0496103_0541049
687 Ga0496104_0356378
688 Ga0496105_0170174
689 Ga0496106_0089041
690 Ga0496107_0498619
691 Ga0496108_0176906
692 Ga0496108_1219088
693 Ga0496110_0034064
694 Ga0496110_1226819
695 Ga0496111_0011315
696 Ga0496112_0143302
697 Ga0496112_0244952
698 Ga0496112_0449530
699 Ga0496112_1706503
700 Ga0496113_0602777
701 Ga0496114_0285764
702 Ga0496115_0200585
703 Ga0496115_0940592
704 Ga0496126_0009942
705 Ga0496126_0145632
706 Ga0496126_0633106
707 Ga0501031_0021525
708 Ga0501031_0117224
709 Ga0501031_0126322
710 Ga0501032_0151855
711 Ga0501032_0221447
712 Ga0501032_0279218
713 Ga0501033_0111163
714 Ga0501033_1121996
715 Ga0501034_0031861
716 Ga0501034_0137550
717 Ga0501034_0177067
718 Ga0501034_0516700
719 Ga0501034_0582820
720 Ga0501036_0268637
721 Ga0501036_0289543
722 Ga0501037_0057209
723 Ga0501037_0080378
724 Ga0501037_0084364
725 Ga0501037_0231414
726 Ga0501037_0381638
727 Ga0501038_0010520
728 Ga0501038_0015906
729 Ga0501038_0064524
730 Ga0501038_0169805
731 Ga0501039_0072368
732 Ga0501039_0218220
733 Ga0501039_0701091
734 Ga0501041_0282006
735 Ga0501042_0061263
736 Ga0501043_0008468
737 Ga0501043_0086548
738 Ga0501043_0107553
739 Ga0501046_0114028
740 Ga0501046_1063369
741 Ga0501047_0025713
742 Ga0501047_0129752
743 Ga0501047_0384099
744 Ga0501047_0896727
745 Ga0501048_0043030
746 Ga0501067_0008550
747 Ga0501068_0089059
748 Ga0501068_0116180
749 Ga0501069_0124537
750 Ga0501070_0052323
751 Ga0501070_1005395
752 Ga0501072_0336080
753 Ga0501073_0081770
754 Ga0501074_0064851
755 Ga0501076_1553280
756 Ga0501079_0110449
757 Ga0501079_0429274
758 Ga0501080_0082618
759 Ga0501080_0144588
760 Ga0501080_0561338
761 Ga0501083_0059161
762 Ga0501035_0220246
763 Ga0501035_0624698
764 Ga0501035_1025921
765 Ga0501044_0066455
766 Ga0501044_0277683
767 Ga0501044_0516391
768 Ga0501044_1063228
769 Ga0501045_0010340
770 Ga0501045_0490578
771 Ga0501045_0520059
772 nmdc:mga0yw44_208622_c1
773 nmdc:mga06z11_323428_c1
774 nmdc:mga0qj67_695362_c1
775 nmdc:mga0n895_673664_c1
776 nmdc:mga0a205_202430_c1
777 Ga0495601_0536192
778 Ga0495601_0700235
779 Ga0495612_0019395
780 Ga0495595_0083267
781 Ga0495619_0054954
782 Ga0495619_0473324
783 Ga0500646_0164582
784 Ga0500616_0000244
785 Ga0501084_0028201
786 Ga0501082_0010641
787 Ga0466962_0014122
788 Ga0530510_0238648
789 Ga0530510_1275620
790 2509152139
791 2728748473
792 2874621244
793 2904667789
794 2904708454

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06262

Zincin_1

Zincin-like metallopeptidase

43

142

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e11-assembly2.cif.gz_B crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution 0.7287 20 137
1xm5-assembly1.cif.gz_A crystal structure of metal-dependent hydrolase ybey from e. coli, pfam upf0054 0.683 25 142
3e11-assembly2.cif.gz_B crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution 0.6779 20 137
2ejq-assembly1.cif.gz_A conserved hypothetical protein (ttha0227) from thermo thermophilus hb8 0.6572 20 128
2ejq-assembly1.cif.gz_A conserved hypothetical protein (ttha0227) from thermo thermophilus hb8 0.6173 20 128
ID Description Score Start End Superfamily
3e11B00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.7224 20 137 3.30.2010.20
3e11B00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.6768 20 137 3.30.2010.20
2ejqA00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.6572 20 128 3.30.2010.20
af_Q9SS48_494_621_1.10.8.870 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Alpha-glycerophosphate oxidase, cap domain 0.6462 98 142 1.10.8.870
af_P9WGX9_1_163_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.6424 25 142 3.40.390.30
ID Description Score Start End GO Terms
AF-A0A1M3CN13-F1-model_v4 Zn-dependent protease 0.981 18 142 GO:0006508
GO:0008233
AF-A0A833LHK3-F1-model_v4 Zn-dependent protease 0.9641 28 143 GO:0006508
GO:0008233
AF-A0A2S7K476-F1-model_v4 Neutral zinc metallopeptidase 0.9591 16 143
AF-A0A6P1YJT6-F1-model_v4 Metallopeptidase family protein 0.9568 13 142
AF-A0A101K1W0-F1-model_v4 Zn-dependent protease 0.9542 24 143 GO:0006508
GO:0008233

Map