F433805

General Info

Members Datasets Scaffolds Average Seq Length
397 264 388 112

Family's Representative Sequence

Representative Sequence 3300031711|Ga0265314_10005122|Ga0265314_1000512212
Length 129
Sequence MASKSGTSQRGHDDLSGASMNKMRTAKYTIGQVVKHRLFSFRGVIFDIDPEFDNTDEWYEAIPAEVRPRKDQPFYHLFAENADTEYVAYVSEQNLLPDTSDKPVRHPQVAEVFVRDRKGGYKPRNNQLN

Samples

Sample ID Description Type Environment
1 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
2 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
3 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
4 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
5 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
6 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
7 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
8 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
9 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
104 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
147 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
148 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
161 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
162 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
167 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
168 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
177 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
178 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
179 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
180 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
183 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
193 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
194 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
219 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
237 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
251 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
252 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
253 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
254 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
255 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
256 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
257 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
258 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
259 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
260 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
264 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.73
Metatranscriptomes 0
Isolates 2.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.05
Nodule 0.25
Rhizoplane 4.53
Rhizosphere 87.41
Stem 0
Stem Tuber 0
Unclassified 1.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10009376 3300003911 Bacteria 1848
2 Ga0070690_100448413 3300005330 Bacteria 956
3 Ga0068869_100037141 3300005334 Bacteria 3463
4 Ga0068869_100499810 3300005334 Bacteria 1015
5 Ga0070680_100190149 3300005336 Bacteria 1730
6 Ga0070682_100006521 3300005337 Bacteria 6549
7 Ga0070660_100019880 3300005339 Bacteria 4926
8 Ga0070689_101843435 3300005340 Bacteria 552
9 Ga0070691_10007196 3300005341 Bacteria 5096
10 Ga0070691_10077528 3300005341 Bacteria 1622
11 Ga0070691_10694782 3300005341 Bacteria 610
12 Ga0070687_100960188 3300005343 Bacteria 617
13 Ga0070692_10173030 3300005345 Bacteria 1246
14 Ga0070668_100517475 3300005347 Bacteria 1035
15 Ga0070668_101661818 3300005347 Bacteria 586
16 Ga0070673_100052909 3300005364 Bacteria 3187
17 Ga0070673_100724050 3300005364 Bacteria 915
18 Ga0070659_100035177 3300005366 Bacteria 3900
19 Ga0070703_10019196 3300005406 Bacteria 1982
20 Ga0070709_10681802 3300005434 Bacteria 798
21 Ga0070714_100633025 3300005435 Bacteria 1029
22 Ga0070710_11093856 3300005437 Bacteria 585
23 Ga0070701_10706261 3300005438 Bacteria 679
24 Ga0070711_100317869 3300005439 Bacteria 1243
25 Ga0070705_100002824 3300005440 Bacteria 8659
26 Ga0070705_100036473 3300005440 Bacteria 2765
27 Ga0070705_100251292 3300005440 Bacteria 1241
28 Ga0070700_100005113 3300005441 Bacteria 6922
29 Ga0070700_100087643 3300005441 Bacteria 2024
30 Ga0070694_100001395 3300005444 Bacteria 14118
31 Ga0070694_100034848 3300005444 Bacteria 3323
32 Ga0070708_100030598 3300005445 Bacteria 4654
33 Ga0070663_100135054 3300005455 Bacteria 1877
34 Ga0070663_100407678 3300005455 Bacteria 1112
35 Ga0070678_100841897 3300005456 Bacteria 835
36 Ga0070662_100714910 3300005457 Bacteria 848
37 Ga0070662_101682807 3300005457 Bacteria 548
38 Ga0070681_10050829 3300005458 Bacteria 4135
39 Ga0070681_10084993 3300005458 Bacteria 3117
40 Ga0068867_101131369 3300005459 Bacteria 716
41 Ga0070707_100669273 3300005468 Bacteria 1001
42 Ga0070698_100937241 3300005471 Bacteria 812
43 Ga0070699_100000903 3300005518 Bacteria 27717
44 Ga0070699_100001464 3300005518 Bacteria 21616
45 Ga0070679_100068033 3300005530 Bacteria 3553
46 Ga0068853_101174949 3300005539 Bacteria 741
47 Ga0068853_101631435 3300005539 Bacteria 625
48 Ga0070672_100098801 3300005543 Bacteria 2364
49 Ga0070686_100406900 3300005544 Bacteria 1036
50 Ga0070686_100899565 3300005544 Bacteria 720
51 Ga0070686_101772743 3300005544 Bacteria 525
52 Ga0070695_100000639 3300005545 Bacteria 18577
53 Ga0070695_100011521 3300005545 Bacteria 5288
54 Ga0070696_100002167 3300005546 Bacteria 12942
55 Ga0070696_100006694 3300005546 Bacteria 7700
56 Ga0070693_100060141 3300005547 Bacteria 2205
57 Ga0070665_100587256 3300005548 Bacteria 1127
58 Ga0070704_100001558 3300005549 Bacteria 12363
59 Ga0070704_100135482 3300005549 Bacteria 1915
60 Ga0070664_100112560 3300005564 Bacteria 2377
61 Ga0068856_102202813 3300005614 Bacteria 560
62 Ga0070702_100046729 3300005615 Bacteria 2455
63 Ga0070702_100074178 3300005615 Bacteria 2018
64 Ga0068864_102466942 3300005618 Bacteria 526
65 Ga0068866_10743504 3300005718 Bacteria 677
66 Ga0068861_100227118 3300005719 Bacteria 1581
67 Ga0068851_10954985 3300005834 Bacteria 539
68 Ga0068870_11089434 3300005840 Bacteria 574
69 Ga0068858_100175782 3300005842 Bacteria 2020
70 Ga0068860_101212044 3300005843 Bacteria 775
71 Ga0068862_100001758 3300005844 Bacteria 19587
72 Ga0068862_100799326 3300005844 Bacteria 921
73 Ga0081455_10011971 3300005937 Bacteria 8683
74 Ga0081540_1015934 3300005983 Bacteria 4736
75 Ga0075363_100855160 3300006048 Bacteria 555
76 Ga0075364_10208508 3300006051 Bacteria 1325
77 Ga0075364_10485452 3300006051 Bacteria 845
78 Ga0075364_10717784 3300006051 Bacteria 682
79 Ga0075432_10033056 3300006058 Bacteria 1793
80 Ga0075367_10697155 3300006178 Bacteria 646
81 Ga0075427_10010950 3300006194 Bacteria 1363
82 Ga0075366_10909684 3300006195 Bacteria 548
83 Ga0097621_100188337 3300006237 Bacteria 1786
84 Ga0075370_10325490 3300006353 Bacteria 916
85 Ga0068871_100130541 3300006358 Bacteria 2130
86 Ga0068871_100635864 3300006358 Bacteria 973
87 Ga0075428_100017835 3300006844 Bacteria 7844
88 Ga0075428_100030168 3300006844 Bacteria 5998
89 Ga0075430_100004696 3300006846 Bacteria 11490
90 Ga0075430_100064231 3300006846 Bacteria 3084
91 Ga0075431_100006639 3300006847 Bacteria 11490
92 Ga0075433_10001599 3300006852 Bacteria 16784
93 Ga0075434_100000576 3300006871 Bacteria 28251
94 Ga0075434_100943061 3300006871 Bacteria 877
95 Ga0075429_100050787 3300006880 Bacteria 3608
96 Ga0075436_100469752 3300006914 Bacteria 918
97 Ga0075435_100156307 3300007076 Bacteria 1919
98 Ga0105250_10205428 3300009092 Bacteria 832
99 Ga0105240_11570974 3300009093 Bacteria 689
100 Ga0111539_10000503 3300009094 Bacteria 49808
101 Ga0111539_10038117 3300009094 Bacteria 5799
102 Ga0105245_10024222 3300009098 Bacteria 5329
103 Ga0105245_10083234 3300009098 Bacteria 2929
104 Ga0105245_10559277 3300009098 Bacteria 1166
105 Ga0114129_10013874 3300009147 Bacteria 11481
106 Ga0114129_10029505 3300009147 Bacteria 7770
107 Ga0114129_10330763 3300009147 Bacteria 2023
108 Ga0114129_10716327 3300009147 Bacteria 1284
109 Ga0105243_10027825 3300009148 Bacteria 4336
110 Ga0105243_10130121 3300009148 Bacteria 2134
111 Ga0105243_11118624 3300009148 Bacteria 797
112 Ga0105241_10004682 3300009174 Bacteria 10103
113 Ga0105242_10876113 3300009176 Bacteria 896
114 Ga0105248_10019008 3300009177 Bacteria 7597
115 Ga0105237_10083294 3300009545 Bacteria 3190
116 Ga0105237_10105963 3300009545 Bacteria 2803
117 Ga0105238_10058399 3300009551 Bacteria 3867
118 Ga0105249_10001768 3300009553 Bacteria 18827
119 Ga0105239_10391703 3300010375 Bacteria 1572
120 Ga0105246_10084012 3300011119 Bacteria 2276
121 Ga0105246_10194096 3300011119 Bacteria 1574
122 Ga0105246_10313229 3300011119 Bacteria 1272
123 Ga0105246_10720271 3300011119 Bacteria 877
124 Ga0157373_10406496 3300013100 Bacteria 976
125 Ga0157370_10303577 3300013104 Bacteria 1473
126 Ga0157370_10331096 3300013104 Bacteria 1404
127 Ga0157369_10423552 3300013105 Bacteria 1380
128 Ga0157374_10674612 3300013296 Bacteria 1046
129 Ga0157374_11100660 3300013296 Bacteria 815
130 Ga0157378_10041471 3300013297 Bacteria 4083
131 Ga0157378_10402037 3300013297 Bacteria 1350
132 Ga0157378_10628199 3300013297 Bacteria 1088
133 Ga0163162_10096507 3300013306 Bacteria 3044
134 Ga0157375_10045104 3300013308 Bacteria 4290
135 Ga0157375_10308379 3300013308 Bacteria 1747
136 Ga0157380_10063356 3300014326 Bacteria 2964
137 Ga0157380_10610437 3300014326 Bacteria 1081
138 Ga0157380_10853078 3300014326 Bacteria 933
139 Ga0157376_10142775 3300014969 Bacteria 2150
140 Ga0157376_10350002 3300014969 Bacteria 1414
141 Ga0163161_11184326 3300017792 Bacteria 660
142 Ga0213873_10177064 3300021358 Bacteria 653
143 Ga0224572_1098376 3300024225 Bacteria 540
144 Ga0207682_10082211 3300025893 Bacteria 1383
145 Ga0207642_10708092 3300025899 Bacteria 635
146 Ga0207688_10053711 3300025901 Bacteria 2260
147 Ga0207647_10149075 3300025904 Bacteria 1368
148 Ga0207707_10082985 3300025912 Bacteria 2798
149 Ga0207671_10608623 3300025914 Bacteria 871
150 Ga0207663_10047280 3300025916 Bacteria 2656
151 Ga0207657_10204636 3300025919 Bacteria 1586
152 Ga0207652_10329877 3300025921 Bacteria 1378
153 Ga0207650_10465239 3300025925 Bacteria 1054
154 Ga0207659_11674738 3300025926 Bacteria 542
155 Ga0207687_10020034 3300025927 Bacteria 4435
156 Ga0207700_10368164 3300025928 Bacteria 1254
157 Ga0207664_10264901 3300025929 Bacteria 1504
158 Ga0207644_10638547 3300025931 Bacteria 886
159 Ga0207690_10006521 3300025932 Bacteria 6918
160 Ga0207706_10809845 3300025933 Bacteria 795
161 Ga0207706_11175361 3300025933 Bacteria 638
162 Ga0207686_10458074 3300025934 Bacteria 982
163 Ga0207709_10074251 3300025935 Bacteria 2169
164 Ga0207709_10613326 3300025935 Bacteria 863
165 Ga0207669_10051532 3300025937 Bacteria 2466
166 Ga0207691_10089680 3300025940 Bacteria 2757
167 Ga0207679_10109375 3300025945 Bacteria 2178
168 Ga0207651_10164009 3300025960 Bacteria 1745
169 Ga0207651_10249516 3300025960 Bacteria 1451
170 Ga0207703_10034453 3300026035 Bacteria 4017
171 Ga0207639_11314480 3300026041 Bacteria 679
172 Ga0207678_10000594 3300026067 Bacteria 33147
173 Ga0207708_10003552 3300026075 Bacteria 11490
174 Ga0207708_10079749 3300026075 Bacteria 2515
175 Ga0207702_12060726 3300026078 Bacteria 561
176 Ga0207648_10025772 3300026089 Bacteria 5233
177 Ga0207676_10273487 3300026095 Bacteria 1531
178 Ga0207674_10055194 3300026116 Bacteria 4040
179 Ga0207675_100224019 3300026118 Bacteria 1813
180 Ga0207675_100293685 3300026118 Bacteria 1581
181 Ga0207675_101367119 3300026118 Bacteria 729
182 Ga0207683_10046174 3300026121 Bacteria 3811
183 Ga0207683_10775419 3300026121 Bacteria 890
184 Ga0207428_10000114 3300027907 Bacteria 109533
185 Ga0268266_10655384 3300028379 Bacteria 1010
186 Ga0268265_11433103 3300028380 Bacteria 693
187 Ga0268264_12412806 3300028381 Bacteria 532
188 Ga0265338_10695220 3300028800 Bacteria 702
189 Ga0265332_10001014 3300031238 Bacteria 16568
190 Ga0265332_10138971 3300031238 Bacteria 1018
191 Ga0265320_10089323 3300031240 Bacteria 1429
192 Ga0265325_10010969 3300031241 Bacteria 5220
193 Ga0265325_10033971 3300031241 Bacteria 2717
194 Ga0265329_10054249 3300031242 Bacteria 1273
195 Ga0265340_10003609 3300031247 Bacteria 8704
196 Ga0265340_10027937 3300031247 Bacteria 2841
197 Ga0265340_10033530 3300031247 Bacteria 2556
198 Ga0265339_10014704 3300031249 Bacteria 4712
199 Ga0265339_10125258 3300031249 Bacteria 1317
200 Ga0265331_10051074 3300031250 Bacteria 1980
201 Ga0265316_10486219 3300031344 Bacteria 883
202 Ga0265316_10623666 3300031344 Bacteria 763
203 Ga0265316_10732662 3300031344 Bacteria 696
204 Ga0265316_10740473 3300031344 Bacteria 691
205 Ga0307408_101949216 3300031548 Bacteria 564
206 Ga0265313_10032083 3300031595 Bacteria 2686
207 Ga0265313_10138679 3300031595 Bacteria 1047
208 Ga0316579_10070170 3300031691 Bacteria 1659
209 Ga0265314_10005122 3300031711 Bacteria 11925
210 Ga0265314_10026124 3300031711 Bacteria 4393
211 Ga0265314_10040963 3300031711 Bacteria 3320
212 Ga0265314_10081831 3300031711 Bacteria 2126
213 Ga0265342_10000035 3300031712 Bacteria 142886
214 Ga0265342_10006164 3300031712 Bacteria 8973
215 Ga0307410_10640260 3300031852 Bacteria 891
216 Ga0307406_10482265 3300031901 Bacteria 1002
217 Ga0307407_10311264 3300031903 Bacteria 1102
218 Ga0307409_100344799 3300031995 Bacteria 1403
219 Ga0373950_0072400 3300034818 Bacteria 708
220 Ga0373958_0062854 3300034819 Bacteria 808
221 Ga0373944_0389693 3300035089 Bacteria 535
222 Ga0373923_0442374 3300035111 Bacteria 629
223 Ga0373953_0099499 3300035117 Bacteria 1223
224 Ga0373954_0121000 3300035118 Bacteria 1271
225 Ga0373954_0384003 3300035118 Bacteria 694
226 Ga0373957_0057885 3300035120 Bacteria 1496
227 Ga0373942_0182155 3300035207 Bacteria 689
228 Ga0373924_0017358 3300035410 Bacteria 2760
229 Ga0373935_0714734 3300035692 Bacteria 737
230 Ga0373935_0766202 3300035692 Bacteria 712
231 Ga0373927_0008005 3300035695 Bacteria 7137
232 Ga0373933_0029801 3300035724 Bacteria 3157
233 Ga0373937_0041486 3300036401 Bacteria 4197
234 Ga0373937_0076549 3300036401 Bacteria 3090
235 Ga0373937_0587949 3300036401 Bacteria 1057
236 Ga0316582_0403639 3300036647 Bacteria 942
237 Ga0373925_0174194 3300037068 Bacteria 1700
238 Ga0436365_0247085 3300039437 Bacteria 737
239 Ga0436365_0660080 3300039437 Bacteria 522
240 Ga0436365_1482850 3300039437 Bacteria 3588
241 Ga0436361_1026286 3300039447 Bacteria 1071
242 Ga0439453_0002205 3300041408 Bacteria 2652
243 Ga0439441_167281 3300042001 Bacteria 524
244 Ga0439456_100937 3300042013 Bacteria 653
245 Ga0439440_0046805 3300042993 Bacteria 1070
246 Ga0495580_0672391 3300046472 Bacteria 679
247 Ga0495594_0216951 3300046499 Bacteria 1091
248 Ga0495663_0188772 3300046525 Bacteria 716
249 Ga0495652_0625260 3300046529 Bacteria 732
250 Ga0495667_0423756 3300046559 Bacteria 837
251 Ga0495657_0079980 3300046675 Bacteria 2116
252 Ga0495647_0262311 3300046681 Bacteria 771
253 Ga0495658_0030857 3300046683 Bacteria 2914
254 Ga0495581_0099987 3300047315 Bacteria 1685
255 Ga0495674_0439222 3300047319 Bacteria 1050
256 Ga0495675_0340529 3300047444 Bacteria 884
257 Ga0495675_0494615 3300047444 Bacteria 703
258 Ga0495677_0147190 3300047445 Bacteria 906
259 Ga0495685_192926 3300047447 Bacteria 654
260 Ga0495602_0888081 3300048088 Bacteria 594
261 Ga0496100_0335288 3300048903 Bacteria 1139
262 Ga0496101_0033073 3300048904 Bacteria 3645
263 Ga0496101_0124459 3300048904 Bacteria 1952
264 Ga0496102_0007185 3300048905 Bacteria 9508
265 Ga0496102_0046107 3300048905 Bacteria 3958
266 Ga0496103_0004391 3300048906 Bacteria 8556
267 Ga0496103_0008881 3300048906 Bacteria 5962
268 Ga0496104_0333369 3300048907 Bacteria 1430
269 Ga0496106_0000882 3300048909 Bacteria 21853
270 Ga0496106_0009124 3300048909 Bacteria 7329
271 Ga0496107_0070414 3300048910 Bacteria 2539
272 Ga0496107_0087972 3300048910 Bacteria 2268
273 Ga0496108_0613826 3300048911 Bacteria 947
274 Ga0496110_0721747 3300048913 Bacteria 899
275 Ga0496114_0341888 3300048917 Bacteria 1323
276 Ga0496114_1016005 3300048917 Bacteria 713
277 Ga0496115_0238819 3300048918 Bacteria 1498
278 Ga0496115_0289281 3300048918 Bacteria 1344
279 Ga0501031_0224394 3300049568 Bacteria 1223
280 Ga0501033_0012284 3300049570 Bacteria 6536
281 Ga0501033_0311464 3300049570 Bacteria 1107
282 Ga0501034_0000852 3300049571 Bacteria 45151
283 Ga0501034_0031584 3300049571 Bacteria 5379
284 Ga0501034_0237056 3300049571 Bacteria 1771
285 Ga0501034_0426501 3300049571 Bacteria 1246
286 Ga0501034_0801521 3300049571 Bacteria 834
287 Ga0501036_0001075 3300049572 Bacteria 20707
288 Ga0501036_0022844 3300049572 Bacteria 5266
289 Ga0501037_0075028 3300049573 Bacteria 2456
290 Ga0501037_0158321 3300049573 Bacteria 1615
291 Ga0501038_0037771 3300049574 Bacteria 4233
292 Ga0501038_0543595 3300049574 Bacteria 884
293 Ga0501040_0155403 3300049576 Bacteria 1615
294 Ga0501041_0300052 3300049577 Bacteria 1012
295 Ga0501043_0007548 3300049579 Bacteria 8628
296 Ga0501043_0035106 3300049579 Bacteria 3944
297 Ga0501043_0441238 3300049579 Bacteria 979
298 Ga0501043_0627076 3300049579 Bacteria 792
299 Ga0501043_1283835 3300049579 Bacteria 511
300 Ga0501046_0020605 3300049580 Bacteria 5451
301 Ga0501046_0140579 3300049580 Bacteria 1827
302 Ga0501046_0262443 3300049580 Bacteria 1269
303 Ga0501047_0000010 3300049581 Bacteria 429357
304 Ga0501047_0014941 3300049581 Bacteria 7389
305 Ga0501047_0021524 3300049581 Bacteria 6192
306 Ga0501048_0000592 3300049582 Bacteria 25706
307 Ga0501048_0173757 3300049582 Bacteria 1527
308 Ga0501068_0016558 3300049584 Bacteria 4251
309 Ga0501069_0363464 3300049585 Bacteria 854
310 Ga0501070_0062172 3300049586 Bacteria 3093
311 Ga0501070_0069351 3300049586 Bacteria 2919
312 Ga0501070_0095867 3300049586 Bacteria 2454
313 Ga0501070_0745504 3300049586 Bacteria 772
314 Ga0501070_0804516 3300049586 Bacteria 738
315 Ga0501071_0236392 3300049587 Bacteria 1377
316 Ga0501072_0000680 3300049588 Bacteria 24530
317 Ga0501073_0174604 3300049589 Bacteria 1487
318 Ga0501073_0274427 3300049589 Bacteria 1163
319 Ga0501074_0072966 3300049590 Bacteria 2465
320 Ga0501074_0217109 3300049590 Bacteria 1362
321 Ga0501075_0060859 3300049591 Bacteria 2844
322 Ga0501075_1241598 3300049591 Bacteria 565
323 Ga0501076_0059611 3300049592 Bacteria 3036
324 Ga0501076_0416883 3300049592 Bacteria 1105
325 Ga0501077_0003496 3300049593 Bacteria 9432
326 Ga0501077_0357832 3300049593 Bacteria 932
327 Ga0501079_0015775 3300049741 Bacteria 5772
328 Ga0501080_0000314 3300049742 Bacteria 37074
329 Ga0501080_0041600 3300049742 Bacteria 4281
330 Ga0501080_0481689 3300049742 Bacteria 1110
331 Ga0501081_0004329 3300049743 Bacteria 9105
332 Ga0501083_0001213 3300049744 Bacteria 17449
333 Ga0501083_0190676 3300049744 Bacteria 1338
334 Ga0501083_0371796 3300049744 Bacteria 929
335 Ga0501083_0428177 3300049744 Bacteria 861
336 Ga0501083_0754485 3300049744 Bacteria 633
337 Ga0501035_0408554 3300049822 Bacteria 1128
338 Ga0501044_0007386 3300049823 Bacteria 12086
339 Ga0501044_0113361 3300049823 Bacteria 2718
340 Ga0501044_0529444 3300049823 Bacteria 1077
341 Ga0501044_1094144 3300049823 Bacteria 666
342 Ga0501044_1224411 3300049823 Bacteria 618
343 Ga0501044_1256288 3300049823 Bacteria 608
344 Ga0501044_1332376 3300049823 Bacteria 584
345 Ga0501045_0003578 3300049824 Bacteria 10671
346 nmdc:mga00v17_223602_c1 3300050491 Bacteria 1219
347 nmdc:mga00v17_266208_c1 3300050491 Bacteria 1112
348 nmdc:mga00v17_773361_c1 3300050491 Bacteria 613
349 nmdc:mga0yw44_1076907_c1 3300050492 Bacteria 543
350 nmdc:mga07m45_225486_c1 3300050496 Bacteria 801
351 nmdc:mga05p37_18617_c1 3300050507 Bacteria 8392
352 nmdc:mga05p37_56_c3 3300050507 Bacteria 77819
353 nmdc:mga05p37_853700_c1 3300050507 Bacteria 988
354 nmdc:mga09592_568257_c1 3300050508 Bacteria 973
355 nmdc:mga09592_7647_c1 3300050508 Bacteria 8788
356 nmdc:mga0qj67_19135_c1 3300050509 Bacteria 5230
357 nmdc:mga06r32_6105_c1 3300050510 Bacteria 10821
358 nmdc:mga08y16_206_c1 3300050511 Bacteria 46039
359 nmdc:mga08y16_246811_c1 3300050511 Bacteria 1845
360 nmdc:mga0n895_44250_c1 3300050512 Bacteria 4342
361 nmdc:mga0n895_4632_c1 3300050512 Bacteria 11339
362 nmdc:mga0rr50_134236_c1 3300050513 Bacteria 1985
363 nmdc:mga0rr50_67118_c1 3300050513 Bacteria 2724
364 nmdc:mga08x19_396159_c1 3300050514 Bacteria 968
365 nmdc:mga0a205_80_c1 3300050515 Bacteria 53083
366 Ga0495601_0079223 3300053077 Bacteria 2106
367 Ga0495595_0086134 3300053084 Bacteria 1503
368 Ga0495595_0184442 3300053084 Bacteria 1035
369 Ga0495619_0049763 3300053085 Bacteria 2764
370 Ga0495619_0538216 3300053085 Bacteria 802
371 Ga0500643_005433 3300053087 Bacteria 5491
372 Ga0500644_0000331 3300053088 Bacteria 24183
373 Ga0500651_0061251 3300053093 Bacteria 2351
374 Ga0500651_0420371 3300053093 Bacteria 748
375 Ga0500566_0061750 3300053094 Bacteria 2120
376 Ga0500650_0337777 3300053098 Bacteria 661
377 Ga0500555_050560 3300053103 Bacteria 1138
378 Ga0500595_000002 3300053119 Bacteria 1074388
379 Ga0500652_050488 3300053131 Bacteria 1697
380 Ga0500573_0439968 3300053140 Bacteria 606
381 Ga0500616_0000002 3300053153 Bacteria 1611257
382 Ga0500645_000471 3300053730 Bacteria 27490
383 Ga0501084_0066048 3300054114 Bacteria 3027
384 Ga0501082_0005507 3300060353 Bacteria 10990
385 Ga0501082_0109951 3300060353 Bacteria 2386
386 Ga0501082_0544216 3300060353 Bacteria 1015
387 Ga0530510_0016090 3300061734 Bacteria 5288
388 Ga0530510_0039846 3300061734 Bacteria 3390

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053140 Ga0500573_0439968 Ga0500573_0439968_169_498 104
2 3300025899 Ga0207642_10708092 Ga0207642_107080921 105
3 3300031238 Ga0265332_10001014 Ga0265332_100010145 105
4 3300031247 Ga0265340_10033530 Ga0265340_100335302 105
5 3300031249 Ga0265339_10014704 Ga0265339_100147043 105
6 3300031250 Ga0265331_10051074 Ga0265331_100510742 105
7 3300031711 Ga0265314_10040963 Ga0265314_100409634 105
8 3300031712 Ga0265342_10000035 Ga0265342_1000003582 105
9 3300035118 Ga0373954_0384003 Ga0373954_0384003_275_592 105
10 3300035120 Ga0373957_0057885 Ga0373957_0057885_529_846 105
11 3300035410 Ga0373924_0017358 Ga0373924_0017358_15_332 105
12 3300035724 Ga0373933_0029801 Ga0373933_0029801_2622_2939 105
13 3300036401 Ga0373937_0587949 Ga0373937_0587949_144_461 105
14 3300046529 Ga0495652_0625260 Ga0495652_0625260_109_426 105
15 3300046559 Ga0495667_0423756 Ga0495667_0423756_293_610 105
16 3300046675 Ga0495657_0079980 Ga0495657_0079980_508_825 105
17 3300047444 Ga0495675_0494615 Ga0495675_0494615_296_613 105
18 3300048088 Ga0495602_0888081 Ga0495602_0888081_201_518 105
19 3300049823 Ga0501044_1094144 Ga0501044_1094144_10_327 105
20 3300053077 Ga0495601_0079223 Ga0495601_0079223_356_673 105
21 3300053084 Ga0495595_0184442 Ga0495595_0184442_177_494 105
22 3300053085 Ga0495619_0049763 Ga0495619_0049763_329_646 105
23 iso_pu_bacteria 2508501114 2509075925 105
24 iso_pu_bacteria 2775506901 2776260631 105
25 iso_pu_bacteria 2884298095 2884300073 105
26 iso_pu_bacteria 8054563764 8054564554 105
27 3300053093 Ga0500651_0420371 Ga0500651_0420371_97_417 106
28 iso_pu_bacteria 2643221547 2643756400 106
29 iso_pu_bacteria 2842871566 2842872703 106
30 iso_pu_bacteria 2928521798 2928523284 106
31 iso_pu_bacteria 2954011201 2954015556 106
32 3300011119 Ga0105246_10313229 Ga0105246_103132292 107
33 3300049592 Ga0501076_0416883 Ga0501076_0416883_761_1090 107
34 3300053085 Ga0495619_0538216 Ga0495619_0538216_202_525 107
35 3300005334 Ga0068869_100037141 Ga0068869_1000371413 108
36 3300005336 Ga0070680_100190149 Ga0070680_1001901492 108
37 3300005341 Ga0070691_10007196 Ga0070691_100071964 108
38 3300005343 Ga0070687_100960188 Ga0070687_1009601882 108
39 3300005345 Ga0070692_10173030 Ga0070692_101730302 108
40 3300005347 Ga0070668_100517475 Ga0070668_1005174752 108
41 3300005406 Ga0070703_10019196 Ga0070703_100191963 108
42 3300005440 Ga0070705_100002824 Ga0070705_1000028245 108
43 3300005441 Ga0070700_100005113 Ga0070700_1000051136 108
44 3300005444 Ga0070694_100001395 Ga0070694_10000139511 108
45 3300005445 Ga0070708_100030598 Ga0070708_1000305984 108
46 3300005455 Ga0070663_100135054 Ga0070663_1001350541 108
47 3300005458 Ga0070681_10084993 Ga0070681_100849934 108
48 3300005468 Ga0070707_100669273 Ga0070707_1006692732 108
49 3300005471 Ga0070698_100937241 Ga0070698_1009372411 108
50 3300005518 Ga0070699_100000903 Ga0070699_1000009039 108
51 3300005539 Ga0068853_101174949 Ga0068853_1011749492 108
52 3300005545 Ga0070695_100000639 Ga0070695_1000006395 108
53 3300005546 Ga0070696_100002167 Ga0070696_1000021672 108
54 3300005549 Ga0070704_100001558 Ga0070704_1000015584 108
55 3300005615 Ga0070702_100074178 Ga0070702_1000741782 108
56 3300005844 Ga0068862_100001758 Ga0068862_10000175816 108
57 3300009092 Ga0105250_10205428 Ga0105250_102054281 108
58 3300009098 Ga0105245_10559277 Ga0105245_105592772 108
59 3300009148 Ga0105243_10130121 Ga0105243_101301213 108
60 3300009553 Ga0105249_10001768 Ga0105249_1000176816 108
61 3300013306 Ga0163162_10096507 Ga0163162_100965072 108
62 3300014326 Ga0157380_10853078 Ga0157380_108530782 108
63 3300026075 Ga0207708_10003552 Ga0207708_100035521 108
64 3300034819 Ga0373958_0062854 Ga0373958_0062854_184_510 108
65 3300048904 Ga0496101_0033073 Ga0496101_0033073_963_1289 108
66 3300048905 Ga0496102_0007185 Ga0496102_0007185_2951_3277 108
67 3300048906 Ga0496103_0008881 Ga0496103_0008881_727_1053 108
68 3300048909 Ga0496106_0000882 Ga0496106_0000882_19933_20259 108
69 3300048910 Ga0496107_0070414 Ga0496107_0070414_764_1090 108
70 3300048918 Ga0496115_0289281 Ga0496115_0289281_992_1318 108
71 3300005347 Ga0070668_101661818 Ga0070668_1016618181 109
72 3300005439 Ga0070711_100317869 Ga0070711_1003178692 109
73 3300005441 Ga0070700_100087643 Ga0070700_1000876432 109
74 3300005456 Ga0070678_100841897 Ga0070678_1008418971 109
75 3300005459 Ga0068867_101131369 Ga0068867_1011313691 109
76 3300005544 Ga0070686_101772743 Ga0070686_1017727431 109
77 3300005719 Ga0068861_100227118 Ga0068861_1002271182 109
78 3300006844 Ga0075428_100017835 Ga0075428_1000178354 109
79 3300011119 Ga0105246_10084012 Ga0105246_100840122 109
80 3300014326 Ga0157380_10610437 Ga0157380_106104371 109
81 3300025901 Ga0207688_10053711 Ga0207688_100537113 109
82 3300025916 Ga0207663_10047280 Ga0207663_100472803 109
83 3300025935 Ga0207709_10613326 Ga0207709_106133262 109
84 3300026075 Ga0207708_10079749 Ga0207708_100797493 109
85 3300026078 Ga0207702_12060726 Ga0207702_120607262 109
86 3300026118 Ga0207675_100224019 Ga0207675_1002240192 109
87 3300026121 Ga0207683_10775419 Ga0207683_107754191 109
88 3300031247 Ga0265340_10027937 Ga0265340_100279373 109
89 3300031711 Ga0265314_10081831 Ga0265314_100818312 109
90 3300035692 Ga0373935_0766202 Ga0373935_0766202_64_393 109
91 3300048911 Ga0496108_0613826 Ga0496108_0613826_493_822 109
92 3300050508 nmdc:mga09592_568257_c1 nmdc:mga09592_568257_c1_226_567 109
93 iso_pu_bacteria 2511231027 2511389482 109
94 3300003911 JGI25405J52794_10009376 JGI25405J52794_100093761 110
95 3300005330 Ga0070690_100448413 Ga0070690_1004484132 110
96 3300005334 Ga0068869_100499810 Ga0068869_1004998102 110
97 3300005337 Ga0070682_100006521 Ga0070682_1000065214 110
98 3300005339 Ga0070660_100019880 Ga0070660_1000198804 110
99 3300005340 Ga0070689_101843435 Ga0070689_1018434352 110
100 3300005341 Ga0070691_10077528 Ga0070691_100775282 110
101 3300005341 Ga0070691_10694782 Ga0070691_106947821 110
102 3300005364 Ga0070673_100052909 Ga0070673_1000529094 110
103 3300005364 Ga0070673_100724050 Ga0070673_1007240502 110
104 3300005366 Ga0070659_100035177 Ga0070659_1000351772 110
105 3300005434 Ga0070709_10681802 Ga0070709_106818022 110
106 3300005435 Ga0070714_100633025 Ga0070714_1006330252 110
107 3300005437 Ga0070710_11093856 Ga0070710_110938561 110
108 3300005438 Ga0070701_10706261 Ga0070701_107062612 110
109 3300005440 Ga0070705_100036473 Ga0070705_1000364733 110
110 3300005440 Ga0070705_100251292 Ga0070705_1002512922 110
111 3300005444 Ga0070694_100034848 Ga0070694_1000348483 110
112 3300005455 Ga0070663_100407678 Ga0070663_1004076782 110
113 3300005457 Ga0070662_100714910 Ga0070662_1007149102 110
114 3300005457 Ga0070662_101682807 Ga0070662_1016828071 110
115 3300005458 Ga0070681_10050829 Ga0070681_100508291 110
116 3300005518 Ga0070699_100001464 Ga0070699_1000014648 110
117 3300005530 Ga0070679_100068033 Ga0070679_1000680333 110
118 3300005539 Ga0068853_101631435 Ga0068853_1016314351 110
119 3300005543 Ga0070672_100098801 Ga0070672_1000988013 110
120 3300005544 Ga0070686_100406900 Ga0070686_1004069001 110
121 3300005544 Ga0070686_100899565 Ga0070686_1008995652 110
122 3300005545 Ga0070695_100011521 Ga0070695_1000115213 110
123 3300005546 Ga0070696_100006694 Ga0070696_1000066943 110
124 3300005547 Ga0070693_100060141 Ga0070693_1000601412 110
125 3300005548 Ga0070665_100587256 Ga0070665_1005872561 110
126 3300005549 Ga0070704_100135482 Ga0070704_1001354822 110
127 3300005564 Ga0070664_100112560 Ga0070664_1001125602 110
128 3300005614 Ga0068856_102202813 Ga0068856_1022028131 110
129 3300005615 Ga0070702_100046729 Ga0070702_1000467292 110
130 3300005618 Ga0068864_102466942 Ga0068864_1024669421 110
131 3300005718 Ga0068866_10743504 Ga0068866_107435041 110
132 3300005834 Ga0068851_10954985 Ga0068851_109549851 110
133 3300005840 Ga0068870_11089434 Ga0068870_110894342 110
134 3300005842 Ga0068858_100175782 Ga0068858_1001757823 110
135 3300005843 Ga0068860_101212044 Ga0068860_1012120442 110
136 3300005844 Ga0068862_100799326 Ga0068862_1007993262 110
137 3300005937 Ga0081455_10011971 Ga0081455_100119714 110
138 3300005983 Ga0081540_1015934 Ga0081540_10159344 110
139 3300006048 Ga0075363_100855160 Ga0075363_1008551601 110
140 3300006051 Ga0075364_10208508 Ga0075364_102085082 110
141 3300006051 Ga0075364_10485452 Ga0075364_104854522 110
142 3300006051 Ga0075364_10717784 Ga0075364_107177842 110
143 3300006058 Ga0075432_10033056 Ga0075432_100330562 110
144 3300006178 Ga0075367_10697155 Ga0075367_106971551 110
145 3300006194 Ga0075427_10010950 Ga0075427_100109501 110
146 3300006195 Ga0075366_10909684 Ga0075366_109096841 110
147 3300006237 Ga0097621_100188337 Ga0097621_1001883371 110
148 3300006353 Ga0075370_10325490 Ga0075370_103254902 110
149 3300006358 Ga0068871_100130541 Ga0068871_1001305412 110
150 3300006358 Ga0068871_100635864 Ga0068871_1006358641 110
151 3300006844 Ga0075428_100030168 Ga0075428_1000301681 110
152 3300006846 Ga0075430_100004696 Ga0075430_10000469611 110
153 3300006846 Ga0075430_100064231 Ga0075430_1000642312 110
154 3300006847 Ga0075431_100006639 Ga0075431_10000663911 110
155 3300006852 Ga0075433_10001599 Ga0075433_100015991 110
156 3300006871 Ga0075434_100000576 Ga0075434_10000057628 110
157 3300006871 Ga0075434_100943061 Ga0075434_1009430611 110
158 3300006880 Ga0075429_100050787 Ga0075429_1000507872 110
159 3300006914 Ga0075436_100469752 Ga0075436_1004697522 110
160 3300007076 Ga0075435_100156307 Ga0075435_1001563072 110
161 3300009093 Ga0105240_11570974 Ga0105240_115709741 110
162 3300009094 Ga0111539_10000503 Ga0111539_1000050323 110
163 3300009094 Ga0111539_10038117 Ga0111539_100381175 110
164 3300009098 Ga0105245_10024222 Ga0105245_100242223 110
165 3300009098 Ga0105245_10083234 Ga0105245_100832343 110
166 3300009147 Ga0114129_10013874 Ga0114129_100138741 110
167 3300009147 Ga0114129_10029505 Ga0114129_100295057 110
168 3300009147 Ga0114129_10330763 Ga0114129_103307633 110
169 3300009147 Ga0114129_10716327 Ga0114129_107163272 110
170 3300009148 Ga0105243_10027825 Ga0105243_100278253 110
171 3300009148 Ga0105243_11118624 Ga0105243_111186241 110
172 3300009174 Ga0105241_10004682 Ga0105241_100046825 110
173 3300009176 Ga0105242_10876113 Ga0105242_108761132 110
174 3300009177 Ga0105248_10019008 Ga0105248_100190082 110
175 3300009545 Ga0105237_10083294 Ga0105237_100832943 110
176 3300009545 Ga0105237_10105963 Ga0105237_101059632 110
177 3300009551 Ga0105238_10058399 Ga0105238_100583994 110
178 3300010375 Ga0105239_10391703 Ga0105239_103917032 110
179 3300011119 Ga0105246_10194096 Ga0105246_101940962 110
180 3300011119 Ga0105246_10720271 Ga0105246_107202712 110
181 3300013100 Ga0157373_10406496 Ga0157373_104064962 110
182 3300013104 Ga0157370_10303577 Ga0157370_103035772 110
183 3300013104 Ga0157370_10331096 Ga0157370_103310962 110
184 3300013105 Ga0157369_10423552 Ga0157369_104235521 110
185 3300013296 Ga0157374_10674612 Ga0157374_106746122 110
186 3300013296 Ga0157374_11100660 Ga0157374_111006601 110
187 3300013297 Ga0157378_10041471 Ga0157378_100414713 110
188 3300013297 Ga0157378_10402037 Ga0157378_104020372 110
189 3300013297 Ga0157378_10628199 Ga0157378_106281992 110
190 3300013308 Ga0157375_10045104 Ga0157375_100451042 110
191 3300013308 Ga0157375_10308379 Ga0157375_103083792 110
192 3300014326 Ga0157380_10063356 Ga0157380_100633563 110
193 3300014969 Ga0157376_10142775 Ga0157376_101427752 110
194 3300014969 Ga0157376_10350002 Ga0157376_103500022 110
195 3300017792 Ga0163161_11184326 Ga0163161_111843261 110
196 3300021358 Ga0213873_10177064 Ga0213873_101770642 110
197 3300024225 Ga0224572_1098376 Ga0224572_10983761 110
198 3300025893 Ga0207682_10082211 Ga0207682_100822111 110
199 3300025904 Ga0207647_10149075 Ga0207647_101490752 110
200 3300025912 Ga0207707_10082985 Ga0207707_100829852 110
201 3300025914 Ga0207671_10608623 Ga0207671_106086232 110
202 3300025919 Ga0207657_10204636 Ga0207657_102046362 110
203 3300025921 Ga0207652_10329877 Ga0207652_103298772 110
204 3300025925 Ga0207650_10465239 Ga0207650_104652391 110
205 3300025926 Ga0207659_11674738 Ga0207659_116747381 110
206 3300025927 Ga0207687_10020034 Ga0207687_100200343 110
207 3300025928 Ga0207700_10368164 Ga0207700_103681642 110
208 3300025929 Ga0207664_10264901 Ga0207664_102649012 110
209 3300025931 Ga0207644_10638547 Ga0207644_106385472 110
210 3300025932 Ga0207690_10006521 Ga0207690_100065213 110
211 3300025933 Ga0207706_10809845 Ga0207706_108098452 110
212 3300025933 Ga0207706_11175361 Ga0207706_111753611 110
213 3300025934 Ga0207686_10458074 Ga0207686_104580743 110
214 3300025935 Ga0207709_10074251 Ga0207709_100742512 110
215 3300025937 Ga0207669_10051532 Ga0207669_100515323 110
216 3300025940 Ga0207691_10089680 Ga0207691_100896802 110
217 3300025945 Ga0207679_10109375 Ga0207679_101093752 110
218 3300025960 Ga0207651_10164009 Ga0207651_101640092 110
219 3300025960 Ga0207651_10249516 Ga0207651_102495163 110
220 3300026035 Ga0207703_10034453 Ga0207703_100344534 110
221 3300026041 Ga0207639_11314480 Ga0207639_113144801 110
222 3300026067 Ga0207678_10000594 Ga0207678_100005946 110
223 3300026089 Ga0207648_10025772 Ga0207648_100257724 110
224 3300026095 Ga0207676_10273487 Ga0207676_102734872 110
225 3300026116 Ga0207674_10055194 Ga0207674_100551944 110
226 3300026118 Ga0207675_100293685 Ga0207675_1002936852 110
227 3300026118 Ga0207675_101367119 Ga0207675_1013671191 110
228 3300026121 Ga0207683_10046174 Ga0207683_100461743 110
229 3300027907 Ga0207428_10000114 Ga0207428_1000011479 110
230 3300028379 Ga0268266_10655384 Ga0268266_106553842 110
231 3300028380 Ga0268265_11433103 Ga0268265_114331032 110
232 3300028381 Ga0268264_12412806 Ga0268264_124128061 110
233 3300028800 Ga0265338_10695220 Ga0265338_106952202 110
234 3300031238 Ga0265332_10138971 Ga0265332_101389712 110
235 3300031240 Ga0265320_10089323 Ga0265320_100893232 110
236 3300031241 Ga0265325_10010969 Ga0265325_100109693 110
237 3300031241 Ga0265325_10033971 Ga0265325_100339713 110
238 3300031242 Ga0265329_10054249 Ga0265329_100542492 110
239 3300031247 Ga0265340_10003609 Ga0265340_100036098 110
240 3300031249 Ga0265339_10125258 Ga0265339_101252582 110
241 3300031344 Ga0265316_10486219 Ga0265316_104862192 110
242 3300031344 Ga0265316_10623666 Ga0265316_106236661 110
243 3300031344 Ga0265316_10732662 Ga0265316_107326622 110
244 3300031344 Ga0265316_10740473 Ga0265316_107404731 110
245 3300031548 Ga0307408_101949216 Ga0307408_1019492162 110
246 3300031595 Ga0265313_10032083 Ga0265313_100320832 110
247 3300031595 Ga0265313_10138679 Ga0265313_101386791 110
248 3300031691 Ga0316579_10070170 Ga0316579_100701702 110
249 3300031711 Ga0265314_10005122 Ga0265314_1000512212 110
250 3300031711 Ga0265314_10026124 Ga0265314_100261244 110
251 3300031712 Ga0265342_10006164 Ga0265342_100061644 110
252 3300031852 Ga0307410_10640260 Ga0307410_106402602 110
253 3300031901 Ga0307406_10482265 Ga0307406_104822652 110
254 3300031903 Ga0307407_10311264 Ga0307407_103112642 110
255 3300031995 Ga0307409_100344799 Ga0307409_1003447992 110
256 3300034818 Ga0373950_0072400 Ga0373950_0072400_57_446 110
257 3300035089 Ga0373944_0389693 Ga0373944_0389693_66_398 110
258 3300035111 Ga0373923_0442374 Ga0373923_0442374_255_587 110
259 3300035117 Ga0373953_0099499 Ga0373953_0099499_876_1208 110
260 3300035118 Ga0373954_0121000 Ga0373954_0121000_775_1107 110
261 3300035207 Ga0373942_0182155 Ga0373942_0182155_98_430 110
262 3300035692 Ga0373935_0714734 Ga0373935_0714734_226_558 110
263 3300035695 Ga0373927_0008005 Ga0373927_0008005_164_496 110
264 3300036401 Ga0373937_0041486 Ga0373937_0041486_2896_3228 110
265 3300036401 Ga0373937_0076549 Ga0373937_0076549_2094_2438 110
266 3300036647 Ga0316582_0403639 Ga0316582_0403639_327_662 110
267 3300037068 Ga0373925_0174194 Ga0373925_0174194_1195_1527 110
268 3300039437 Ga0436365_0247085 Ga0436365_0247085_57_389 110
269 3300039437 Ga0436365_0660080 Ga0436365_0660080_20_352 110
270 3300039437 Ga0436365_1482850 Ga0436365_1482850_2805_3146 110
271 3300039447 Ga0436361_1026286 Ga0436361_1026286_129_461 110
272 3300041408 Ga0439453_0002205 Ga0439453_0002205_2294_2626 110
273 3300042001 Ga0439441_167281 Ga0439441_167281_44_376 110
274 3300042013 Ga0439456_100937 Ga0439456_100937_125_457 110
275 3300042993 Ga0439440_0046805 Ga0439440_0046805_129_461 110
276 3300046472 Ga0495580_0672391 Ga0495580_0672391_207_539 110
277 3300046499 Ga0495594_0216951 Ga0495594_0216951_146_478 110
278 3300046525 Ga0495663_0188772 Ga0495663_0188772_349_681 110
279 3300046681 Ga0495647_0262311 Ga0495647_0262311_133_465 110
280 3300046683 Ga0495658_0030857 Ga0495658_0030857_178_510 110
281 3300047315 Ga0495581_0099987 Ga0495581_0099987_1295_1627 110
282 3300047319 Ga0495674_0439222 Ga0495674_0439222_605_937 110
283 3300047444 Ga0495675_0340529 Ga0495675_0340529_268_600 110
284 3300047445 Ga0495677_0147190 Ga0495677_0147190_282_614 110
285 3300047447 Ga0495685_192926 Ga0495685_192926_127_492 110
286 3300048903 Ga0496100_0335288 Ga0496100_0335288_134_508 110
287 3300048904 Ga0496101_0124459 Ga0496101_0124459_354_728 110
288 3300048905 Ga0496102_0046107 Ga0496102_0046107_821_1195 110
289 3300048906 Ga0496103_0004391 Ga0496103_0004391_2252_2626 110
290 3300048907 Ga0496104_0333369 Ga0496104_0333369_38_370 110
291 3300048909 Ga0496106_0009124 Ga0496106_0009124_3022_3396 110
292 3300048910 Ga0496107_0087972 Ga0496107_0087972_1311_1685 110
293 3300048913 Ga0496110_0721747 Ga0496110_0721747_468_833 110
294 3300048917 Ga0496114_0341888 Ga0496114_0341888_44_418 110
295 3300048917 Ga0496114_1016005 Ga0496114_1016005_147_479 110
296 3300048918 Ga0496115_0238819 Ga0496115_0238819_856_1188 110
297 3300049568 Ga0501031_0224394 Ga0501031_0224394_782_1123 110
298 3300049570 Ga0501033_0012284 Ga0501033_0012284_2689_3033 110
299 3300049570 Ga0501033_0311464 Ga0501033_0311464_579_923 110
300 3300049571 Ga0501034_0000852 Ga0501034_0000852_12558_12902 110
301 3300049571 Ga0501034_0031584 Ga0501034_0031584_2905_3249 110
302 3300049571 Ga0501034_0237056 Ga0501034_0237056_840_1184 110
303 3300049571 Ga0501034_0426501 Ga0501034_0426501_760_1104 110
304 3300049571 Ga0501034_0801521 Ga0501034_0801521_205_549 110
305 3300049572 Ga0501036_0001075 Ga0501036_0001075_4713_5057 110
306 3300049572 Ga0501036_0022844 Ga0501036_0022844_1459_1803 110
307 3300049573 Ga0501037_0075028 Ga0501037_0075028_1744_2088 110
308 3300049573 Ga0501037_0158321 Ga0501037_0158321_388_732 110
309 3300049574 Ga0501038_0037771 Ga0501038_0037771_3227_3571 110
310 3300049574 Ga0501038_0543595 Ga0501038_0543595_53_397 110
311 3300049576 Ga0501040_0155403 Ga0501040_0155403_392_733 110
312 3300049577 Ga0501041_0300052 Ga0501041_0300052_264_605 110
313 3300049579 Ga0501043_0007548 Ga0501043_0007548_7448_7792 110
314 3300049579 Ga0501043_0035106 Ga0501043_0035106_1483_1827 110
315 3300049579 Ga0501043_0441238 Ga0501043_0441238_20_364 110
316 3300049579 Ga0501043_0627076 Ga0501043_0627076_374_706 110
317 3300049579 Ga0501043_1283835 Ga0501043_1283835_122_466 110
318 3300049580 Ga0501046_0020605 Ga0501046_0020605_3116_3460 110
319 3300049580 Ga0501046_0140579 Ga0501046_0140579_1129_1473 110
320 3300049580 Ga0501046_0262443 Ga0501046_0262443_342_686 110
321 3300049581 Ga0501047_0000010 Ga0501047_0000010_80237_80581 110
322 3300049581 Ga0501047_0014941 Ga0501047_0014941_2140_2484 110
323 3300049581 Ga0501047_0021524 Ga0501047_0021524_1993_2337 110
324 3300049582 Ga0501048_0000592 Ga0501048_0000592_14131_14475 110
325 3300049582 Ga0501048_0173757 Ga0501048_0173757_749_1093 110
326 3300049584 Ga0501068_0016558 Ga0501068_0016558_1108_1452 110
327 3300049585 Ga0501069_0363464 Ga0501069_0363464_488_832 110
328 3300049586 Ga0501070_0062172 Ga0501070_0062172_2079_2423 110
329 3300049586 Ga0501070_0069351 Ga0501070_0069351_2143_2487 110
330 3300049586 Ga0501070_0095867 Ga0501070_0095867_985_1329 110
331 3300049586 Ga0501070_0745504 Ga0501070_0745504_300_644 110
332 3300049586 Ga0501070_0804516 Ga0501070_0804516_276_620 110
333 3300049587 Ga0501071_0236392 Ga0501071_0236392_441_785 110
334 3300049588 Ga0501072_0000680 Ga0501072_0000680_22098_22430 110
335 3300049589 Ga0501073_0174604 Ga0501073_0174604_358_702 110
336 3300049589 Ga0501073_0274427 Ga0501073_0274427_740_1084 110
337 3300049590 Ga0501074_0072966 Ga0501074_0072966_1298_1642 110
338 3300049590 Ga0501074_0217109 Ga0501074_0217109_605_946 110
339 3300049591 Ga0501075_0060859 Ga0501075_0060859_1018_1359 110
340 3300049591 Ga0501075_1241598 Ga0501075_1241598_30_392 110
341 3300049592 Ga0501076_0059611 Ga0501076_0059611_511_852 110
342 3300049593 Ga0501077_0003496 Ga0501077_0003496_9010_9351 110
343 3300049593 Ga0501077_0357832 Ga0501077_0357832_456_788 110
344 3300049741 Ga0501079_0015775 Ga0501079_0015775_512_853 110
345 3300049742 Ga0501080_0000314 Ga0501080_0000314_23596_23940 110
346 3300049742 Ga0501080_0041600 Ga0501080_0041600_2225_2569 110
347 3300049742 Ga0501080_0481689 Ga0501080_0481689_561_902 110
348 3300049743 Ga0501081_0004329 Ga0501081_0004329_4186_4527 110
349 3300049744 Ga0501083_0001213 Ga0501083_0001213_8314_8658 110
350 3300049744 Ga0501083_0190676 Ga0501083_0190676_779_1111 110
351 3300049744 Ga0501083_0371796 Ga0501083_0371796_263_595 110
352 3300049744 Ga0501083_0428177 Ga0501083_0428177_170_514 110
353 3300049744 Ga0501083_0754485 Ga0501083_0754485_241_600 110
354 3300049822 Ga0501035_0408554 Ga0501035_0408554_389_733 110
355 3300049823 Ga0501044_0007386 Ga0501044_0007386_5480_5824 110
356 3300049823 Ga0501044_0113361 Ga0501044_0113361_2006_2350 110
357 3300049823 Ga0501044_0529444 Ga0501044_0529444_669_1013 110
358 3300049823 Ga0501044_1224411 Ga0501044_1224411_208_552 110
359 3300049823 Ga0501044_1256288 Ga0501044_1256288_54_386 110
360 3300049823 Ga0501044_1332376 Ga0501044_1332376_158_502 110
361 3300049824 Ga0501045_0003578 Ga0501045_0003578_769_1110 110
362 3300050491 nmdc:mga00v17_223602_c1 nmdc:mga00v17_223602_c1_193_531 110
363 3300050491 nmdc:mga00v17_266208_c1 nmdc:mga00v17_266208_c1_437_769 110
364 3300050491 nmdc:mga00v17_773361_c1 nmdc:mga00v17_773361_c1_248_592 110
365 3300050492 nmdc:mga0yw44_1076907_c1 nmdc:mga0yw44_1076907_c1_166_504 110
366 3300050496 nmdc:mga07m45_225486_c1 nmdc:mga07m45_225486_c1_26_370 110
367 3300050507 nmdc:mga05p37_18617_c1 nmdc:mga05p37_18617_c1_7582_7920 110
368 3300050507 nmdc:mga05p37_56_c3 nmdc:mga05p37_56_c3_45585_45917 110
369 3300050507 nmdc:mga05p37_853700_c1 nmdc:mga05p37_853700_c1_348_680 110
370 3300050508 nmdc:mga09592_7647_c1 nmdc:mga09592_7647_c1_6120_6452 110
371 3300050509 nmdc:mga0qj67_19135_c1 nmdc:mga0qj67_19135_c1_2690_3022 110
372 3300050510 nmdc:mga06r32_6105_c1 nmdc:mga06r32_6105_c1_6541_6873 110
373 3300050511 nmdc:mga08y16_206_c1 nmdc:mga08y16_206_c1_123_455 110
374 3300050511 nmdc:mga08y16_246811_c1 nmdc:mga08y16_246811_c1_1137_1481 110
375 3300050512 nmdc:mga0n895_44250_c1 nmdc:mga0n895_44250_c1_3198_3536 110
376 3300050512 nmdc:mga0n895_4632_c1 nmdc:mga0n895_4632_c1_8318_8650 110
377 3300050513 nmdc:mga0rr50_134236_c1 nmdc:mga0rr50_134236_c1_382_714 110
378 3300050513 nmdc:mga0rr50_67118_c1 nmdc:mga0rr50_67118_c1_887_1225 110
379 3300050514 nmdc:mga08x19_396159_c1 nmdc:mga08x19_396159_c1_603_941 110
380 3300050515 nmdc:mga0a205_80_c1 nmdc:mga0a205_80_c1_52553_52885 110
381 3300053084 Ga0495595_0086134 Ga0495595_0086134_133_465 110
382 3300053087 Ga0500643_005433 Ga0500643_005433_4480_4869 110
383 3300053088 Ga0500644_0000331 Ga0500644_0000331_17047_17436 110
384 3300053093 Ga0500651_0061251 Ga0500651_0061251_410_799 110
385 3300053094 Ga0500566_0061750 Ga0500566_0061750_1646_2035 110
386 3300053098 Ga0500650_0337777 Ga0500650_0337777_242_631 110
387 3300053103 Ga0500555_050560 Ga0500555_050560_312_701 110
388 3300053119 Ga0500595_000002 Ga0500595_000002_39005_39394 110
389 3300053131 Ga0500652_050488 Ga0500652_050488_1288_1620 110
390 3300053153 Ga0500616_0000002 Ga0500616_0000002_53808_54197 110
391 3300053730 Ga0500645_000471 Ga0500645_000471_15188_15520 110
392 3300054114 Ga0501084_0066048 Ga0501084_0066048_1371_1703 110
393 3300060353 Ga0501082_0005507 Ga0501082_0005507_6156_6497 110
394 3300060353 Ga0501082_0109951 Ga0501082_0109951_890_1234 110
395 3300060353 Ga0501082_0544216 Ga0501082_0544216_367_699 110
396 3300061734 Ga0530510_0016090 Ga0530510_0016090_4461_4802 110
397 3300061734 Ga0530510_0039846 Ga0530510_0039846_2637_2969 110

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08755

YccV-like

Hemimethylated DNA-binding protein YccV like

26

120

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ycq-assembly1.cif.gz_A unique specificity-enhancing factor for the aaa+ lon protease 0.7861 7 92
1nz9-assembly1.cif.gz_A solution structure of the n-utilization substance g (nusg) c-terminal (ngc) domain from thermus thermophilus 0.7543 9 79
8fkv-assembly1.cif.gz_LE human nucleolar pre-60s ribosomal subunit (state d1) 0.7537 9 81
2xhc-assembly1.cif.gz_A crystal structure of thermotoga maritima n-utilization substance g (nusg) 0.7355 8 79
7xn7-assembly1.cif.gz_W rna polymerase ii elongation complex containing spt4/5, elf1, spt6, spn1 and paf1c 0.7143 9 81
ID Description Score Start End Superfamily
af_Q67Y99_203_301_2.30.30.390 Mainly Beta;Roll;SH3 type barrels.;Hemimethylated DNA-binding domain 0.8322 6 98 2.30.30.390
af_Q7YTU9_87_190_2.30.30.390 Mainly Beta;Roll;SH3 type barrels.;Hemimethylated DNA-binding domain 0.8169 8 105 2.30.30.390
af_F1M5Q6_492_592_2.30.30.390 Mainly Beta;Roll;SH3 type barrels.;Hemimethylated DNA-binding domain 0.8065 9 108 2.30.30.390
af_E9QDW7_114_220_2.30.30.390 Mainly Beta;Roll;SH3 type barrels.;Hemimethylated DNA-binding domain 0.7949 9 105 2.30.30.390
af_Q9V460_456_512_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.7948 8 79 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A3D2VYI3-F1-model_v4 Heat shock protein HspQ 0.9823 6 104 GO:0003677
AF-A0A259D078-F1-model_v4 deleted 0.9822 3 105
AF-A0A519YQW3-F1-model_v4 deleted 0.9753 5 90
AF-A0A6N9ASG2-F1-model_v4 Heat shock protein HspQ 0.9752 7 62 GO:0003677
AF-A0A1H8F3J5-F1-model_v4 Heat shock protein HspQ 0.9717 1 107 GO:0003677

Feature Viewer

pLDDT pTM Quality
87.67 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map