F433723

General Info

Members Datasets Scaffolds Average Seq Length
397 221 366 124

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100167428|Ga0068852_1001674283
Length 150
Sequence MAGDTGSMFKIQVIPCRPWLNTSHSAMQLTEHRTDRELFVRSADATRVVIVDREFRASLVLTPSGVLEDFAPRTVEEIDAAAAERVLALRPEVVLLGTGARATFPPQAVLGLFLRRGIGLETMDSAAAARTFNVLAGEGRQVAAVFLIGA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2643221559 Lysobacter sp. Root559 Isolate Unclassified
5 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
6 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
7 2643221586 Lysobacter sp. Root667 Isolate Unclassified
8 2643221612 Lysobacter sp. Root76 Isolate Unclassified
9 2643221727 Lysobacter sp. Root96 Isolate Unclassified
10 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
11 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
12 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
13 2818991457 Xanthomonas translucens 569 Isolate Unclassified
14 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
15 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
16 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
17 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
18 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
19 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
20 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
21 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
22 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
23 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
24 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
25 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
26 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
27 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
28 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
29 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
30 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
87 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
88 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
131 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
132 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
133 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
134 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
138 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
144 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
145 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
146 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
147 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
148 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
149 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
150 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
151 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
152 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
153 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
154 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
155 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
156 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
157 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
158 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
159 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
160 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
161 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
162 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
163 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
164 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
165 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
166 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
167 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
168 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
169 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
170 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
171 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
172 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
173 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
176 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
177 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
178 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
179 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
180 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
181 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
182 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
183 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
207 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
217 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
218 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
219 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
220 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
221 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.19
Metatranscriptomes 0
Isolates 7.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.28
Nodule 0.25
Rhizoplane 8.31
Rhizosphere 60.2
Stem 0
Stem Tuber 0
Unclassified 26.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_136925 2162886007 Bacteria 3390
2 rootH1_10020036 3300003323 Bacteria 4145
3 rootH1_10201722 3300003323 Bacteria 1048
4 Ga0055536_1002522 3300003781 Bacteria 10260
5 Ga0055536_1005660 3300003781 Bacteria 6045
6 Ga0055531_10014780 3300003794 Bacteria 3491
7 Ga0058692_1000002 3300003856 Bacteria 508401
8 Ga0058692_1000006 3300003856 Bacteria 398109
9 Ga0065704_10074187 3300005289 Bacteria 6463
10 Ga0065704_10095753 3300005289 Bacteria 2474
11 Ga0065704_10209784 3300005289 Bacteria 1113
12 Ga0070670_100021104 3300005331 Bacteria 5602
13 Ga0068868_100345498 3300005338 Bacteria 1273
14 Ga0070661_100026423 3300005344 Bacteria 4175
15 Ga0070668_100078684 3300005347 Bacteria 2579
16 Ga0070668_100163472 3300005347 Bacteria 1808
17 Ga0070668_100460351 3300005347 Bacteria 1095
18 Ga0070671_100334444 3300005355 Bacteria 1291
19 Ga0070688_100134004 3300005365 Bacteria 1675
20 Ga0070659_100817043 3300005366 Bacteria 811
21 Ga0070667_100258541 3300005367 Bacteria 1558
22 Ga0070714_100042752 3300005435 Bacteria 3830
23 Ga0070710_10042905 3300005437 Bacteria 2503
24 Ga0070663_100004878 3300005455 Bacteria 7916
25 Ga0070663_100024628 3300005455 Bacteria 4054
26 Ga0070662_100008490 3300005457 Bacteria 6704
27 Ga0068867_101851395 3300005459 Unclassified 568
28 Ga0070685_10003480 3300005466 Bacteria 8011
29 Ga0068853_100039275 3300005539 Bacteria 4036
30 Ga0068853_100062215 3300005539 Bacteria 3229
31 Ga0070665_100001482 3300005548 Bacteria 27442
32 Ga0070665_100610451 3300005548 Bacteria 1104
33 Ga0070665_101130413 3300005548 Bacteria 795
34 Ga0068855_100212061 3300005563 Bacteria 2175
35 Ga0068855_101022706 3300005563 Bacteria 867
36 Ga0068857_100101039 3300005577 Bacteria 2588
37 Ga0068857_100721452 3300005577 Bacteria 948
38 Ga0068854_100009719 3300005578 Bacteria 6215
39 Ga0068854_100951999 3300005578 Bacteria 757
40 Ga0068856_101079899 3300005614 Bacteria 820
41 Ga0068852_100005452 3300005616 Bacteria 9098
42 Ga0068852_100136432 3300005616 Bacteria 2266
43 Ga0068852_100167428 3300005616 Bacteria 2057
44 Ga0068852_101190334 3300005616 Bacteria 783
45 Ga0068859_100142859 3300005617 Bacteria 2467
46 Ga0068851_10047128 3300005834 Bacteria 2182
47 Ga0068863_100550543 3300005841 Unclassified 1139
48 Ga0068858_100001325 3300005842 Bacteria 25564
49 Ga0075365_10068746 3300006038 Bacteria 2380
50 Ga0075364_10019841 3300006051 Bacteria 4224
51 Ga0075369_10246136 3300006186 Bacteria 830
52 Ga0097621_100149563 3300006237 Bacteria 2002
53 Ga0097621_100198994 3300006237 Bacteria 1738
54 Ga0097621_100650751 3300006237 Bacteria 967
55 Ga0068871_100039070 3300006358 Bacteria 3795
56 Ga0068865_101055872 3300006881 Bacteria 714
57 Ga0068865_101079898 3300006881 Bacteria 706
58 Ga0097620_100142868 3300006931 Bacteria 2467
59 Ga0105251_10002861 3300009011 Bacteria 13030
60 Ga0105244_10099134 3300009036 Bacteria 1427
61 Ga0105244_10108544 3300009036 Bacteria 1352
62 Ga0105240_10001278 3300009093 Bacteria 43550
63 Ga0105240_10313608 3300009093 Bacteria 1790
64 Ga0105241_10096475 3300009174 Bacteria 2342
65 Ga0105248_10822911 3300009177 Bacteria 1048
66 Ga0105248_11402778 3300009177 Bacteria 790
67 Ga0105237_10294394 3300009545 Bacteria 1626
68 Ga0105237_10295551 3300009545 Bacteria 1622
69 Ga0105238_10032728 3300009551 Bacteria 5292
70 Ga0105238_10055319 3300009551 Bacteria 3983
71 Ga0105238_10086971 3300009551 Bacteria 3113
72 Ga0105238_10092552 3300009551 Bacteria 3011
73 Ga0105249_10025839 3300009553 Bacteria 5289
74 Ga0105239_10221435 3300010375 Bacteria 2122
75 Ga0105239_12006733 3300010375 Unclassified 672
76 Ga0157373_10582345 3300013100 Bacteria 814
77 Ga0157371_10002030 3300013102 Bacteria 19969
78 Ga0157371_10234531 3300013102 Bacteria 1319
79 Ga0157371_10252853 3300013102 Bacteria 1269
80 Ga0157370_10004741 3300013104 Bacteria 15490
81 Ga0157370_10013751 3300013104 Bacteria 8319
82 Ga0157370_10060548 3300013104 Bacteria 3594
83 Ga0157370_10096403 3300013104 Bacteria 2775
84 Ga0157370_10123157 3300013104 Bacteria 2421
85 Ga0157370_10582894 3300013104 Bacteria 1024
86 Ga0157369_10077148 3300013105 Bacteria 3571
87 Ga0157369_10164205 3300013105 Bacteria 2343
88 Ga0157374_10142473 3300013296 Bacteria 2327
89 Ga0157378_10000043 3300013297 Bacteria 107750
90 Ga0163162_10000015 3300013306 Bacteria 261996
91 Ga0157375_10542950 3300013308 Bacteria 1325
92 Ga0182008_10000116 3300014497 Bacteria 60097
93 Ga0182008_10020426 3300014497 Bacteria 3411
94 Ga0182008_10044098 3300014497 Bacteria 2219
95 Ga0157379_11843514 3300014968 Unclassified 595
96 Ga0157376_10164688 3300014969 Bacteria 2013
97 Ga0157376_10784974 3300014969 Bacteria 964
98 Ga0182006_1032816 3300015261 Bacteria 2084
99 Ga0182006_1057289 3300015261 Bacteria 1482
100 Ga0182006_1088152 3300015261 Bacteria 1120
101 Ga0182007_10002719 3300015262 Bacteria 8652
102 Ga0182007_10014048 3300015262 Bacteria 3033
103 Ga0182005_1000655 3300015265 Bacteria 16503
104 Ga0163161_10013088 3300017792 Bacteria 5766
105 Ga0163161_10055352 3300017792 Bacteria 2880
106 Ga0163161_10076603 3300017792 Bacteria 2455
107 Ga0163161_10386962 3300017792 Bacteria 1119
108 Ga0163161_10492187 3300017792 Bacteria 997
109 Ga0209233_1008257 3300025261 Bacteria 3233
110 Ga0209676_1000047 3300025292 Bacteria 408645
111 Ga0209025_1071055 3300025294 Bacteria 1236
112 Ga0209050_1017481 3300025298 Bacteria 2855
113 Ga0209257_1000302 3300025304 Bacteria 108038
114 Ga0209257_1041945 3300025304 Bacteria 1354
115 Ga0207656_10001827 3300025321 Bacteria 7069
116 Ga0207713_1000890 3300025735 Bacteria 27092
117 Ga0207692_10041733 3300025898 Bacteria 2274
118 Ga0207680_10003078 3300025903 Bacteria 7827
119 Ga0207647_10002915 3300025904 Bacteria 12879
120 Ga0207654_10508193 3300025911 Bacteria 852
121 Ga0207695_10000033 3300025913 Bacteria 507477
122 Ga0207695_10005921 3300025913 Bacteria 16024
123 Ga0207695_10034290 3300025913 Bacteria 5523
124 Ga0207671_10013246 3300025914 Bacteria 6578
125 Ga0207671_10034031 3300025914 Bacteria 3788
126 Ga0207649_10041331 3300025920 Bacteria 2806
127 Ga0207694_10002668 3300025924 Bacteria 14456
128 Ga0207694_10003738 3300025924 Bacteria 12061
129 Ga0207694_10005276 3300025924 Bacteria 9958
130 Ga0207650_10002390 3300025925 Bacteria 13068
131 Ga0207650_10009991 3300025925 Bacteria 6497
132 Ga0207664_10046775 3300025929 Bacteria 3398
133 Ga0207644_10053772 3300025931 Bacteria 2898
134 Ga0207644_10439985 3300025931 Bacteria 1070
135 Ga0207690_11321566 3300025932 Bacteria 603
136 Ga0207706_10052916 3300025933 Bacteria 3584
137 Ga0207709_10046489 3300025935 Bacteria 2634
138 Ga0207709_10084076 3300025935 Bacteria 2060
139 Ga0207704_10706844 3300025938 Bacteria 835
140 Ga0207711_10135621 3300025941 Bacteria 2210
141 Ga0207679_10518473 3300025945 Bacteria 1066
142 Ga0207667_10660291 3300025949 Bacteria 1050
143 Ga0207712_10000165 3300025961 Bacteria 68118
144 Ga0207668_10118608 3300025972 Bacteria 1999
145 Ga0207668_10879608 3300025972 Bacteria 796
146 Ga0207640_10732262 3300025981 Bacteria 851
147 Ga0207658_10016117 3300025986 Bacteria 5134
148 Ga0207658_11620687 3300025986 Bacteria 592
149 Ga0207677_10060979 3300026023 Bacteria 2610
150 Ga0207703_10000553 3300026035 Bacteria 38426
151 Ga0207639_10000217 3300026041 Bacteria 42907
152 Ga0207639_10008722 3300026041 Bacteria 6960
153 Ga0207678_10005262 3300026067 Bacteria 11593
154 Ga0207678_10073285 3300026067 Bacteria 2935
155 Ga0207702_10005747 3300026078 Bacteria 10805
156 Ga0207702_10060529 3300026078 Bacteria 3228
157 Ga0207648_10158657 3300026089 Bacteria 1997
158 Ga0207676_10487472 3300026095 Bacteria 1168
159 Ga0207674_10050213 3300026116 Bacteria 4262
160 Ga0207674_10232430 3300026116 Bacteria 1791
161 Ga0207698_10043839 3300026142 Bacteria 3356
162 Ga0207698_10138025 3300026142 Bacteria 2095
163 Ga0207698_10617308 3300026142 Bacteria 1071
164 Ga0209371_1000004 3300027312 Bacteria 1098197
165 Ga0209371_1000016 3300027312 Bacteria 646301
166 Ga0268266_10000006 3300028379 Bacteria 1410021
167 Ga0268266_10192460 3300028379 Bacteria 1863
168 Ga0268266_10564529 3300028379 Bacteria 1091
169 Ga0268266_11001992 3300028379 Bacteria 808
170 Ga0307515_10144069 3300028794 Bacteria 2536
171 Ga0268256_1000005 3300030500 Bacteria 1082342
172 Ga0268256_1000015 3300030500 Bacteria 646300
173 Ga0316177_1140976 3300030731 Bacteria 1922
174 Ga0316176_1196701 3300030732 Bacteria 1284
175 Ga0316182_1404932 3300030745 Bacteria 577
176 Ga0307513_10010266 3300031456 Bacteria 11756
177 Ga0307513_10506697 3300031456 Bacteria 924
178 Ga0307408_100647625 3300031548 Bacteria 944
179 Ga0307408_100714193 3300031548 Bacteria 902
180 Ga0307508_10010006 3300031616 Bacteria 8691
181 Ga0307516_10035322 3300031730 Bacteria 5016
182 Ga0307405_10361182 3300031731 Bacteria 1124
183 Ga0307405_10708457 3300031731 Bacteria 834
184 Ga0307412_10090238 3300031911 Bacteria 2141
185 Ga0307412_10403228 3300031911 Bacteria 1114
186 Ga0307414_10002380 3300032004 Bacteria 9831
187 Ga0307414_10026483 3300032004 Bacteria 3732
188 Ga0307414_10289971 3300032004 Bacteria 1379
189 Ga0307414_10442889 3300032004 Bacteria 1137
190 Ga0307414_11302418 3300032004 Bacteria 674
191 Ga0436364_0208968 3300037853 Bacteria 596
192 Ga0237819_02887 3300038705 Bacteria 3252
193 Ga0237816_00163 3300039145 Bacteria 5317
194 Ga0439436_0008344 3300041404 Bacteria 3182
195 Ga0439436_0011948 3300041404 Bacteria 2635
196 Ga0439436_0081025 3300041404 Bacteria 903
197 Ga0439439_0002962 3300041406 Bacteria 3690
198 Ga0439439_0017171 3300041406 Bacteria 1777
199 Ga0439439_0100207 3300041406 Bacteria 797
200 Ga0439439_0248520 3300041406 Bacteria 527
201 Ga0439465_0009636 3300041413 Bacteria 3042
202 Ga0439465_0037926 3300041413 Bacteria 1551
203 Ga0439465_0297793 3300041413 Bacteria 603
204 Ga0451787_289771 3300041441 Bacteria 1173
205 Ga0451791_0734992 3300041451 Bacteria 4680
206 Ga0451791_0893513 3300041451 Bacteria 847
207 Ga0451793_0100418 3300041452 Bacteria 1145
208 Ga0451793_1036736 3300041452 Bacteria 4071
209 Ga0451793_1404216 3300041452 Bacteria 1476
210 Ga0451797_0199294 3300041453 Bacteria 758
211 Ga0451797_0405581 3300041453 Bacteria 860
212 Ga0451797_0515144 3300041453 Bacteria 1610
213 Ga0451797_0892303 3300041453 Bacteria 961
214 Ga0451797_1283472 3300041453 Bacteria 556
215 Ga0451797_1529956 3300041453 Bacteria 616
216 Ga0451795_0613894 3300041456 Bacteria 2313
217 Ga0451798_0552853 3300041458 Bacteria 1149
218 Ga0451800_0416075 3300041459 Bacteria 5098
219 Ga0451800_0860938 3300041459 Unclassified 670
220 Ga0451800_1591334 3300041459 Bacteria 650
221 Ga0451802_1509754 3300041460 Bacteria 1266
222 Ga0451804_0778980 3300041463 Bacteria 2428
223 Ga0451807_1726329 3300041486 Bacteria 1181
224 Ga0451807_2042944 3300041486 Bacteria 3308
225 Ga0451807_2045398 3300041486 Bacteria 5221
226 Ga0451833_0868058 3300041491 Bacteria 1578
227 Ga0451837_1302419 3300041494 Bacteria 918
228 Ga0451839_0410190 3300041496 Bacteria 615
229 Ga0451843_0541203 3300041509 Bacteria 2219
230 Ga0451843_0588876 3300041509 Bacteria 1070
231 Ga0451843_1551973 3300041509 Bacteria 694
232 Ga0451843_1674354 3300041509 Bacteria 555
233 Ga0451853_1230542 3300041512 Bacteria 529
234 Ga0451853_3182570 3300041512 Bacteria 566
235 Ga0439431_0129154 3300041997 Bacteria 709
236 Ga0439433_0013792 3300041999 Bacteria 1777
237 Ga0439432_127707 3300042006 Bacteria 751
238 Ga0439432_131845 3300042006 Bacteria 737
239 Ga0439449_0081714 3300042007 Bacteria 1191
240 Ga0439449_0299153 3300042007 Bacteria 607
241 Ga0439452_129142 3300042010 Bacteria 536
242 Ga0439457_033134 3300042014 Bacteria 1147
243 Ga0439462_0003666 3300042015 Bacteria 3702
244 Ga0450911_004925 3300042115 Bacteria 2130
245 Ga0439434_0069185 3300042435 Bacteria 1110
246 Ga0450901_007944 3300042533 Bacteria 1093
247 Ga0495627_015436 3300046453 Bacteria 2636
248 Ga0495627_017553 3300046453 Bacteria 2430
249 Ga0495638_0009055 3300046460 Bacteria 7015
250 Ga0495650_0197116 3300046471 Bacteria 701
251 Ga0495605_0267825 3300046474 Bacteria 728
252 Ga0495607_0013695 3300046501 Bacteria 5301
253 Ga0495606_0009016 3300046507 Bacteria 8526
254 Ga0495610_0052563 3300046512 Bacteria 1977
255 Ga0495610_0102934 3300046512 Bacteria 1276
256 Ga0495616_0035011 3300046513 Bacteria 2602
257 Ga0495616_0122923 3300046513 Bacteria 1196
258 Ga0495643_0138920 3300046522 Bacteria 1213
259 Ga0495663_0007180 3300046525 Bacteria 3074
260 Ga0495663_0021651 3300046525 Bacteria 1852
261 Ga0495663_0023067 3300046525 Bacteria 1800
262 Ga0495663_0106638 3300046525 Bacteria 927
263 Ga0495609_0097962 3300046538 Bacteria 1272
264 Ga0495633_0045125 3300046558 Bacteria 2088
265 Ga0495633_0084469 3300046558 Bacteria 1476
266 Ga0495633_0118653 3300046558 Bacteria 1225
267 Ga0495633_0146661 3300046558 Bacteria 1090
268 Ga0495633_0201304 3300046558 Bacteria 914
269 Ga0495656_0012852 3300046615 Bacteria 3100
270 Ga0495670_0414566 3300046691 Bacteria 728
271 Ga0495671_0016012 3300046692 Bacteria 4011
272 Ga0495672_0113525 3300047320 Bacteria 1451
273 Ga0495681_0020212 3300047470 Bacteria 3617
274 Ga0495681_0094673 3300047470 Bacteria 1314
275 Ga0496100_0329832 3300048903 Bacteria 1148
276 Ga0496102_0114110 3300048905 Bacteria 2521
277 Ga0496103_0104338 3300048906 Bacteria 1796
278 Ga0496105_0057175 3300048908 Bacteria 3221
279 Ga0496106_1340582 3300048909 Bacteria 554
280 Ga0496109_0057232 3300048912 Bacteria 3558
281 Ga0496110_0098551 3300048913 Bacteria 2620
282 Ga0496111_0813886 3300048914 Bacteria 676
283 Ga0496113_0365676 3300048916 Bacteria 1157
284 Ga0496113_0525795 3300048916 Bacteria 949
285 Ga0496114_0012641 3300048917 Bacteria 6762
286 Ga0496116_0008552 3300048919 Bacteria 8865
287 Ga0496117_0000446 3300048920 Bacteria 68559
288 Ga0496117_0049405 3300048920 Bacteria 2992
289 Ga0496117_0059616 3300048920 Bacteria 2635
290 Ga0496117_0122453 3300048920 Bacteria 1595
291 Ga0496117_0145823 3300048920 Bacteria 1409
292 Ga0496117_0229375 3300048920 Bacteria 1027
293 Ga0496118_0004210 3300048921 Bacteria 17288
294 Ga0496118_0014133 3300048921 Bacteria 7487
295 Ga0496118_0043362 3300048921 Bacteria 3537
296 Ga0496118_0072929 3300048921 Bacteria 2462
297 Ga0496118_0076525 3300048921 Bacteria 2379
298 Ga0496118_0086448 3300048921 Bacteria 2178
299 Ga0496118_0099723 3300048921 Bacteria 1967
300 Ga0496118_0110950 3300048921 Bacteria 1820
301 Ga0496118_0126767 3300048921 Bacteria 1649
302 Ga0496118_0247714 3300048921 Bacteria 1015
303 Ga0496119_0000211 3300048922 Bacteria 83064
304 Ga0496119_0017246 3300048922 Bacteria 5441
305 Ga0496119_0044448 3300048922 Bacteria 2796
306 Ga0496120_0000102 3300048923 Bacteria 142902
307 Ga0496120_0000432 3300048923 Bacteria 66285
308 Ga0496121_0016903 3300048924 Bacteria 7499
309 Ga0496121_0042072 3300048924 Bacteria 3981
310 Ga0496121_0043961 3300048924 Bacteria 3861
311 Ga0496121_0096923 3300048924 Bacteria 2287
312 Ga0496121_0120757 3300048924 Bacteria 1979
313 Ga0496121_0374694 3300048924 Bacteria 940
314 Ga0496121_0692868 3300048924 Bacteria 614
315 Ga0496122_0000158 3300048925 Bacteria 159352
316 Ga0496122_0025404 3300048925 Bacteria 5144
317 Ga0496122_0052299 3300048925 Bacteria 3093
318 Ga0496122_0083272 3300048925 Bacteria 2218
319 Ga0496122_0091027 3300048925 Bacteria 2078
320 Ga0496122_0103883 3300048925 Bacteria 1889
321 Ga0496122_0397529 3300048925 Bacteria 701
322 Ga0496122_0534167 3300048925 Bacteria 562
323 Ga0496123_0000120 3300048926 Bacteria 159406
324 Ga0496123_0087396 3300048926 Bacteria 1865
325 Ga0496123_0097319 3300048926 Bacteria 1724
326 Ga0496123_0128224 3300048926 Bacteria 1412
327 Ga0496123_0162715 3300048926 Bacteria 1187
328 Ga0496123_0267700 3300048926 Bacteria 833
329 Ga0496123_0289918 3300048926 Bacteria 786
330 Ga0496123_0346292 3300048926 Bacteria 693
331 Ga0496123_0447967 3300048926 Bacteria 575
332 Ga0496124_0001894 3300048927 Bacteria 28749
333 Ga0496124_0003150 3300048927 Bacteria 20397
334 Ga0496124_0013372 3300048927 Bacteria 8014
335 Ga0496124_0015478 3300048927 Bacteria 7309
336 Ga0496124_0022295 3300048927 Bacteria 5809
337 Ga0496124_0083776 3300048927 Bacteria 2615
338 Ga0496124_0096054 3300048927 Bacteria 2408
339 Ga0496124_0198392 3300048927 Bacteria 1528
340 Ga0496124_0395113 3300048927 Bacteria 961
341 Ga0496124_0604509 3300048927 Bacteria 712
342 Ga0496125_0007655 3300048928 Bacteria 11448
343 Ga0496125_0017369 3300048928 Bacteria 6863
344 Ga0496125_0029116 3300048928 Bacteria 4970
345 Ga0496125_0082543 3300048928 Bacteria 2449
346 Ga0496125_0121889 3300048928 Bacteria 1857
347 Ga0496125_0371909 3300048928 Bacteria 846
348 Ga0496125_0431513 3300048928 Bacteria 760
349 Ga0496126_0005495 3300048929 Bacteria 14446
350 Ga0496126_0037693 3300048929 Bacteria 4508
351 Ga0496126_0102559 3300048929 Bacteria 2501
352 Ga0496126_0118597 3300048929 Bacteria 2297
353 Ga0496126_0134283 3300048929 Bacteria 2136
354 Ga0496126_0282013 3300048929 Bacteria 1376
355 Ga0496126_0291093 3300048929 Bacteria 1350
356 Ga0501034_0000147 3300049571 Bacteria 132629
357 Ga0501034_0021375 3300049571 Bacteria 6597
358 Ga0501034_0109495 3300049571 Bacteria 2753
359 Ga0501034_1633424 3300049571 Bacteria 517
360 Ga0501034_1672151 3300049571 Bacteria 509
361 nmdc:mga03n38_929499_c1 3300050490 Bacteria 512
362 nmdc:mga00v17_464551_c1 3300050491 Bacteria 821
363 nmdc:mga0yw44_181580_c1 3300050492 Bacteria 1385
364 Ga0495612_0303055 3300053078 Bacteria 717
365 Ga0500572_206553 3300053111 Bacteria 643
366 Ga0500658_0335703 3300053134 Bacteria 694

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046691 Ga0495670_0414566 Ga0495670_0414566_46_369 107
2 iso_pu_bacteria 2571042365 2572256237 120
3 iso_pu_bacteria 2576861471 2578458833 120
4 iso_pu_bacteria 2643221559 2643815720 120
5 iso_pu_bacteria 2643221562 2643829851 120
6 iso_pu_bacteria 2643221579 2643908886 120
7 iso_pu_bacteria 2643221586 2643940775 120
8 iso_pu_bacteria 2643221612 2644080178 120
9 iso_pu_bacteria 2643221727 2644695774 120
10 iso_pu_bacteria 2747842428 2747948854 120
11 iso_pu_bacteria 2765235840 2765578553 120
12 iso_pu_bacteria 2816332141 2816516631 120
13 iso_pu_bacteria 2818991457 2819659778 120
14 iso_pu_bacteria 2842391507 2842392717 120
15 iso_pu_bacteria 2842757796 2842758513 120
16 iso_pu_bacteria 2842780639 2842783626 120
17 iso_pu_bacteria 2852649853 2852651189 120
18 iso_pu_bacteria 2852684882 2852685394 120
19 iso_pu_bacteria 2857442823 2857445336 120
20 iso_pu_bacteria 2919089067 2919092567 120
21 iso_pu_bacteria 2919130084 2919131509 120
22 iso_pu_bacteria 2928496128 2928496151 120
23 iso_pu_bacteria 2929195423 2929198072 120
24 iso_pu_bacteria 2931380184 2931381176 120
25 iso_pu_bacteria 2939622612 2939622825 120
26 iso_pu_bacteria 2939626828 2939629734 120
27 iso_pu_bacteria 2961047084 2961047947 120
28 iso_pu_bacteria 2961064222 2961065664 120
29 iso_pu_bacteria 8002869464 8002871579 120
30 iso_pu_bacteria 8021622325 8021624415 120
31 iso_pu_bacteria 8021626552 8021628091 120
32 iso_pu_bacteria 8021648035 8021651017 120
33 3300003323 rootH1_10201722 rootH1_102017223 122
34 3300005347 Ga0070668_100078684 Ga0070668_1000786844 122
35 3300009177 Ga0105248_11402778 Ga0105248_114027781 122
36 3300010375 Ga0105239_12006733 Ga0105239_120067331 122
37 3300025972 Ga0207668_10118608 Ga0207668_101186082 122
38 3300006237 Ga0097621_100149563 Ga0097621_1001495633 123
39 3300006881 Ga0068865_101079898 Ga0068865_1010798982 123
40 3300014969 Ga0157376_10164688 Ga0157376_101646883 123
41 3300017792 Ga0163161_10386962 Ga0163161_103869623 123
42 3300025938 Ga0207704_10706844 Ga0207704_107068442 123
43 3300041404 Ga0439436_0081025 Ga0439436_0081025_309_680 123
44 3300041406 Ga0439439_0248520 Ga0439439_0248520_109_480 123
45 3300041453 Ga0451797_1283472 Ga0451797_1283472_84_455 123
46 3300041456 Ga0451795_0613894 Ga0451795_0613894_511_882 123
47 3300041509 Ga0451843_1674354 Ga0451843_1674354_136_507 123
48 3300041512 Ga0451853_3182570 Ga0451853_3182570_156_527 123
49 3300041999 Ga0439433_0013792 Ga0439433_0013792_860_1231 123
50 3300042007 Ga0439449_0081714 Ga0439449_0081714_260_631 123
51 3300042014 Ga0439457_033134 Ga0439457_033134_31_402 123
52 3300042435 Ga0439434_0069185 Ga0439434_0069185_119_490 123
53 3300046522 Ga0495643_0138920 Ga0495643_0138920_470_841 123
54 3300046525 Ga0495663_0007180 Ga0495663_0007180_1251_1622 123
55 3300046692 Ga0495671_0016012 Ga0495671_0016012_1595_1966 123
56 3300049571 Ga0501034_1633424 Ga0501034_1633424_12_383 123
57 2162886007 SwRhRL2b_contig_136925 SwRhRL2b_0185.00007380 124
58 3300003323 rootH1_10020036 rootH1_100200366 124
59 3300003781 Ga0055536_1002522 Ga0055536_10025227 124
60 3300003781 Ga0055536_1005660 Ga0055536_10056603 124
61 3300003794 Ga0055531_10014780 Ga0055531_100147802 124
62 3300003856 Ga0058692_1000002 Ga0058692_1000002165 124
63 3300003856 Ga0058692_1000006 Ga0058692_100000651 124
64 3300005289 Ga0065704_10074187 Ga0065704_100741873 124
65 3300005289 Ga0065704_10095753 Ga0065704_100957532 124
66 3300005289 Ga0065704_10209784 Ga0065704_102097842 124
67 3300005331 Ga0070670_100021104 Ga0070670_1000211044 124
68 3300005338 Ga0068868_100345498 Ga0068868_1003454982 124
69 3300005344 Ga0070661_100026423 Ga0070661_1000264233 124
70 3300005347 Ga0070668_100163472 Ga0070668_1001634721 124
71 3300005347 Ga0070668_100460351 Ga0070668_1004603511 124
72 3300005355 Ga0070671_100334444 Ga0070671_1003344442 124
73 3300005365 Ga0070688_100134004 Ga0070688_1001340042 124
74 3300005366 Ga0070659_100817043 Ga0070659_1008170431 124
75 3300005367 Ga0070667_100258541 Ga0070667_1002585411 124
76 3300005435 Ga0070714_100042752 Ga0070714_1000427524 124
77 3300005437 Ga0070710_10042905 Ga0070710_100429052 124
78 3300005455 Ga0070663_100004878 Ga0070663_1000048784 124
79 3300005455 Ga0070663_100024628 Ga0070663_1000246282 124
80 3300005457 Ga0070662_100008490 Ga0070662_1000084904 124
81 3300005459 Ga0068867_101851395 Ga0068867_1018513951 124
82 3300005466 Ga0070685_10003480 Ga0070685_100034807 124
83 3300005539 Ga0068853_100039275 Ga0068853_1000392752 124
84 3300005539 Ga0068853_100062215 Ga0068853_1000622153 124
85 3300005548 Ga0070665_100001482 Ga0070665_1000014824 124
86 3300005548 Ga0070665_100610451 Ga0070665_1006104511 124
87 3300005548 Ga0070665_101130413 Ga0070665_1011304132 124
88 3300005563 Ga0068855_100212061 Ga0068855_1002120615 124
89 3300005563 Ga0068855_101022706 Ga0068855_1010227062 124
90 3300005577 Ga0068857_100101039 Ga0068857_1001010394 124
91 3300005577 Ga0068857_100721452 Ga0068857_1007214522 124
92 3300005578 Ga0068854_100009719 Ga0068854_1000097193 124
93 3300005578 Ga0068854_100951999 Ga0068854_1009519991 124
94 3300005614 Ga0068856_101079899 Ga0068856_1010798992 124
95 3300005616 Ga0068852_100005452 Ga0068852_1000054527 124
96 3300005616 Ga0068852_100136432 Ga0068852_1001364324 124
97 3300005616 Ga0068852_100167428 Ga0068852_1001674283 124
98 3300005616 Ga0068852_101190334 Ga0068852_1011903342 124
99 3300005617 Ga0068859_100142859 Ga0068859_1001428591 124
100 3300005834 Ga0068851_10047128 Ga0068851_100471282 124
101 3300005841 Ga0068863_100550543 Ga0068863_1005505432 124
102 3300005842 Ga0068858_100001325 Ga0068858_10000132515 124
103 3300006038 Ga0075365_10068746 Ga0075365_100687463 124
104 3300006051 Ga0075364_10019841 Ga0075364_100198414 124
105 3300006186 Ga0075369_10246136 Ga0075369_102461362 124
106 3300006237 Ga0097621_100198994 Ga0097621_1001989942 124
107 3300006237 Ga0097621_100650751 Ga0097621_1006507511 124
108 3300006358 Ga0068871_100039070 Ga0068871_1000390705 124
109 3300006881 Ga0068865_101055872 Ga0068865_1010558722 124
110 3300006931 Ga0097620_100142868 Ga0097620_1001428683 124
111 3300009011 Ga0105251_10002861 Ga0105251_100028616 124
112 3300009036 Ga0105244_10099134 Ga0105244_100991342 124
113 3300009036 Ga0105244_10108544 Ga0105244_101085443 124
114 3300009093 Ga0105240_10001278 Ga0105240_100012787 124
115 3300009093 Ga0105240_10313608 Ga0105240_103136083 124
116 3300009174 Ga0105241_10096475 Ga0105241_100964752 124
117 3300009177 Ga0105248_10822911 Ga0105248_108229112 124
118 3300009545 Ga0105237_10294394 Ga0105237_102943942 124
119 3300009545 Ga0105237_10295551 Ga0105237_102955513 124
120 3300009551 Ga0105238_10032728 Ga0105238_100327284 124
121 3300009551 Ga0105238_10055319 Ga0105238_100553193 124
122 3300009551 Ga0105238_10086971 Ga0105238_100869711 124
123 3300009551 Ga0105238_10092552 Ga0105238_100925524 124
124 3300009553 Ga0105249_10025839 Ga0105249_100258394 124
125 3300010375 Ga0105239_10221435 Ga0105239_102214351 124
126 3300013100 Ga0157373_10582345 Ga0157373_105823451 124
127 3300013102 Ga0157371_10002030 Ga0157371_1000203014 124
128 3300013102 Ga0157371_10234531 Ga0157371_102345312 124
129 3300013102 Ga0157371_10252853 Ga0157371_102528532 124
130 3300013104 Ga0157370_10004741 Ga0157370_100047416 124
131 3300013104 Ga0157370_10013751 Ga0157370_100137518 124
132 3300013104 Ga0157370_10060548 Ga0157370_100605484 124
133 3300013104 Ga0157370_10096403 Ga0157370_100964031 124
134 3300013104 Ga0157370_10123157 Ga0157370_101231574 124
135 3300013104 Ga0157370_10582894 Ga0157370_105828943 124
136 3300013105 Ga0157369_10077148 Ga0157369_100771481 124
137 3300013105 Ga0157369_10164205 Ga0157369_101642052 124
138 3300013296 Ga0157374_10142473 Ga0157374_101424733 124
139 3300013297 Ga0157378_10000043 Ga0157378_1000004363 124
140 3300013306 Ga0163162_10000015 Ga0163162_10000015141 124
141 3300013308 Ga0157375_10542950 Ga0157375_105429501 124
142 3300014497 Ga0182008_10000116 Ga0182008_1000011663 124
143 3300014497 Ga0182008_10020426 Ga0182008_100204264 124
144 3300014497 Ga0182008_10044098 Ga0182008_100440982 124
145 3300014968 Ga0157379_11843514 Ga0157379_118435141 124
146 3300014969 Ga0157376_10784974 Ga0157376_107849742 124
147 3300015261 Ga0182006_1032816 Ga0182006_10328163 124
148 3300015261 Ga0182006_1057289 Ga0182006_10572891 124
149 3300015261 Ga0182006_1088152 Ga0182006_10881522 124
150 3300015262 Ga0182007_10002719 Ga0182007_1000271911 124
151 3300015262 Ga0182007_10014048 Ga0182007_100140484 124
152 3300015265 Ga0182005_1000655 Ga0182005_100065511 124
153 3300017792 Ga0163161_10013088 Ga0163161_100130887 124
154 3300017792 Ga0163161_10055352 Ga0163161_100553524 124
155 3300017792 Ga0163161_10076603 Ga0163161_100766033 124
156 3300017792 Ga0163161_10492187 Ga0163161_104921872 124
157 3300025261 Ga0209233_1008257 Ga0209233_10082573 124
158 3300025292 Ga0209676_1000047 Ga0209676_1000047135 124
159 3300025294 Ga0209025_1071055 Ga0209025_10710551 124
160 3300025298 Ga0209050_1017481 Ga0209050_10174814 124
161 3300025304 Ga0209257_1000302 Ga0209257_100030290 124
162 3300025304 Ga0209257_1041945 Ga0209257_10419452 124
163 3300025321 Ga0207656_10001827 Ga0207656_100018277 124
164 3300025735 Ga0207713_1000890 Ga0207713_10008904 124
165 3300025898 Ga0207692_10041733 Ga0207692_100417334 124
166 3300025903 Ga0207680_10003078 Ga0207680_100030788 124
167 3300025904 Ga0207647_10002915 Ga0207647_1000291512 124
168 3300025911 Ga0207654_10508193 Ga0207654_105081932 124
169 3300025913 Ga0207695_10000033 Ga0207695_10000033364 124
170 3300025913 Ga0207695_10005921 Ga0207695_100059214 124
171 3300025913 Ga0207695_10034290 Ga0207695_100342905 124
172 3300025914 Ga0207671_10013246 Ga0207671_100132467 124
173 3300025914 Ga0207671_10034031 Ga0207671_100340314 124
174 3300025920 Ga0207649_10041331 Ga0207649_100413313 124
175 3300025924 Ga0207694_10002668 Ga0207694_1000266810 124
176 3300025924 Ga0207694_10003738 Ga0207694_100037388 124
177 3300025924 Ga0207694_10005276 Ga0207694_100052762 124
178 3300025925 Ga0207650_10002390 Ga0207650_100023905 124
179 3300025925 Ga0207650_10009991 Ga0207650_100099913 124
180 3300025929 Ga0207664_10046775 Ga0207664_100467754 124
181 3300025931 Ga0207644_10053772 Ga0207644_100537722 124
182 3300025931 Ga0207644_10439985 Ga0207644_104399852 124
183 3300025932 Ga0207690_11321566 Ga0207690_113215662 124
184 3300025933 Ga0207706_10052916 Ga0207706_100529163 124
185 3300025935 Ga0207709_10046489 Ga0207709_100464892 124
186 3300025935 Ga0207709_10084076 Ga0207709_100840761 124
187 3300025941 Ga0207711_10135621 Ga0207711_101356214 124
188 3300025945 Ga0207679_10518473 Ga0207679_105184732 124
189 3300025949 Ga0207667_10660291 Ga0207667_106602911 124
190 3300025961 Ga0207712_10000165 Ga0207712_1000016527 124
191 3300025972 Ga0207668_10879608 Ga0207668_108796083 124
192 3300025981 Ga0207640_10732262 Ga0207640_107322621 124
193 3300025986 Ga0207658_10016117 Ga0207658_100161174 124
194 3300025986 Ga0207658_11620687 Ga0207658_116206872 124
195 3300026023 Ga0207677_10060979 Ga0207677_100609792 124
196 3300026035 Ga0207703_10000553 Ga0207703_100005539 124
197 3300026041 Ga0207639_10000217 Ga0207639_1000021722 124
198 3300026041 Ga0207639_10008722 Ga0207639_100087221 124
199 3300026067 Ga0207678_10005262 Ga0207678_1000526211 124
200 3300026067 Ga0207678_10073285 Ga0207678_100732854 124
201 3300026078 Ga0207702_10005747 Ga0207702_1000574714 124
202 3300026078 Ga0207702_10060529 Ga0207702_100605293 124
203 3300026089 Ga0207648_10158657 Ga0207648_101586572 124
204 3300026095 Ga0207676_10487472 Ga0207676_104874721 124
205 3300026116 Ga0207674_10050213 Ga0207674_100502133 124
206 3300026116 Ga0207674_10232430 Ga0207674_102324302 124
207 3300026142 Ga0207698_10043839 Ga0207698_100438394 124
208 3300026142 Ga0207698_10138025 Ga0207698_101380251 124
209 3300026142 Ga0207698_10617308 Ga0207698_106173082 124
210 3300027312 Ga0209371_1000004 Ga0209371_1000004373 124
211 3300027312 Ga0209371_1000016 Ga0209371_100001651 124
212 3300028379 Ga0268266_10000006 Ga0268266_100000061158 124
213 3300028379 Ga0268266_10192460 Ga0268266_101924604 124
214 3300028379 Ga0268266_10564529 Ga0268266_105645292 124
215 3300028379 Ga0268266_11001992 Ga0268266_110019921 124
216 3300028794 Ga0307515_10144069 Ga0307515_101440693 124
217 3300030500 Ga0268256_1000005 Ga0268256_1000005672 124
218 3300030500 Ga0268256_1000015 Ga0268256_1000015519 124
219 3300030731 Ga0316177_1140976 Ga0316177_11409762 124
220 3300030732 Ga0316176_1196701 Ga0316176_11967011 124
221 3300030745 Ga0316182_1404932 Ga0316182_14049321 124
222 3300031456 Ga0307513_10010266 Ga0307513_100102667 124
223 3300031456 Ga0307513_10506697 Ga0307513_105066972 124
224 3300031548 Ga0307408_100647625 Ga0307408_1006476252 124
225 3300031548 Ga0307408_100714193 Ga0307408_1007141932 124
226 3300031616 Ga0307508_10010006 Ga0307508_100100065 124
227 3300031730 Ga0307516_10035322 Ga0307516_100353222 124
228 3300031731 Ga0307405_10361182 Ga0307405_103611822 124
229 3300031731 Ga0307405_10708457 Ga0307405_107084572 124
230 3300031911 Ga0307412_10090238 Ga0307412_100902382 124
231 3300031911 Ga0307412_10403228 Ga0307412_104032282 124
232 3300032004 Ga0307414_10002380 Ga0307414_100023804 124
233 3300032004 Ga0307414_10026483 Ga0307414_100264835 124
234 3300032004 Ga0307414_10289971 Ga0307414_102899713 124
235 3300032004 Ga0307414_10442889 Ga0307414_104428893 124
236 3300032004 Ga0307414_11302418 Ga0307414_113024181 124
237 3300037853 Ga0436364_0208968 Ga0436364_0208968_74_451 124
238 3300038705 Ga0237819_02887 Ga0237819_02887_1815_2189 124
239 3300039145 Ga0237816_00163 Ga0237816_00163_192_569 124
240 3300041404 Ga0439436_0008344 Ga0439436_0008344_2140_2514 124
241 3300041404 Ga0439436_0011948 Ga0439436_0011948_124_507 124
242 3300041406 Ga0439439_0002962 Ga0439439_0002962_1194_1568 124
243 3300041406 Ga0439439_0017171 Ga0439439_0017171_683_1066 124
244 3300041406 Ga0439439_0100207 Ga0439439_0100207_174_548 124
245 3300041413 Ga0439465_0009636 Ga0439465_0009636_2009_2383 124
246 3300041413 Ga0439465_0037926 Ga0439465_0037926_542_916 124
247 3300041413 Ga0439465_0297793 Ga0439465_0297793_57_431 124
248 3300041441 Ga0451787_289771 Ga0451787_289771_704_1081 124
249 3300041451 Ga0451791_0734992 Ga0451791_0734992_2416_2790 124
250 3300041451 Ga0451791_0893513 Ga0451791_0893513_60_437 124
251 3300041452 Ga0451793_0100418 Ga0451793_0100418_427_801 124
252 3300041452 Ga0451793_1036736 Ga0451793_1036736_1810_2184 124
253 3300041452 Ga0451793_1404216 Ga0451793_1404216_858_1235 124
254 3300041453 Ga0451797_0199294 Ga0451797_0199294_239_613 124
255 3300041453 Ga0451797_0405581 Ga0451797_0405581_73_447 124
256 3300041453 Ga0451797_0515144 Ga0451797_0515144_686_1087 124
257 3300041453 Ga0451797_0892303 Ga0451797_0892303_190_564 124
258 3300041453 Ga0451797_1529956 Ga0451797_1529956_155_592 124
259 3300041458 Ga0451798_0552853 Ga0451798_0552853_179_553 124
260 3300041459 Ga0451800_0416075 Ga0451800_0416075_4147_4521 124
261 3300041459 Ga0451800_0860938 Ga0451800_0860938_185_559 124
262 3300041459 Ga0451800_1591334 Ga0451800_1591334_88_465 124
263 3300041460 Ga0451802_1509754 Ga0451802_1509754_77_454 124
264 3300041463 Ga0451804_0778980 Ga0451804_0778980_461_835 124
265 3300041486 Ga0451807_1726329 Ga0451807_1726329_488_862 124
266 3300041486 Ga0451807_2042944 Ga0451807_2042944_517_894 124
267 3300041486 Ga0451807_2045398 Ga0451807_2045398_572_946 124
268 3300041491 Ga0451833_0868058 Ga0451833_0868058_543_917 124
269 3300041494 Ga0451837_1302419 Ga0451837_1302419_10_411 124
270 3300041496 Ga0451839_0410190 Ga0451839_0410190_44_418 124
271 3300041509 Ga0451843_0541203 Ga0451843_0541203_1734_2111 124
272 3300041509 Ga0451843_0588876 Ga0451843_0588876_560_961 124
273 3300041509 Ga0451843_1551973 Ga0451843_1551973_106_480 124
274 3300041512 Ga0451853_1230542 Ga0451853_1230542_51_425 124
275 3300041997 Ga0439431_0129154 Ga0439431_0129154_273_647 124
276 3300042006 Ga0439432_127707 Ga0439432_127707_62_436 124
277 3300042006 Ga0439432_131845 Ga0439432_131845_84_458 124
278 3300042007 Ga0439449_0299153 Ga0439449_0299153_157_540 124
279 3300042010 Ga0439452_129142 Ga0439452_129142_70_453 124
280 3300042015 Ga0439462_0003666 Ga0439462_0003666_3009_3383 124
281 3300042115 Ga0450911_004925 Ga0450911_004925_1100_1474 124
282 3300042533 Ga0450901_007944 Ga0450901_007944_310_684 124
283 3300046453 Ga0495627_015436 Ga0495627_015436_16_390 124
284 3300046453 Ga0495627_017553 Ga0495627_017553_277_651 124
285 3300046460 Ga0495638_0009055 Ga0495638_0009055_4333_4707 124
286 3300046471 Ga0495650_0197116 Ga0495650_0197116_231_605 124
287 3300046474 Ga0495605_0267825 Ga0495605_0267825_265_639 124
288 3300046501 Ga0495607_0013695 Ga0495607_0013695_2344_2718 124
289 3300046507 Ga0495606_0009016 Ga0495606_0009016_6421_6795 124
290 3300046512 Ga0495610_0052563 Ga0495610_0052563_350_724 124
291 3300046512 Ga0495610_0102934 Ga0495610_0102934_378_752 124
292 3300046513 Ga0495616_0035011 Ga0495616_0035011_312_686 124
293 3300046513 Ga0495616_0122923 Ga0495616_0122923_237_611 124
294 3300046525 Ga0495663_0021651 Ga0495663_0021651_433_807 124
295 3300046525 Ga0495663_0023067 Ga0495663_0023067_413_787 124
296 3300046525 Ga0495663_0106638 Ga0495663_0106638_258_632 124
297 3300046538 Ga0495609_0097962 Ga0495609_0097962_154_528 124
298 3300046558 Ga0495633_0045125 Ga0495633_0045125_309_683 124
299 3300046558 Ga0495633_0084469 Ga0495633_0084469_379_753 124
300 3300046558 Ga0495633_0118653 Ga0495633_0118653_432_806 124
301 3300046558 Ga0495633_0146661 Ga0495633_0146661_436_810 124
302 3300046558 Ga0495633_0201304 Ga0495633_0201304_186_566 124
303 3300046615 Ga0495656_0012852 Ga0495656_0012852_2132_2506 124
304 3300047320 Ga0495672_0113525 Ga0495672_0113525_324_698 124
305 3300047470 Ga0495681_0020212 Ga0495681_0020212_1806_2180 124
306 3300047470 Ga0495681_0094673 Ga0495681_0094673_681_1055 124
307 3300048903 Ga0496100_0329832 Ga0496100_0329832_455_850 124
308 3300048905 Ga0496102_0114110 Ga0496102_0114110_620_994 124
309 3300048906 Ga0496103_0104338 Ga0496103_0104338_254_628 124
310 3300048908 Ga0496105_0057175 Ga0496105_0057175_1519_1893 124
311 3300048909 Ga0496106_1340582 Ga0496106_1340582_105_479 124
312 3300048912 Ga0496109_0057232 Ga0496109_0057232_1098_1493 124
313 3300048913 Ga0496110_0098551 Ga0496110_0098551_1098_1472 124
314 3300048914 Ga0496111_0813886 Ga0496111_0813886_239_613 124
315 3300048916 Ga0496113_0365676 Ga0496113_0365676_417_791 124
316 3300048916 Ga0496113_0525795 Ga0496113_0525795_208_582 124
317 3300048917 Ga0496114_0012641 Ga0496114_0012641_101_478 124
318 3300048919 Ga0496116_0008552 Ga0496116_0008552_1306_1680 124
319 3300048920 Ga0496117_0000446 Ga0496117_0000446_9124_9498 124
320 3300048920 Ga0496117_0049405 Ga0496117_0049405_311_685 124
321 3300048920 Ga0496117_0059616 Ga0496117_0059616_489_863 124
322 3300048920 Ga0496117_0122453 Ga0496117_0122453_96_470 124
323 3300048920 Ga0496117_0145823 Ga0496117_0145823_307_684 124
324 3300048920 Ga0496117_0229375 Ga0496117_0229375_438_812 124
325 3300048921 Ga0496118_0004210 Ga0496118_0004210_11080_11454 124
326 3300048921 Ga0496118_0014133 Ga0496118_0014133_400_774 124
327 3300048921 Ga0496118_0043362 Ga0496118_0043362_1137_1511 124
328 3300048921 Ga0496118_0072929 Ga0496118_0072929_957_1331 124
329 3300048921 Ga0496118_0076525 Ga0496118_0076525_1944_2318 124
330 3300048921 Ga0496118_0086448 Ga0496118_0086448_1093_1467 124
331 3300048921 Ga0496118_0099723 Ga0496118_0099723_1136_1510 124
332 3300048921 Ga0496118_0110950 Ga0496118_0110950_1016_1393 124
333 3300048921 Ga0496118_0126767 Ga0496118_0126767_1120_1494 124
334 3300048921 Ga0496118_0247714 Ga0496118_0247714_231_605 124
335 3300048922 Ga0496119_0000211 Ga0496119_0000211_2415_2789 124
336 3300048922 Ga0496119_0017246 Ga0496119_0017246_3531_3905 124
337 3300048922 Ga0496119_0044448 Ga0496119_0044448_1989_2363 124
338 3300048923 Ga0496120_0000102 Ga0496120_0000102_100485_100859 124
339 3300048923 Ga0496120_0000432 Ga0496120_0000432_64372_64746 124
340 3300048924 Ga0496121_0016903 Ga0496121_0016903_136_510 124
341 3300048924 Ga0496121_0042072 Ga0496121_0042072_2326_2700 124
342 3300048924 Ga0496121_0043961 Ga0496121_0043961_461_835 124
343 3300048924 Ga0496121_0096923 Ga0496121_0096923_1083_1457 124
344 3300048924 Ga0496121_0120757 Ga0496121_0120757_597_971 124
345 3300048924 Ga0496121_0374694 Ga0496121_0374694_136_510 124
346 3300048924 Ga0496121_0692868 Ga0496121_0692868_186_560 124
347 3300048925 Ga0496122_0000158 Ga0496122_0000158_114426_114800 124
348 3300048925 Ga0496122_0025404 Ga0496122_0025404_2966_3340 124
349 3300048925 Ga0496122_0052299 Ga0496122_0052299_2132_2506 124
350 3300048925 Ga0496122_0083272 Ga0496122_0083272_1288_1662 124
351 3300048925 Ga0496122_0091027 Ga0496122_0091027_954_1328 124
352 3300048925 Ga0496122_0103883 Ga0496122_0103883_763_1137 124
353 3300048925 Ga0496122_0397529 Ga0496122_0397529_268_642 124
354 3300048925 Ga0496122_0534167 Ga0496122_0534167_20_394 124
355 3300048926 Ga0496123_0000120 Ga0496123_0000120_44553_44927 124
356 3300048926 Ga0496123_0087396 Ga0496123_0087396_881_1255 124
357 3300048926 Ga0496123_0097319 Ga0496123_0097319_63_437 124
358 3300048926 Ga0496123_0128224 Ga0496123_0128224_65_439 124
359 3300048926 Ga0496123_0162715 Ga0496123_0162715_751_1125 124
360 3300048926 Ga0496123_0267700 Ga0496123_0267700_45_419 124
361 3300048926 Ga0496123_0289918 Ga0496123_0289918_57_431 124
362 3300048926 Ga0496123_0346292 Ga0496123_0346292_75_449 124
363 3300048926 Ga0496123_0447967 Ga0496123_0447967_145_519 124
364 3300048927 Ga0496124_0001894 Ga0496124_0001894_6653_7027 124
365 3300048927 Ga0496124_0003150 Ga0496124_0003150_12703_13077 124
366 3300048927 Ga0496124_0013372 Ga0496124_0013372_7202_7576 124
367 3300048927 Ga0496124_0015478 Ga0496124_0015478_6630_7004 124
368 3300048927 Ga0496124_0022295 Ga0496124_0022295_2375_2749 124
369 3300048927 Ga0496124_0083776 Ga0496124_0083776_1937_2311 124
370 3300048927 Ga0496124_0096054 Ga0496124_0096054_250_624 124
371 3300048927 Ga0496124_0198392 Ga0496124_0198392_316_690 124
372 3300048927 Ga0496124_0395113 Ga0496124_0395113_148_522 124
373 3300048927 Ga0496124_0604509 Ga0496124_0604509_114_488 124
374 3300048928 Ga0496125_0007655 Ga0496125_0007655_10672_11046 124
375 3300048928 Ga0496125_0017369 Ga0496125_0017369_54_428 124
376 3300048928 Ga0496125_0029116 Ga0496125_0029116_2324_2698 124
377 3300048928 Ga0496125_0082543 Ga0496125_0082543_683_1057 124
378 3300048928 Ga0496125_0121889 Ga0496125_0121889_1081_1455 124
379 3300048928 Ga0496125_0371909 Ga0496125_0371909_54_428 124
380 3300048928 Ga0496125_0431513 Ga0496125_0431513_10_384 124
381 3300048929 Ga0496126_0005495 Ga0496126_0005495_1529_1903 124
382 3300048929 Ga0496126_0037693 Ga0496126_0037693_1557_1931 124
383 3300048929 Ga0496126_0102559 Ga0496126_0102559_1186_1560 124
384 3300048929 Ga0496126_0118597 Ga0496126_0118597_994_1368 124
385 3300048929 Ga0496126_0134283 Ga0496126_0134283_945_1319 124
386 3300048929 Ga0496126_0282013 Ga0496126_0282013_218_592 124
387 3300048929 Ga0496126_0291093 Ga0496126_0291093_378_752 124
388 3300049571 Ga0501034_0000147 Ga0501034_0000147_266_643 124
389 3300049571 Ga0501034_0021375 Ga0501034_0021375_1899_2282 124
390 3300049571 Ga0501034_0109495 Ga0501034_0109495_97_474 124
391 3300049571 Ga0501034_1672151 Ga0501034_1672151_109_486 124
392 3300050490 nmdc:mga03n38_929499_c1 nmdc:mga03n38_929499_c1_105_479 124
393 3300050491 nmdc:mga00v17_464551_c1 nmdc:mga00v17_464551_c1_56_430 124
394 3300050492 nmdc:mga0yw44_181580_c1 nmdc:mga0yw44_181580_c1_735_1109 124
395 3300053078 Ga0495612_0303055 Ga0495612_0303055_77_469 124
396 3300053111 Ga0500572_206553 Ga0500572_206553_88_462 124
397 3300053134 Ga0500658_0335703 Ga0500658_0335703_192_566 124

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04430

DUF498

Protein of unknown function (DUF498/DUF598)

40

147

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cpk-assembly1.cif.gz_A crystal structure of the q7w7n7_borpa protein from bordetella parapertussis. northeast structural genomics consortium target ber31 0.9136 12 123
2fvt-assembly1.cif.gz_A nmr structure of the rpa2829 protein from rhodopseudomonas palustris: northeast structural genomics target rpr43 0.8642 31 123
3cpk-assembly1.cif.gz_A crystal structure of the q7w7n7_borpa protein from bordetella parapertussis. northeast structural genomics consortium target ber31 0.8633 12 123
2gm2-assembly1.cif.gz_A nmr structure of xanthomonas campestris xcc1710: northeast structural genomics consortium target xcr35 0.8609 1 122
2fi9-assembly1.cif.gz_A the crystal structure of an outer membrane protein from the bartonella henselae 0.8569 12 122
ID Description Score Start End Superfamily
af_A0A0P0VZT1_1_69_3.40.50.10190 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;BRCT domain 0.9424 65 124 3.40.50.10190
2gm2A01 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Mth938; Chain: A,;MTH938-like 0.9298 12 123 3.40.1230.10
2gm2A01 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Mth938; Chain: A,;MTH938-like 0.922 12 123 3.40.1230.10
3cpkA00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Mth938; Chain: A,;MTH938-like 0.8986 12 123 3.40.1230.10
af_Q9BU61_55_171_3.40.1230.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Mth938; Chain: A,;MTH938-like 0.8882 12 124 3.40.1230.10
ID Description Score Start End GO Terms
AF-A0A856Y668-F1-model_v4 deleted 0.9798 7 124
AF-A0A7Y1SJU8-F1-model_v4 deleted 0.974 33 114
AF-A0A3B0WPM6-F1-model_v4 Membrane protein 0.9693 32 122
AF-A0A7W9Z387-F1-model_v4 Xcc1710-like domain-containing protein 0.968 13 124
AF-A0A7C5Q7A3-F1-model_v4 Xcc1710-like domain-containing protein 0.9617 12 124

Feature Viewer

pLDDT pTM Quality
91.82 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map