F433685

General Info

Members Datasets Scaffolds Average Seq Length
397 199 794 395

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100000612|Ga0070690_1000006122
Length 454
Sequence MRAAASGWVSRCYFYRVLPFFATHNYRTGAQRPIPMRVLRFSQLKSVAALAFGSCEAESMETKSIYLAGAVRTPIGKFGGTLASLTAADLGVAVAVETLKRAGVNPEQVNESIWGCARQAGGGPNVARQITYRAQVPQSVPAFTVNQACGSGLKAIILAAQEIMLGRADVVLAGGTESMSRVPYFAEGARWGMRMGNTQLVDGMYRDGFNDPLSGLVMGETAENLAQRHEISRDEQDEYALRSQHRAAAAISSNRFSDEILALEVKGPKGQTITFAKDEHARSETTIQDLSKLKPVFASTGTVTAGNSSGITDGAAAVTVMSETAVNSSGSSPQARIVDYEITGVAPEIMGIGPVPAVRALLDRRNINLSDVDLIELNEAFAAQVIACDRELQFDQERLNVNGGAIALGHPIGCTGVRITTTLIHEMAKRKSKLGLATLCVSGGMGLALLLERV

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
148 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
159 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
160 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
163 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
176 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
177 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
178 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
179 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
180 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
181 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
182 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
183 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
184 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
196 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
199 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.25
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 1.51
Rhizosphere 96.47
Stem 0
Stem Tuber 0
Unclassified 1.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100000612 3300005330 Bacteria 18067
2 CNBas_1000117 3300000531 Unclassified 2548
3 JGI24751J29686_10000059 3300002459 Bacteria 61971
4 JGI25406J46586_10003254 3300003203 Bacteria 7647
5 JGI25406J46586_10009207 3300003203 Bacteria 4428
6 Ga0065712_10000122 3300005290 Bacteria 92508
7 Ga0065715_10018442 3300005293 Bacteria 2391
8 Ga0065715_10090470 3300005293 Bacteria 6916
9 Ga0065715_10109914 3300005293 Bacteria 2646
10 Ga0070676_10032085 3300005328 Bacteria 3007
11 Ga0070690_100002621 3300005330 Bacteria 9689
12 Ga0070690_100034804 3300005330 Bacteria 3157
13 Ga0070670_100000331 3300005331 Bacteria 39667
14 Ga0070670_100003188 3300005331 Bacteria 13540
15 Ga0070670_100072862 3300005331 Bacteria 2950
16 Ga0070670_100166814 3300005331 Bacteria 1909
17 Ga0068869_100001138 3300005334 Bacteria 15509
18 Ga0068869_100045839 3300005334 Bacteria 3149
19 Ga0068869_100111826 3300005334 Bacteria 2079
20 Ga0070680_100001278 3300005336 Bacteria 18191
21 Ga0070682_100000112 3300005337 Bacteria 72106
22 Ga0070682_100003103 3300005337 Bacteria 9209
23 Ga0070689_100003618 3300005340 Bacteria 10305
24 Ga0070689_100017859 3300005340 Bacteria 5215
25 Ga0070661_100061724 3300005344 Bacteria 2751
26 Ga0070692_10008307 3300005345 Bacteria 4626
27 Ga0070692_10014020 3300005345 Bacteria 3752
28 Ga0070669_100003676 3300005353 Bacteria 11066
29 Ga0070669_100043063 3300005353 Unclassified 3286
30 Ga0070675_100013223 3300005354 Bacteria 6485
31 Ga0070671_100001508 3300005355 Bacteria 17436
32 Ga0070671_100021955 3300005355 Bacteria 5213
33 Ga0070673_100066982 3300005364 Bacteria 2870
34 Ga0070659_100003624 3300005366 Bacteria 10995
35 Ga0070667_100035485 3300005367 Bacteria 4178
36 Ga0070703_10003790 3300005406 Bacteria 4279
37 Ga0070710_10056073 3300005437 Bacteria 2229
38 Ga0070701_10016940 3300005438 Bacteria 3399
39 Ga0070701_10081011 3300005438 Bacteria 1757
40 Ga0070705_100033983 3300005440 Bacteria 2847
41 Ga0070700_100000065 3300005441 Bacteria 76224
42 Ga0070700_100001252 3300005441 Bacteria 12586
43 Ga0070700_100093039 3300005441 Bacteria 1971
44 Ga0070694_100007515 3300005444 Bacteria 6650
45 Ga0070694_100015184 3300005444 Bacteria 4830
46 Ga0070694_100021993 3300005444 Bacteria 4083
47 Ga0070694_100132028 3300005444 Bacteria 1805
48 Ga0070708_100067550 3300005445 Bacteria 3211
49 Ga0070678_100025643 3300005456 Bacteria 3971
50 Ga0070662_100140118 3300005457 Bacteria 1873
51 Ga0070662_100247868 3300005457 Bacteria 1431
52 Ga0070681_10000089 3300005458 Bacteria 68795
53 Ga0070681_10001309 3300005458 Bacteria 21729
54 Ga0070681_10039195 3300005458 Bacteria 4750
55 Ga0068867_100015699 3300005459 Bacteria 5373
56 Ga0068867_100031099 3300005459 Bacteria 3853
57 Ga0068867_100070613 3300005459 Bacteria 2611
58 Ga0070706_100000984 3300005467 Bacteria 31023
59 Ga0070706_100001848 3300005467 Bacteria 21913
60 Ga0070706_100350731 3300005467 Bacteria 1375
61 Ga0070707_100085625 3300005468 Bacteria 3047
62 Ga0070698_100000826 3300005471 Bacteria 33892
63 Ga0070698_100009351 3300005471 Bacteria 10511
64 Ga0070698_100014216 3300005471 Bacteria 8414
65 Ga0070698_100020589 3300005471 Bacteria 6916
66 Ga0070698_100024276 3300005471 Bacteria 6326
67 Ga0070698_100042273 3300005471 Bacteria 4674
68 Ga0070699_100001908 3300005518 Bacteria 18830
69 Ga0070699_100003583 3300005518 Bacteria 13733
70 Ga0070699_100007411 3300005518 Bacteria 9550
71 Ga0070699_100043243 3300005518 Bacteria 3899
72 Ga0070699_100176991 3300005518 Bacteria 1892
73 Ga0070679_100000014 3300005530 Bacteria 150481
74 Ga0070684_100070149 3300005535 Bacteria 3083
75 Ga0070697_100000160 3300005536 Bacteria 54910
76 Ga0070697_100013377 3300005536 Bacteria 6436
77 Ga0070697_100067970 3300005536 Bacteria 2916
78 Ga0070697_100232556 3300005536 Bacteria 1572
79 Ga0068853_100016545 3300005539 Bacteria 6073
80 Ga0068853_100028789 3300005539 Bacteria 4675
81 Ga0070672_100020548 3300005543 Bacteria 4818
82 Ga0070672_100032475 3300005543 Bacteria 3939
83 Ga0070686_100000928 3300005544 Bacteria 16839
84 Ga0070686_100001875 3300005544 Bacteria 11714
85 Ga0070686_100017138 3300005544 Bacteria 4228
86 Ga0070696_100029102 3300005546 Bacteria 3772
87 Ga0070696_100051866 3300005546 Bacteria 2853
88 Ga0070696_100112939 3300005546 Bacteria 1958
89 Ga0070693_100010220 3300005547 Bacteria 4695
90 Ga0070693_100109355 3300005547 Bacteria 1697
91 Ga0070704_100092098 3300005549 Bacteria 2262
92 Ga0070664_100001461 3300005564 Bacteria 18822
93 Ga0068857_100130931 3300005577 Bacteria 2262
94 Ga0068857_100245396 3300005577 Bacteria 1640
95 Ga0068854_100072865 3300005578 Bacteria 2516
96 Ga0068856_100018010 3300005614 Bacteria 6848
97 Ga0070702_100001631 3300005615 Bacteria 9290
98 Ga0070702_100006715 3300005615 Bacteria 5469
99 Ga0070702_100008121 3300005615 Bacteria 5071
100 Ga0070702_100110887 3300005615 Bacteria 1701
101 Ga0068859_100000031 3300005617 Bacteria 174715
102 Ga0068859_100006574 3300005617 Bacteria 11797
103 Ga0068859_100015563 3300005617 Bacteria 7644
104 Ga0068859_100016272 3300005617 Bacteria 7471
105 Ga0068859_100033308 3300005617 Bacteria 5174
106 Ga0068859_100039745 3300005617 Bacteria 4720
107 Ga0068859_100043066 3300005617 Bacteria 4536
108 Ga0068859_100060741 3300005617 Bacteria 3808
109 Ga0068859_100091802 3300005617 Bacteria 3088
110 Ga0068859_100102820 3300005617 Bacteria 2915
111 Ga0068859_100155137 3300005617 Bacteria 2367
112 Ga0068864_100002051 3300005618 Bacteria 16634
113 Ga0068864_100013354 3300005618 Bacteria 6805
114 Ga0068864_100086918 3300005618 Bacteria 2752
115 Ga0068861_100021346 3300005719 Bacteria 4654
116 Ga0068861_100044164 3300005719 Bacteria 3350
117 Ga0068861_100071734 3300005719 Bacteria 2685
118 Ga0068870_10004868 3300005840 Bacteria 5808
119 Ga0068870_10094367 3300005840 Bacteria 1679
120 Ga0068863_100037945 3300005841 Bacteria 4585
121 Ga0068863_100103970 3300005841 Bacteria 2702
122 Ga0068858_100021453 3300005842 Bacteria 6035
123 Ga0068858_100188707 3300005842 Bacteria 1948
124 Ga0068860_100006275 3300005843 Bacteria 11939
125 Ga0068860_100028233 3300005843 Bacteria 5401
126 Ga0068860_100034091 3300005843 Bacteria 4882
127 Ga0068860_100036468 3300005843 Bacteria 4711
128 Ga0068860_100053267 3300005843 Bacteria 3848
129 Ga0068860_100130625 3300005843 Bacteria 2410
130 Ga0068862_100097364 3300005844 Bacteria 2569
131 Ga0081540_1039866 3300005983 Bacteria 2456
132 Ga0081539_10000502 3300005985 Bacteria 82098
133 Ga0081539_10001231 3300005985 Bacteria 45721
134 Ga0081539_10031041 3300005985 Bacteria 3301
135 Ga0068871_100004172 3300006358 Bacteria 10002
136 Ga0068871_100270411 3300006358 Bacteria 1484
137 Ga0075430_100009542 3300006846 Bacteria 8200
138 Ga0075431_100042899 3300006847 Bacteria 4667
139 Ga0075431_100184581 3300006847 Bacteria 2139
140 Ga0075431_100382536 3300006847 Bacteria 1411
141 Ga0075433_10090807 3300006852 Bacteria 2700
142 Ga0075433_10128516 3300006852 Bacteria 2251
143 Ga0075433_10211626 3300006852 Bacteria 1723
144 Ga0075433_10275692 3300006852 Bacteria 1491
145 Ga0075434_100066094 3300006871 Bacteria 3602
146 Ga0075434_100086349 3300006871 Bacteria 3137
147 Ga0075434_100128329 3300006871 Bacteria 2553
148 Ga0075429_100006778 3300006880 Bacteria 9935
149 Ga0075429_100151215 3300006880 Bacteria 2032
150 Ga0068865_100149326 3300006881 Bacteria 1771
151 Ga0075436_100003151 3300006914 Bacteria 11311
152 Ga0097620_100000031 3300006931 Bacteria 174715
153 Ga0097620_100006574 3300006931 Bacteria 11797
154 Ga0097620_100015562 3300006931 Bacteria 7644
155 Ga0097620_100016270 3300006931 Bacteria 7471
156 Ga0097620_100033310 3300006931 Bacteria 5174
157 Ga0097620_100039746 3300006931 Bacteria 4720
158 Ga0097620_100043066 3300006931 Bacteria 4536
159 Ga0097620_100060739 3300006931 Bacteria 3808
160 Ga0097620_100102824 3300006931 Bacteria 2915
161 Ga0097620_100155141 3300006931 Bacteria 2367
162 Ga0075435_100081853 3300007076 Bacteria 2652
163 Ga0111539_10002599 3300009094 Bacteria 23915
164 Ga0111539_10015997 3300009094 Bacteria 9319
165 Ga0111539_10096905 3300009094 Bacteria 3465
166 Ga0111539_10172880 3300009094 Bacteria 2524
167 Ga0105245_10018452 3300009098 Bacteria 6100
168 Ga0105245_10241384 3300009098 Bacteria 1751
169 Ga0114129_10002464 3300009147 Bacteria 25702
170 Ga0114129_10005912 3300009147 Bacteria 17312
171 Ga0114129_10126026 3300009147 Bacteria 3520
172 Ga0114129_10190177 3300009147 Bacteria 2788
173 Ga0114129_10230154 3300009147 Bacteria 2496
174 Ga0114129_10246631 3300009147 Bacteria 2399
175 Ga0114129_10329965 3300009147 Bacteria 2026
176 Ga0114129_10468291 3300009147 Bacteria 1650
177 Ga0105243_10007939 3300009148 Bacteria 8151
178 Ga0105243_10068822 3300009148 Bacteria 2854
179 Ga0105243_10124724 3300009148 Bacteria 2177
180 Ga0105243_10171277 3300009148 Bacteria 1880
181 Ga0105241_10125016 3300009174 Bacteria 2076
182 Ga0105242_10011240 3300009176 Bacteria 6881
183 Ga0105248_10009043 3300009177 Bacteria 10956
184 Ga0105248_10039163 3300009177 Bacteria 5308
185 Ga0105248_10056650 3300009177 Bacteria 4397
186 Ga0105237_10009406 3300009545 Bacteria 10468
187 Ga0105238_10008766 3300009551 Bacteria 10117
188 Ga0105249_10000521 3300009553 Bacteria 35462
189 Ga0105249_10176307 3300009553 Bacteria 2076
190 Ga0105239_10043119 3300010375 Bacteria 4944
191 Ga0105246_10150395 3300011119 Bacteria 1762
192 Ga0157373_10018152 3300013100 Bacteria 5124
193 Ga0157373_10097017 3300013100 Bacteria 2075
194 Ga0157373_10221930 3300013100 Bacteria 1333
195 Ga0157378_10002925 3300013297 Bacteria 15193
196 Ga0157378_10054639 3300013297 Bacteria 3556
197 Ga0157378_10134711 3300013297 Bacteria 2289
198 Ga0157378_10300044 3300013297 Bacteria 1555
199 Ga0163162_10000009 3300013306 Bacteria 316099
200 Ga0163162_10000734 3300013306 Bacteria 30397
201 Ga0163162_10007470 3300013306 Bacteria 10633
202 Ga0163162_10013468 3300013306 Bacteria 7983
203 Ga0163162_10090019 3300013306 Unclassified 3150
204 Ga0163162_10117307 3300013306 Bacteria 2763
205 Ga0157372_10062945 3300013307 Bacteria 4158
206 Ga0157375_10007306 3300013308 Bacteria 9668
207 Ga0163163_10000934 3300014325 Bacteria 24788
208 Ga0163163_10001238 3300014325 Bacteria 21569
209 Ga0163163_10022936 3300014325 Bacteria 5918
210 Ga0163163_10062914 3300014325 Bacteria 3678
211 Ga0163163_10097815 3300014325 Bacteria 2955
212 Ga0163163_10106264 3300014325 Bacteria 2833
213 Ga0157380_10000207 3300014326 Bacteria 34905
214 Ga0157380_10001969 3300014326 Bacteria 13678
215 Ga0157380_10015752 3300014326 Bacteria 5561
216 Ga0157380_10016200 3300014326 Bacteria 5492
217 Ga0157380_10055333 3300014326 Bacteria 3151
218 Ga0157380_10102837 3300014326 Bacteria 2383
219 Ga0157377_10002634 3300014745 Bacteria 7963
220 Ga0157379_10128483 3300014968 Bacteria 2281
221 Ga0163161_10005683 3300017792 Bacteria 8646
222 Ga0207653_10004690 3300025885 Bacteria 4285
223 Ga0207642_10003917 3300025899 Bacteria 4748
224 Ga0207647_10004263 3300025904 Bacteria 10604
225 Ga0207645_10065694 3300025907 Bacteria 2319
226 Ga0207643_10003978 3300025908 Bacteria 7959
227 Ga0207643_10016563 3300025908 Bacteria 4021
228 Ga0207643_10100695 3300025908 Bacteria 1694
229 Ga0207684_10000085 3300025910 Bacteria 175922
230 Ga0207684_10006154 3300025910 Bacteria 10974
231 Ga0207684_10030351 3300025910 Bacteria 4602
232 Ga0207707_10000016 3300025912 Bacteria 256002
233 Ga0207707_10009236 3300025912 Bacteria 8557
234 Ga0207707_10038693 3300025912 Bacteria 4168
235 Ga0207671_10008884 3300025914 Bacteria 8460
236 Ga0207660_10018572 3300025917 Bacteria 4637
237 Ga0207662_10002812 3300025918 Bacteria 8799
238 Ga0207662_10005037 3300025918 Bacteria 6997
239 Ga0207652_10000126 3300025921 Bacteria 82522
240 Ga0207652_10006867 3300025921 Bacteria 9173
241 Ga0207646_10020511 3300025922 Bacteria 6122
242 Ga0207646_10126895 3300025922 Bacteria 2294
243 Ga0207681_10000395 3300025923 Bacteria 30526
244 Ga0207694_10017188 3300025924 Bacteria 5466
245 Ga0207650_10000011 3300025925 Bacteria 450115
246 Ga0207650_10003650 3300025925 Bacteria 10531
247 Ga0207650_10074311 3300025925 Bacteria 2562
248 Ga0207659_10296656 3300025926 Bacteria 1326
249 Ga0207644_10007051 3300025931 Bacteria 7321
250 Ga0207686_10013229 3300025934 Unclassified 4562
251 Ga0207686_10049261 3300025934 Bacteria 2614
252 Ga0207709_10000814 3300025935 Bacteria 24173
253 Ga0207709_10053451 3300025935 Bacteria 2486
254 Ga0207709_10089148 3300025935 Bacteria 2010
255 Ga0207670_10003052 3300025936 Bacteria 8839
256 Ga0207670_10049573 3300025936 Bacteria 2810
257 Ga0207704_10065046 3300025938 Bacteria 2281
258 Ga0207691_10025125 3300025940 Bacteria 5596
259 Ga0207691_10025128 3300025940 Bacteria 5596
260 Ga0207711_10036982 3300025941 Bacteria 4143
261 Ga0207689_10012738 3300025942 Bacteria 7183
262 Ga0207689_10018174 3300025942 Bacteria 5936
263 Ga0207689_10018965 3300025942 Bacteria 5802
264 Ga0207689_10023428 3300025942 Bacteria 5182
265 Ga0207689_10251566 3300025942 Bacteria 1461
266 Ga0207679_10049378 3300025945 Bacteria 3070
267 Ga0207651_10002319 3300025960 Bacteria 9069
268 Ga0207651_10064039 3300025960 Bacteria 2571
269 Ga0207712_10000445 3300025961 Bacteria 35170
270 Ga0207712_10012276 3300025961 Bacteria 5473
271 Ga0207703_10186203 3300026035 Bacteria 1835
272 Ga0207703_10289804 3300026035 Bacteria 1489
273 Ga0207639_10004529 3300026041 Bacteria 9365
274 Ga0207708_10000091 3300026075 Bacteria 71484
275 Ga0207708_10002429 3300026075 Bacteria 13685
276 Ga0207708_10005668 3300026075 Bacteria 9222
277 Ga0207708_10042243 3300026075 Bacteria 3476
278 Ga0207641_10035861 3300026088 Bacteria 4136
279 Ga0207641_10047800 3300026088 Bacteria 3609
280 Ga0207648_10021760 3300026089 Bacteria 5761
281 Ga0207648_10035421 3300026089 Bacteria 4397
282 Ga0207648_10044842 3300026089 Bacteria 3880
283 Ga0207648_10079370 3300026089 Bacteria 2863
284 Ga0207648_10093189 3300026089 Bacteria 2634
285 Ga0207676_10005583 3300026095 Bacteria 8901
286 Ga0207676_10013862 3300026095 Bacteria 5787
287 Ga0207676_10158731 3300026095 Bacteria 1957
288 Ga0207676_10194430 3300026095 Bacteria 1788
289 Ga0207674_10000169 3300026116 Bacteria 78781
290 Ga0207674_10059305 3300026116 Bacteria 3873
291 Ga0207674_10262297 3300026116 Bacteria 1675
292 Ga0207675_100001843 3300026118 Bacteria 21273
293 Ga0207675_100014900 3300026118 Bacteria 7257
294 Ga0207675_100034839 3300026118 Bacteria 4695
295 Ga0207675_100131762 3300026118 Bacteria 2371
296 Ga0207675_100170543 3300026118 Bacteria 2080
297 Ga0207683_10089741 3300026121 Bacteria 2736
298 Ga0207428_10011270 3300027907 Bacteria 7920
299 Ga0268265_10016120 3300028380 Bacteria 5128
300 Ga0268264_10026118 3300028381 Bacteria 4769
301 Ga0268264_10091740 3300028381 Bacteria 2621
302 Ga0268264_10101665 3300028381 Bacteria 2499
303 Ga0268264_10103202 3300028381 Bacteria 2482
304 Ga0307513_10001605 3300031456 Bacteria 32470
305 Ga0307408_100009561 3300031548 Bacteria 6397
306 Ga0307408_100076933 3300031548 Bacteria 2484
307 Ga0307405_10059972 3300031731 Bacteria 2399
308 Ga0307413_10020350 3300031824 Bacteria 3527
309 Ga0307410_10011627 3300031852 Bacteria 5044
310 Ga0307406_10001225 3300031901 Bacteria 14372
311 Ga0307416_100010001 3300032002 Bacteria 6244
312 Ga0307416_100093428 3300032002 Bacteria 2591
313 Ga0307414_10006615 3300032004 Bacteria 6475
314 Ga0307415_100006042 3300032126 Bacteria 6488
315 Ga0373940_0011344 3300035088 Bacteria 2115
316 Ga0373949_0008804 3300035090 Bacteria 2208
317 Ga0373951_0007525 3300035091 Bacteria 2471
318 Ga0373955_0110652 3300035172 Bacteria 1588
319 Ga0373937_0168923 3300036401 Bacteria 2052
320 Ga0395900_0015051 3300037418 Bacteria 7885
321 Ga0395898_0509622 3300037466 Bacteria 1144
322 Ga0242422_01477 3300038699 Bacteria 1625
323 Ga0400483_071102 3300039062 Bacteria 1859
324 Ga0400483_162987 3300039062 Bacteria 1867
325 Ga0400483_190702 3300039062 Bacteria 2023
326 Ga0400483_246598 3300039062 Bacteria 3198
327 Ga0436365_0810020 3300039437 Bacteria 2537
328 Ga0436365_1240072 3300039437 Bacteria 5131
329 Ga0439462_0008522 3300042015 Bacteria 2588
330 Ga0451577_0001746 3300042876 Bacteria 28024
331 Ga0453684_0001779 3300044712 Bacteria 57517
332 Ga0466959_0051637 3300045049 Bacteria 3014
333 Ga0451576_0055454 3300045051 Bacteria 4146
334 Ga0451576_0110704 3300045051 Bacteria 2858
335 Ga0495629_0000005 3300046459 Bacteria 404868
336 Ga0495629_0082970 3300046459 Bacteria 2237
337 Ga0495580_0091283 3300046472 Bacteria 2120
338 Ga0495639_0000118 3300046475 Bacteria 40122
339 Ga0495632_0005810 3300046519 Bacteria 8083
340 Ga0495663_0008001 3300046525 Bacteria 2924
341 Ga0495666_0000167 3300046526 Bacteria 27730
342 Ga0495586_0000355 3300046535 Bacteria 28707
343 Ga0495598_0000088 3300046537 Bacteria 14973
344 Ga0495621_0039334 3300046539 Bacteria 1653
345 Ga0495633_0039090 3300046558 Bacteria 2265
346 Ga0495668_0089035 3300046616 Bacteria 1692
347 Ga0495635_0016684 3300046663 Bacteria 5130
348 Ga0495624_0096805 3300046690 Bacteria 1818
349 Ga0495581_0038029 3300047315 Bacteria 2784
350 Ga0495676_0002547 3300047321 Bacteria 16220
351 Ga0495680_0002121 3300047322 Bacteria 20608
352 Ga0496104_0142476 3300048907 Bacteria 2303
353 Ga0496106_0021045 3300048909 Bacteria 4842
354 Ga0496106_0060559 3300048909 Bacteria 2870
355 Ga0496106_0167735 3300048909 Bacteria 1739
356 Ga0496108_0131667 3300048911 Bacteria 2150
357 Ga0496110_0062038 3300048913 Bacteria 3301
358 Ga0501296_005004 3300049519 Bacteria 1464
359 Ga0501297_007844 3300049520 Bacteria 1167
360 Ga0501217_006814 3300049661 Bacteria 2437
361 Ga0501223_001126 3300049663 Bacteria 6281
362 Ga0501227_001017 3300049665 Bacteria 6220
363 Ga0501235_002384 3300049669 Bacteria 4050
364 Ga0501235_003810 3300049669 Bacteria 3259
365 Ga0501243_003484 3300049675 Bacteria 2331
366 Ga0501261_006417 3300049690 Bacteria 1496
367 Ga0501221_012667 3300049704 Bacteria 1538
368 Ga0501225_0001892 3300049705 Bacteria 6580
369 Ga0501225_0005009 3300049705 Bacteria 3913
370 Ga0501225_0020408 3300049705 Bacteria 1831
371 nmdc:mga05p37_242482_c1 3300050507 Bacteria 2166
372 nmdc:mga05p37_294789_c1 3300050507 Bacteria 1929
373 nmdc:mga05p37_314857_c1 3300050507 Bacteria 1854
374 nmdc:mga05p37_351944_c1 3300050507 Bacteria 1734
375 nmdc:mga05p37_83543_c1 3300050507 Bacteria 3934
376 nmdc:mga09592_250282_c1 3300050508 Bacteria 1536
377 nmdc:mga0qj67_9015_c1 3300050509 Bacteria 7402
378 nmdc:mga06r32_111221_c1 3300050510 Bacteria 2695
379 nmdc:mga08y16_10538_c1 3300050511 Bacteria 9702
380 nmdc:mga08y16_206887_c1 3300050511 Bacteria 2033
381 nmdc:mga08y16_342780_c1 3300050511 Bacteria 1536
382 nmdc:mga0rr50_191751_c1 3300050513 Bacteria 1675
383 nmdc:mga0rr50_27554_c1 3300050513 Bacteria 3981
384 nmdc:mga0rr50_311599_c1 3300050513 Bacteria 1318
385 nmdc:mga08x19_6310_c1 3300050514 Bacteria 7018
386 nmdc:mga0a205_145291_c1 3300050515 Bacteria 2272
387 nmdc:mga0a205_192919_c1 3300050515 Bacteria 1929
388 nmdc:mga0a205_289076_c1 3300050515 Bacteria 1514
389 nmdc:mga0a205_32658_c1 3300050515 Bacteria 2179
390 nmdc:mga0a205_85893_c1 3300050515 Bacteria 3039
391 Ga0495595_0017922 3300053084 Bacteria 3052
392 Ga0495619_0021081 3300053085 Bacteria 4158
393 Ga0500616_0003675 3300053153 Bacteria 11510
394 Ga0587073_0013710 3300059492 Bacteria 1429
395 Ga0501082_0174218 3300060353 Bacteria 1871
396 Ga0530510_0054795 3300061734 Bacteria 2882
397 2840882073 2840878972 Bacteria 5483153
398 Ga0070690_100000612
399 CNBas_1000117
400 JGI24751J29686_10000059
401 JGI25406J46586_10003254
402 JGI25406J46586_10009207
403 Ga0065712_10000122
404 Ga0065715_10018442
405 Ga0065715_10090470
406 Ga0065715_10109914
407 Ga0070676_10032085
408 Ga0070690_100002621
409 Ga0070690_100034804
410 Ga0070670_100000331
411 Ga0070670_100003188
412 Ga0070670_100072862
413 Ga0070670_100166814
414 Ga0068869_100001138
415 Ga0068869_100045839
416 Ga0068869_100111826
417 Ga0070680_100001278
418 Ga0070682_100000112
419 Ga0070682_100003103
420 Ga0070689_100003618
421 Ga0070689_100017859
422 Ga0070661_100061724
423 Ga0070692_10008307
424 Ga0070692_10014020
425 Ga0070669_100003676
426 Ga0070669_100043063
427 Ga0070675_100013223
428 Ga0070671_100001508
429 Ga0070671_100021955
430 Ga0070673_100066982
431 Ga0070659_100003624
432 Ga0070667_100035485
433 Ga0070703_10003790
434 Ga0070710_10056073
435 Ga0070701_10016940
436 Ga0070701_10081011
437 Ga0070705_100033983
438 Ga0070700_100000065
439 Ga0070700_100001252
440 Ga0070700_100093039
441 Ga0070694_100007515
442 Ga0070694_100015184
443 Ga0070694_100021993
444 Ga0070694_100132028
445 Ga0070708_100067550
446 Ga0070678_100025643
447 Ga0070662_100140118
448 Ga0070662_100247868
449 Ga0070681_10000089
450 Ga0070681_10001309
451 Ga0070681_10039195
452 Ga0068867_100015699
453 Ga0068867_100031099
454 Ga0068867_100070613
455 Ga0070706_100000984
456 Ga0070706_100001848
457 Ga0070706_100350731
458 Ga0070707_100085625
459 Ga0070698_100000826
460 Ga0070698_100009351
461 Ga0070698_100014216
462 Ga0070698_100020589
463 Ga0070698_100024276
464 Ga0070698_100042273
465 Ga0070699_100001908
466 Ga0070699_100003583
467 Ga0070699_100007411
468 Ga0070699_100043243
469 Ga0070699_100176991
470 Ga0070679_100000014
471 Ga0070684_100070149
472 Ga0070697_100000160
473 Ga0070697_100013377
474 Ga0070697_100067970
475 Ga0070697_100232556
476 Ga0068853_100016545
477 Ga0068853_100028789
478 Ga0070672_100020548
479 Ga0070672_100032475
480 Ga0070686_100000928
481 Ga0070686_100001875
482 Ga0070686_100017138
483 Ga0070696_100029102
484 Ga0070696_100051866
485 Ga0070696_100112939
486 Ga0070693_100010220
487 Ga0070693_100109355
488 Ga0070704_100092098
489 Ga0070664_100001461
490 Ga0068857_100130931
491 Ga0068857_100245396
492 Ga0068854_100072865
493 Ga0068856_100018010
494 Ga0070702_100001631
495 Ga0070702_100006715
496 Ga0070702_100008121
497 Ga0070702_100110887
498 Ga0068859_100000031
499 Ga0068859_100006574
500 Ga0068859_100015563
501 Ga0068859_100016272
502 Ga0068859_100033308
503 Ga0068859_100039745
504 Ga0068859_100043066
505 Ga0068859_100060741
506 Ga0068859_100091802
507 Ga0068859_100102820
508 Ga0068859_100155137
509 Ga0068864_100002051
510 Ga0068864_100013354
511 Ga0068864_100086918
512 Ga0068861_100021346
513 Ga0068861_100044164
514 Ga0068861_100071734
515 Ga0068870_10004868
516 Ga0068870_10094367
517 Ga0068863_100037945
518 Ga0068863_100103970
519 Ga0068858_100021453
520 Ga0068858_100188707
521 Ga0068860_100006275
522 Ga0068860_100028233
523 Ga0068860_100034091
524 Ga0068860_100036468
525 Ga0068860_100053267
526 Ga0068860_100130625
527 Ga0068862_100097364
528 Ga0081540_1039866
529 Ga0081539_10000502
530 Ga0081539_10001231
531 Ga0081539_10031041
532 Ga0068871_100004172
533 Ga0068871_100270411
534 Ga0075430_100009542
535 Ga0075431_100042899
536 Ga0075431_100184581
537 Ga0075431_100382536
538 Ga0075433_10090807
539 Ga0075433_10128516
540 Ga0075433_10211626
541 Ga0075433_10275692
542 Ga0075434_100066094
543 Ga0075434_100086349
544 Ga0075434_100128329
545 Ga0075429_100006778
546 Ga0075429_100151215
547 Ga0068865_100149326
548 Ga0075436_100003151
549 Ga0097620_100000031
550 Ga0097620_100006574
551 Ga0097620_100015562
552 Ga0097620_100016270
553 Ga0097620_100033310
554 Ga0097620_100039746
555 Ga0097620_100043066
556 Ga0097620_100060739
557 Ga0097620_100102824
558 Ga0097620_100155141
559 Ga0075435_100081853
560 Ga0111539_10002599
561 Ga0111539_10015997
562 Ga0111539_10096905
563 Ga0111539_10172880
564 Ga0105245_10018452
565 Ga0105245_10241384
566 Ga0114129_10002464
567 Ga0114129_10005912
568 Ga0114129_10126026
569 Ga0114129_10190177
570 Ga0114129_10230154
571 Ga0114129_10246631
572 Ga0114129_10329965
573 Ga0114129_10468291
574 Ga0105243_10007939
575 Ga0105243_10068822
576 Ga0105243_10124724
577 Ga0105243_10171277
578 Ga0105241_10125016
579 Ga0105242_10011240
580 Ga0105248_10009043
581 Ga0105248_10039163
582 Ga0105248_10056650
583 Ga0105237_10009406
584 Ga0105238_10008766
585 Ga0105249_10000521
586 Ga0105249_10176307
587 Ga0105239_10043119
588 Ga0105246_10150395
589 Ga0157373_10018152
590 Ga0157373_10097017
591 Ga0157373_10221930
592 Ga0157378_10002925
593 Ga0157378_10054639
594 Ga0157378_10134711
595 Ga0157378_10300044
596 Ga0163162_10000009
597 Ga0163162_10000734
598 Ga0163162_10007470
599 Ga0163162_10013468
600 Ga0163162_10090019
601 Ga0163162_10117307
602 Ga0157372_10062945
603 Ga0157375_10007306
604 Ga0163163_10000934
605 Ga0163163_10001238
606 Ga0163163_10022936
607 Ga0163163_10062914
608 Ga0163163_10097815
609 Ga0163163_10106264
610 Ga0157380_10000207
611 Ga0157380_10001969
612 Ga0157380_10015752
613 Ga0157380_10016200
614 Ga0157380_10055333
615 Ga0157380_10102837
616 Ga0157377_10002634
617 Ga0157379_10128483
618 Ga0163161_10005683
619 Ga0207653_10004690
620 Ga0207642_10003917
621 Ga0207647_10004263
622 Ga0207645_10065694
623 Ga0207643_10003978
624 Ga0207643_10016563
625 Ga0207643_10100695
626 Ga0207684_10000085
627 Ga0207684_10006154
628 Ga0207684_10030351
629 Ga0207707_10000016
630 Ga0207707_10009236
631 Ga0207707_10038693
632 Ga0207671_10008884
633 Ga0207660_10018572
634 Ga0207662_10002812
635 Ga0207662_10005037
636 Ga0207652_10000126
637 Ga0207652_10006867
638 Ga0207646_10020511
639 Ga0207646_10126895
640 Ga0207681_10000395
641 Ga0207694_10017188
642 Ga0207650_10000011
643 Ga0207650_10003650
644 Ga0207650_10074311
645 Ga0207659_10296656
646 Ga0207644_10007051
647 Ga0207686_10013229
648 Ga0207686_10049261
649 Ga0207709_10000814
650 Ga0207709_10053451
651 Ga0207709_10089148
652 Ga0207670_10003052
653 Ga0207670_10049573
654 Ga0207704_10065046
655 Ga0207691_10025125
656 Ga0207691_10025128
657 Ga0207711_10036982
658 Ga0207689_10012738
659 Ga0207689_10018174
660 Ga0207689_10018965
661 Ga0207689_10023428
662 Ga0207689_10251566
663 Ga0207679_10049378
664 Ga0207651_10002319
665 Ga0207651_10064039
666 Ga0207712_10000445
667 Ga0207712_10012276
668 Ga0207703_10186203
669 Ga0207703_10289804
670 Ga0207639_10004529
671 Ga0207708_10000091
672 Ga0207708_10002429
673 Ga0207708_10005668
674 Ga0207708_10042243
675 Ga0207641_10035861
676 Ga0207641_10047800
677 Ga0207648_10021760
678 Ga0207648_10035421
679 Ga0207648_10044842
680 Ga0207648_10079370
681 Ga0207648_10093189
682 Ga0207676_10005583
683 Ga0207676_10013862
684 Ga0207676_10158731
685 Ga0207676_10194430
686 Ga0207674_10000169
687 Ga0207674_10059305
688 Ga0207674_10262297
689 Ga0207675_100001843
690 Ga0207675_100014900
691 Ga0207675_100034839
692 Ga0207675_100131762
693 Ga0207675_100170543
694 Ga0207683_10089741
695 Ga0207428_10011270
696 Ga0268265_10016120
697 Ga0268264_10026118
698 Ga0268264_10091740
699 Ga0268264_10101665
700 Ga0268264_10103202
701 Ga0307513_10001605
702 Ga0307408_100009561
703 Ga0307408_100076933
704 Ga0307405_10059972
705 Ga0307413_10020350
706 Ga0307410_10011627
707 Ga0307406_10001225
708 Ga0307416_100010001
709 Ga0307416_100093428
710 Ga0307414_10006615
711 Ga0307415_100006042
712 Ga0373940_0011344
713 Ga0373949_0008804
714 Ga0373951_0007525
715 Ga0373955_0110652
716 Ga0373937_0168923
717 Ga0395900_0015051
718 Ga0395898_0509622
719 Ga0242422_01477
720 Ga0400483_071102
721 Ga0400483_162987
722 Ga0400483_190702
723 Ga0400483_246598
724 Ga0436365_0810020
725 Ga0436365_1240072
726 Ga0439462_0008522
727 Ga0451577_0001746
728 Ga0453684_0001779
729 Ga0466959_0051637
730 Ga0451576_0055454
731 Ga0451576_0110704
732 Ga0495629_0000005
733 Ga0495629_0082970
734 Ga0495580_0091283
735 Ga0495639_0000118
736 Ga0495632_0005810
737 Ga0495663_0008001
738 Ga0495666_0000167
739 Ga0495586_0000355
740 Ga0495598_0000088
741 Ga0495621_0039334
742 Ga0495633_0039090
743 Ga0495668_0089035
744 Ga0495635_0016684
745 Ga0495624_0096805
746 Ga0495581_0038029
747 Ga0495676_0002547
748 Ga0495680_0002121
749 Ga0496104_0142476
750 Ga0496106_0021045
751 Ga0496106_0060559
752 Ga0496106_0167735
753 Ga0496108_0131667
754 Ga0496110_0062038
755 Ga0501296_005004
756 Ga0501297_007844
757 Ga0501217_006814
758 Ga0501223_001126
759 Ga0501227_001017
760 Ga0501235_002384
761 Ga0501235_003810
762 Ga0501243_003484
763 Ga0501261_006417
764 Ga0501221_012667
765 Ga0501225_0001892
766 Ga0501225_0005009
767 Ga0501225_0020408
768 nmdc:mga05p37_242482_c1
769 nmdc:mga05p37_294789_c1
770 nmdc:mga05p37_314857_c1
771 nmdc:mga05p37_351944_c1
772 nmdc:mga05p37_83543_c1
773 nmdc:mga09592_250282_c1
774 nmdc:mga0qj67_9015_c1
775 nmdc:mga06r32_111221_c1
776 nmdc:mga08y16_10538_c1
777 nmdc:mga08y16_206887_c1
778 nmdc:mga08y16_342780_c1
779 nmdc:mga0rr50_191751_c1
780 nmdc:mga0rr50_27554_c1
781 nmdc:mga0rr50_311599_c1
782 nmdc:mga08x19_6310_c1
783 nmdc:mga0a205_145291_c1
784 nmdc:mga0a205_192919_c1
785 nmdc:mga0a205_289076_c1
786 nmdc:mga0a205_32658_c1
787 nmdc:mga0a205_85893_c1
788 Ga0495595_0017922
789 Ga0495619_0021081
790 Ga0500616_0003675
791 Ga0587073_0013710
792 Ga0501082_0174218
793 Ga0530510_0054795
794 2840882073

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00108

Thiolase_N

Thiolase, N-terminal domain

65

324

0.99

PF02803

Thiolase_C

Thiolase, C-terminal domain

331

453

0.98

PF00109

ketoacyl-synt

Beta-ketoacyl synthase, N-terminal domain

56

230

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wyr-assembly1.cif.gz_A crystal structure of thiolase mutation (v77q,n153y,a286k) from clostridium acetobutylicum 0.9724 1 391
4o9a-assembly1.cif.gz_B crystal structure of beta-ketothiolase (phaa) from ralstonia eutropha h16 0.9718 3 391
4n45-assembly1.cif.gz_A crystal structure of reduced form of thiolase from clostridium acetobutylicum 0.9711 1 391
4dd5-assembly1.cif.gz_A biosynthetic thiolase (thla1) from clostridium difficile 0.9702 1 390
5f0v-assembly1.cif.gz_A x-ray crystal structure of a thiolase from escherichia coli at 1.8 a resolution 0.9701 1 391
ID Description Score Start End Superfamily
af_A0A0G2KML7_1_235_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9795 157 390 3.40.47.10
af_O53871_287_399_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9745 276 385 3.40.47.10
af_A0A096MJY8_281_393_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9727 276 385 3.40.47.10
af_P76461_265_393_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9719 265 391 3.40.47.10
af_A0A0G2KML7_1_235_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9713 157 390 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A3B9LPV2-F1-model_v4 Thiolase N-terminal domain-containing protein 0.989 1 110 GO:0016747
AF-A0A7Y8E982-F1-model_v4 Acetyl-CoA C-acyltransferase 0.9881 270 390 GO:0003988
GO:0006635
GO:0010124
AF-A0A7K2YDF6-F1-model_v4 Probable acetyl-CoA acetyltransferase 0.9871 224 391 GO:0016747
AF-A0A7V4PRG6-F1-model_v4 acetyl-CoA C-acyltransferase (EC 2.3.1.16) 0.9861 271 391 GO:0003988
GO:0006635
GO:0010124
AF-A0A534K6Y8-F1-model_v4 Thiolase family protein 0.9844 232 391 GO:0016747

Map