F433595

General Info

Members Datasets Scaffolds Average Seq Length
396 245 792 76

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0000037|Ga0495650_0000037_75022_75273
Length 83
Sequence MATSAKVDLGTPAKVIAIGNSIGIVLPKEVASRLRVEKGDILYISDSPDGVRLSAYDESFATKLDAMEQVMRENRDVLRRLAE

Samples

Sample ID Description Type Environment
1 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
160 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
170 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
171 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
172 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
178 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
179 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
180 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
181 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
189 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
195 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
196 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
197 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
198 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
234 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
235 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
240 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
241 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
242 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
245 2643221639 Pelomonas sp. Root1217 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.47
Metatranscriptomes 2.27
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.53
Nodule 0
Rhizoplane 1.01
Rhizosphere 94.7
Stem 0
Stem Tuber 0
Unclassified 21.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495650_0000037 3300046471 Bacteria 390090
2 JGI24735J21928_10185379 3300002067 Unclassified 603
3 Ga0058861_11323111 3300004800 Bacteria 512
4 Ga0070658_10199510 3300005327 Bacteria 1688
5 Ga0070658_10476719 3300005327 Unclassified 1077
6 Ga0070676_10154365 3300005328 Bacteria 1472
7 Ga0070690_100060396 3300005330 Bacteria 2440
8 Ga0070670_100478740 3300005331 Bacteria 1105
9 Ga0070670_100738673 3300005331 Bacteria 886
10 Ga0070670_101285994 3300005331 Bacteria 669
11 Ga0070677_10026256 3300005333 Bacteria 2182
12 Ga0068869_100045783 3300005334 Bacteria 3151
13 Ga0068869_100714589 3300005334 Unclassified 855
14 Ga0068869_100795447 3300005334 Unclassified 812
15 Ga0068869_101063578 3300005334 Unclassified 707
16 Ga0070666_10234131 3300005335 Bacteria 1298
17 Ga0070680_100185336 3300005336 Bacteria 1753
18 Ga0068868_100120864 3300005338 Bacteria 2136
19 Ga0068868_100248581 3300005338 Bacteria 1496
20 Ga0070660_100650990 3300005339 Bacteria 882
21 Ga0070689_100068686 3300005340 Bacteria 2764
22 Ga0070689_100141405 3300005340 Bacteria 1936
23 Ga0070687_101133285 3300005343 Unclassified 574
24 Ga0070661_100282560 3300005344 Bacteria 1288
25 Ga0070668_101473425 3300005347 Unclassified 622
26 Ga0070669_101248470 3300005353 Unclassified 643
27 Ga0070669_101481163 3300005353 Unclassified 590
28 Ga0070675_100111941 3300005354 Bacteria 2311
29 Ga0070675_100473684 3300005354 Bacteria 1125
30 Ga0070675_100574931 3300005354 Unclassified 1020
31 Ga0070671_100094982 3300005355 Bacteria 2499
32 Ga0070671_100388501 3300005355 Bacteria 1193
33 Ga0070671_101025003 3300005355 Unclassified 724
34 Ga0070674_100063595 3300005356 Bacteria 2583
35 Ga0070673_100422488 3300005364 Bacteria 1195
36 Ga0070673_100664776 3300005364 Bacteria 954
37 Ga0070673_100814262 3300005364 Unclassified 863
38 Ga0070688_100079056 3300005365 Bacteria 2123
39 Ga0070688_100113380 3300005365 Bacteria 1806
40 Ga0070659_100293504 3300005366 Bacteria 1354
41 Ga0070667_100064982 3300005367 Bacteria 3097
42 Ga0070667_100184838 3300005367 Bacteria 1844
43 Ga0070701_10034412 3300005438 Bacteria 2537
44 Ga0070711_100294002 3300005439 Bacteria 1289
45 Ga0070705_100860871 3300005440 Unclassified 726
46 Ga0070705_100878287 3300005440 Bacteria 719
47 Ga0070700_100321751 3300005441 Bacteria 1137
48 Ga0070694_100205470 3300005444 Bacteria 1470
49 Ga0070663_100047679 3300005455 Bacteria 3035
50 Ga0070663_100583735 3300005455 Unclassified 938
51 Ga0070663_101105050 3300005455 Unclassified 693
52 Ga0070678_100103362 3300005456 Bacteria 2213
53 Ga0070678_100264344 3300005456 Bacteria 1448
54 Ga0070678_101525194 3300005456 Unclassified 626
55 Ga0070662_100208660 3300005457 Bacteria 1553
56 Ga0070662_101737929 3300005457 Unclassified 539
57 Ga0070681_10142789 3300005458 Bacteria 2323
58 Ga0070681_10410701 3300005458 Bacteria 1265
59 Ga0068867_100212773 3300005459 Bacteria 1553
60 Ga0068867_100277982 3300005459 Bacteria 1372
61 Ga0070685_10000659 3300005466 Bacteria 18824
62 Ga0070685_11092262 3300005466 Bacteria 602
63 Ga0070707_101322412 3300005468 Bacteria 687
64 Ga0070679_100759435 3300005530 Unclassified 913
65 Ga0068853_100242546 3300005539 Bacteria 1652
66 Ga0068853_101400263 3300005539 Unclassified 676
67 Ga0070672_100056591 3300005543 Bacteria 3076
68 Ga0070672_100821678 3300005543 Unclassified 818
69 Ga0070672_100923574 3300005543 Unclassified 771
70 Ga0070686_100037871 3300005544 Bacteria 2995
71 Ga0070686_100998237 3300005544 Bacteria 686
72 Ga0070696_101059910 3300005546 Unclassified 680
73 Ga0070693_100568781 3300005547 Bacteria 814
74 Ga0070665_100106313 3300005548 Bacteria 2808
75 Ga0070665_100277620 3300005548 Bacteria 1677
76 Ga0070665_102121638 3300005548 Bacteria 566
77 Ga0070704_100373087 3300005549 Bacteria 1210
78 Ga0068857_101389438 3300005577 Bacteria 683
79 Ga0068854_101221419 3300005578 Unclassified 674
80 Ga0070702_100041231 3300005615 Bacteria 2588
81 Ga0068852_100008456 3300005616 Bacteria 7586
82 Ga0068852_100062194 3300005616 Bacteria 3246
83 Ga0068852_100388847 3300005616 Bacteria 1370
84 Ga0068852_101276804 3300005616 Bacteria 756
85 Ga0068859_100668169 3300005617 Bacteria 1130
86 Ga0068859_101590766 3300005617 Unclassified 722
87 Ga0068864_100145351 3300005618 Bacteria 2143
88 Ga0068864_100335949 3300005618 Unclassified 1422
89 Ga0068864_100696098 3300005618 Unclassified 992
90 Ga0068866_10104853 3300005718 Bacteria 1566
91 Ga0068861_100076697 3300005719 Bacteria 2605
92 Ga0068861_100082224 3300005719 Bacteria 2523
93 Ga0068870_10197024 3300005840 Bacteria 1219
94 Ga0068870_10364794 3300005840 Bacteria 930
95 Ga0068870_10745713 3300005840 Unclassified 680
96 Ga0068863_100099328 3300005841 Bacteria 2765
97 Ga0068863_100107049 3300005841 Bacteria 2660
98 Ga0068863_100182655 3300005841 Bacteria 2013
99 Ga0068863_101417649 3300005841 Bacteria 702
100 Ga0068858_100065220 3300005842 Bacteria 3369
101 Ga0068858_100247491 3300005842 Bacteria 1693
102 Ga0068858_100383809 3300005842 Bacteria 1348
103 Ga0068860_100296378 3300005843 Bacteria 1583
104 Ga0068860_101143915 3300005843 Bacteria 798
105 Ga0068860_101475778 3300005843 Unclassified 702
106 Ga0068862_101118218 3300005844 Unclassified 783
107 Ga0068862_102307579 3300005844 Unclassified 550
108 Ga0068862_102328558 3300005844 Bacteria 547
109 Ga0075363_100083894 3300006048 Bacteria 1746
110 Ga0070716_101007049 3300006173 Unclassified 659
111 Ga0075367_10610771 3300006178 Bacteria 693
112 Ga0097621_100075105 3300006237 Bacteria 2800
113 Ga0097621_100322511 3300006237 Unclassified 1369
114 Ga0097621_100633759 3300006237 Unclassified 979
115 Ga0097621_102008423 3300006237 Unclassified 552
116 Ga0075370_10297836 3300006353 Bacteria 959
117 Ga0068871_100113329 3300006358 Unclassified 2283
118 Ga0068871_100444945 3300006358 Bacteria 1160
119 Ga0068871_100506849 3300006358 Bacteria 1088
120 Ga0075431_100430462 3300006847 Bacteria 1318
121 Ga0075433_10233765 3300006852 Bacteria 1632
122 Ga0068865_100251353 3300006881 Bacteria 1395
123 Ga0075436_100118898 3300006914 Bacteria 1848
124 Ga0097620_100668178 3300006931 Bacteria 1130
125 Ga0097620_101590815 3300006931 Unclassified 722
126 Ga0105240_10000719 3300009093 Bacteria 60602
127 Ga0105240_10009244 3300009093 Bacteria 13982
128 Ga0111539_10836383 3300009094 Bacteria 1071
129 Ga0105245_10139756 3300009098 Unclassified 2280
130 Ga0105245_10274908 3300009098 Bacteria 1644
131 Ga0105245_10359119 3300009098 Bacteria 1445
132 Ga0105245_10462056 3300009098 Bacteria 1280
133 Ga0105247_10042197 3300009101 Bacteria 2793
134 Ga0105241_10104971 3300009174 Bacteria 2252
135 Ga0105241_11524428 3300009174 Bacteria 644
136 Ga0105242_10048317 3300009176 Bacteria 3458
137 Ga0105242_10377704 3300009176 Bacteria 1316
138 Ga0105242_10433584 3300009176 Bacteria 1235
139 Ga0105248_10021704 3300009177 Bacteria 7114
140 Ga0105248_10330772 3300009177 Bacteria 1716
141 Ga0105248_10819900 3300009177 Bacteria 1050
142 Ga0105248_11140992 3300009177 Bacteria 881
143 Ga0105248_11188238 3300009177 Unclassified 862
144 Ga0105248_11889949 3300009177 Bacteria 677
145 Ga0105248_11996923 3300009177 Unclassified 659
146 Ga0105237_10000076 3300009545 Bacteria 131773
147 Ga0105237_10016166 3300009545 Bacteria 7762
148 Ga0105238_10047373 3300009551 Bacteria 4335
149 Ga0105238_10162630 3300009551 Bacteria 2208
150 Ga0105238_12537378 3300009551 Bacteria 549
151 Ga0105249_10377198 3300009553 Bacteria 1443
152 Ga0105239_10025961 3300010375 Bacteria 6450
153 Ga0105239_10299040 3300010375 Bacteria 1812
154 Ga0105246_10638505 3300011119 Bacteria 925
155 Ga0105246_10775479 3300011119 Bacteria 848
156 Ga0157373_10116110 3300013100 Bacteria 1881
157 Ga0157370_10189162 3300013104 Bacteria 1911
158 Ga0157370_10359228 3300013104 Bacteria 1342
159 Ga0157369_10037947 3300013105 Bacteria 5270
160 Ga0157369_10283730 3300013105 Bacteria 1724
161 Ga0157374_10042919 3300013296 Bacteria 4175
162 Ga0157374_10301781 3300013296 Bacteria 1584
163 Ga0157374_10311442 3300013296 Bacteria 1559
164 Ga0157374_11750768 3300013296 Unclassified 646
165 Ga0157378_10052636 3300013297 Bacteria 3622
166 Ga0157378_10918582 3300013297 Bacteria 907
167 Ga0163162_10196188 3300013306 Bacteria 2148
168 Ga0163162_10548792 3300013306 Bacteria 1284
169 Ga0163162_10934530 3300013306 Unclassified 979
170 Ga0157372_10309756 3300013307 Bacteria 1838
171 Ga0157375_10095833 3300013308 Bacteria 3039
172 Ga0157375_10140878 3300013308 Bacteria 2538
173 Ga0163163_10653918 3300014325 Bacteria 1115
174 Ga0163163_11423812 3300014325 Unclassified 755
175 Ga0157380_10081469 3300014326 Bacteria 2648
176 Ga0157377_10158036 3300014745 Bacteria 1407
177 Ga0157377_10995626 3300014745 Unclassified 634
178 Ga0157379_10105480 3300014968 Bacteria 2529
179 Ga0157379_10155722 3300014968 Bacteria 2061
180 Ga0157376_10004619 3300014969 Bacteria 9593
181 Ga0157376_10226245 3300014969 Bacteria 1735
182 Ga0157376_11733036 3300014969 Unclassified 660
183 Ga0163161_10812852 3300017792 Unclassified 786
184 Ga0163161_11306598 3300017792 Unclassified 631
185 Ga0206356_11774517 3300020070 Bacteria 797
186 Ga0206349_1710093 3300020075 Bacteria 587
187 Ga0206351_10568405 3300020077 Unclassified 583
188 Ga0206351_10982475 3300020077 Bacteria 530
189 Ga0206352_10942534 3300020078 Unclassified 537
190 Ga0206350_10233412 3300020080 Bacteria 1305
191 Ga0206350_11193185 3300020080 Bacteria 1066
192 Ga0213872_10000169 3300021361 Bacteria 58596
193 Ga0224712_10190019 3300022467 Unclassified 929
194 Ga0207697_10102060 3300025315 Bacteria 1223
195 Ga0207697_10209919 3300025315 Unclassified 858
196 Ga0207682_10020750 3300025893 Bacteria 2580
197 Ga0207642_10009376 3300025899 Bacteria 3402
198 Ga0207710_10194846 3300025900 Bacteria 999
199 Ga0207688_10745981 3300025901 Unclassified 620
200 Ga0207680_10182681 3300025903 Bacteria 1419
201 Ga0207680_10410600 3300025903 Bacteria 958
202 Ga0207647_10041061 3300025904 Bacteria 2911
203 Ga0207645_10019409 3300025907 Bacteria 4457
204 Ga0207643_10021379 3300025908 Bacteria 3554
205 Ga0207643_10114799 3300025908 Bacteria 1589
206 Ga0207643_10199073 3300025908 Bacteria 1219
207 Ga0207705_10000012 3300025909 Bacteria 472336
208 Ga0207705_10098269 3300025909 Bacteria 2151
209 Ga0207705_11112130 3300025909 Unclassified 608
210 Ga0207654_10723640 3300025911 Bacteria 716
211 Ga0207707_10080765 3300025912 Bacteria 2839
212 Ga0207707_11148097 3300025912 Bacteria 631
213 Ga0207695_10000040 3300025913 Bacteria 452787
214 Ga0207695_10844422 3300025913 Bacteria 796
215 Ga0207671_10008561 3300025914 Bacteria 8656
216 Ga0207671_10686253 3300025914 Unclassified 815
217 Ga0207660_10210376 3300025917 Bacteria 1523
218 Ga0207657_10423999 3300025919 Bacteria 1045
219 Ga0207657_10450941 3300025919 Bacteria 1009
220 Ga0207649_10495115 3300025920 Unclassified 929
221 Ga0207652_10060530 3300025921 Bacteria 3267
222 Ga0207681_10239950 3300025923 Bacteria 1410
223 Ga0207681_10538944 3300025923 Unclassified 959
224 Ga0207694_10003234 3300025924 Bacteria 12982
225 Ga0207694_10150738 3300025924 Bacteria 1873
226 Ga0207650_10014067 3300025925 Bacteria 5556
227 Ga0207650_10358876 3300025925 Bacteria 1200
228 Ga0207659_10420263 3300025926 Bacteria 1121
229 Ga0207659_10697434 3300025926 Unclassified 869
230 Ga0207687_10068126 3300025927 Bacteria 2534
231 Ga0207687_10331103 3300025927 Bacteria 1235
232 Ga0207687_10557254 3300025927 Bacteria 962
233 Ga0207687_10731511 3300025927 Bacteria 841
234 Ga0207687_11053252 3300025927 Unclassified 698
235 Ga0207700_10064275 3300025928 Bacteria 2794
236 Ga0207664_10596297 3300025929 Bacteria 992
237 Ga0207644_10035510 3300025931 Bacteria 3493
238 Ga0207644_10494532 3300025931 Bacteria 1008
239 Ga0207644_11768861 3300025931 Unclassified 517
240 Ga0207690_10428389 3300025932 Bacteria 1060
241 Ga0207690_10643424 3300025932 Bacteria 868
242 Ga0207706_10050787 3300025933 Bacteria 3664
243 Ga0207686_10157454 3300025934 Bacteria 1588
244 Ga0207686_10405136 3300025934 Bacteria 1040
245 Ga0207709_10999423 3300025935 Unclassified 684
246 Ga0207670_10055413 3300025936 Bacteria 2679
247 Ga0207670_10502629 3300025936 Bacteria 984
248 Ga0207670_11740690 3300025936 Unclassified 530
249 Ga0207669_10007851 3300025937 Bacteria 4969
250 Ga0207669_11600598 3300025937 Bacteria 556
251 Ga0207691_10120788 3300025940 Bacteria 2322
252 Ga0207691_10450500 3300025940 Bacteria 1095
253 Ga0207711_10050528 3300025941 Bacteria 3559
254 Ga0207711_10512853 3300025941 Unclassified 1118
255 Ga0207711_10531427 3300025941 Bacteria 1097
256 Ga0207689_10007950 3300025942 Bacteria 9264
257 Ga0207689_10069367 3300025942 Bacteria 2896
258 Ga0207689_10217571 3300025942 Bacteria 1578
259 Ga0207651_10018335 3300025960 Bacteria 4162
260 Ga0207651_10311414 3300025960 Bacteria 1313
261 Ga0207651_10398979 3300025960 Bacteria 1169
262 Ga0207712_11309210 3300025961 Unclassified 648
263 Ga0207640_10787992 3300025981 Bacteria 822
264 Ga0207658_10102153 3300025986 Bacteria 2248
265 Ga0207658_10538461 3300025986 Bacteria 1044
266 Ga0207677_10888993 3300026023 Bacteria 802
267 Ga0207677_11109112 3300026023 Unclassified 721
268 Ga0207703_10224990 3300026035 Bacteria 1679
269 Ga0207703_10285638 3300026035 Bacteria 1500
270 Ga0207703_11374910 3300026035 Unclassified 679
271 Ga0207639_10150598 3300026041 Bacteria 1948
272 Ga0207678_10095710 3300026067 Bacteria 2537
273 Ga0207678_10172725 3300026067 Bacteria 1845
274 Ga0207708_10043521 3300026075 Bacteria 3422
275 Ga0207641_10006411 3300026088 Bacteria 9917
276 Ga0207641_10162485 3300026088 Bacteria 2031
277 Ga0207648_10022317 3300026089 Bacteria 5687
278 Ga0207648_10182887 3300026089 Bacteria 1855
279 Ga0207676_10002274 3300026095 Bacteria 13784
280 Ga0207676_10120732 3300026095 Bacteria 2210
281 Ga0207676_10508068 3300026095 Bacteria 1145
282 Ga0207676_10524921 3300026095 Bacteria 1127
283 Ga0207675_100178403 3300026118 Bacteria 2033
284 Ga0207675_100435751 3300026118 Unclassified 1297
285 Ga0207683_10463417 3300026121 Bacteria 1169
286 Ga0207683_10505276 3300026121 Bacteria 1117
287 Ga0207683_10983473 3300026121 Bacteria 783
288 Ga0207683_11400712 3300026121 Unclassified 646
289 Ga0207698_10005987 3300026142 Bacteria 7558
290 Ga0207698_10231289 3300026142 Bacteria 1678
291 Ga0207698_11136171 3300026142 Bacteria 794
292 Ga0207428_10076803 3300027907 Bacteria 2615
293 Ga0268266_10000962 3300028379 Bacteria 36632
294 Ga0268266_10285393 3300028379 Bacteria 1536
295 Ga0268266_10823275 3300028379 Bacteria 897
296 Ga0268265_10092895 3300028380 Bacteria 2416
297 Ga0268265_11519576 3300028380 Unclassified 673
298 Ga0268265_12112921 3300028380 Unclassified 570
299 Ga0268265_12667496 3300028380 Bacteria 505
300 Ga0268264_10686623 3300028381 Unclassified 1016
301 Ga0268264_10856425 3300028381 Unclassified 910
302 Ga0265334_10010432 3300028573 Bacteria 3922
303 Ga0265338_10046039 3300028800 Bacteria 4002
304 Ga0265332_10434691 3300031238 Bacteria 542
305 Ga0265339_10457987 3300031249 Unclassified 592
306 Ga0265327_10388467 3300031251 Bacteria 607
307 Ga0265316_10375848 3300031344 Bacteria 1026
308 Ga0265316_10698659 3300031344 Unclassified 715
309 Ga0307408_101827676 3300031548 Bacteria 581
310 Ga0265313_10332412 3300031595 Bacteria 605
311 Ga0265314_10080650 3300031711 Bacteria 2148
312 Ga0307516_10843124 3300031730 Bacteria 580
313 Ga0307406_11273309 3300031901 Bacteria 641
314 Ga0307416_102286703 3300032002 Bacteria 641
315 Ga0307510_10604386 3300033180 Unclassified 549
316 Ga0373928_0039098 3300035084 Bacteria 1083
317 Ga0373960_0451913 3300035121 Bacteria 504
318 Ga0373961_0018907 3300035241 Unclassified 1804
319 Ga0373937_0274235 3300036401 Unclassified 1592
320 Ga0373937_1261388 3300036401 Unclassified 687
321 Ga0395900_0174052 3300037418 Bacteria 2190
322 Ga0395898_0228096 3300037466 Unclassified 1776
323 Ga0395898_0566619 3300037466 Unclassified 1078
324 Ga0436365_0874983 3300039437 Bacteria 53988
325 Ga0436360_0920960 3300039438 Bacteria 821
326 Ga0436361_0159126 3300039447 Bacteria 34073
327 Ga0436361_0468750 3300039447 Bacteria 5954
328 Ga0436362_0559224 3300039453 Unclassified 871
329 Ga0439441_001671 3300042001 Bacteria 2972
330 Ga0439448_0257723 3300042005 Unclassified 616
331 Ga0495580_0646035 3300046472 Unclassified 696
332 Ga0495582_0037131 3300046473 Bacteria 2680
333 Ga0495639_0262088 3300046475 Bacteria 856
334 Ga0495584_0392680 3300046491 Bacteria 705
335 Ga0495606_0155685 3300046507 Bacteria 1337
336 Ga0495630_0651020 3300046517 Unclassified 807
337 Ga0495631_0180985 3300046518 Bacteria 903
338 Ga0495643_0136594 3300046522 Bacteria 1226
339 Ga0495640_0414760 3300046533 Bacteria 825
340 Ga0495586_0099954 3300046535 Bacteria 1609
341 Ga0495667_0390162 3300046559 Bacteria 877
342 Ga0495668_0126321 3300046616 Bacteria 1400
343 Ga0495635_0046787 3300046663 Bacteria 2984
344 Ga0495659_0514667 3300046664 Unclassified 525
345 Ga0495588_0192515 3300046674 Bacteria 1077
346 Ga0495649_0049739 3300046694 Bacteria 2276
347 Ga0495687_185450 3300047443 Bacteria 675
348 Ga0495684_0022980 3300047471 Bacteria 4797
349 Ga0495686_0368680 3300047472 Bacteria 777
350 Ga0495602_0591825 3300048088 Bacteria 764
351 Ga0496103_0187651 3300048906 Bacteria 1329
352 Ga0496109_1327980 3300048912 Bacteria 655
353 Ga0496110_0666164 3300048913 Unclassified 941
354 Ga0496114_0404640 3300048917 Bacteria 1209
355 Ga0496117_0168944 3300048920 Bacteria 1272
356 Ga0496118_0022362 3300048921 Bacteria 5531
357 Ga0496126_0189825 3300048929 Bacteria 1741
358 Ga0501031_0002927 3300049568 Bacteria 10919
359 Ga0501032_0044905 3300049569 Bacteria 2989
360 Ga0501033_0125333 3300049570 Bacteria 1862
361 Ga0501034_0002993 3300049571 Bacteria 19550
362 Ga0501036_0002773 3300049572 Bacteria 13870
363 Ga0501036_1263694 3300049572 Bacteria 601
364 Ga0501038_0003086 3300049574 Bacteria 15525
365 Ga0501039_0046004 3300049575 Bacteria 3372
366 Ga0501041_0852305 3300049577 Bacteria 585
367 Ga0501043_0032020 3300049579 Bacteria 4133
368 Ga0501046_0000036 3300049580 Bacteria 159823
369 Ga0501047_0000701 3300049581 Bacteria 34901
370 Ga0501048_0326225 3300049582 Bacteria 1094
371 Ga0501068_0161557 3300049584 Bacteria 1412
372 Ga0501069_0381463 3300049585 Bacteria 833
373 Ga0501070_0426989 3300049586 Bacteria 1070
374 Ga0501071_0475309 3300049587 Bacteria 958
375 Ga0501072_0706422 3300049588 Bacteria 792
376 Ga0501072_1452373 3300049588 Bacteria 530
377 Ga0501073_0006765 3300049589 Bacteria 8536
378 Ga0501074_1081392 3300049590 Unclassified 563
379 Ga0501079_0324827 3300049741 Bacteria 1205
380 Ga0501080_0007429 3300049742 Bacteria 9891
381 Ga0501081_1077922 3300049743 Bacteria 608
382 Ga0501035_0057861 3300049822 Bacteria 3455
383 Ga0501044_0069543 3300049823 Bacteria 3583
384 nmdc:mga03n38_110241_c1 3300050490 Bacteria 1339
385 nmdc:mga06z11_352394_c1 3300050494 Bacteria 881
386 nmdc:mga06r32_767965_c1 3300050510 Bacteria 926
387 nmdc:mga08y16_105934_c1 3300050511 Bacteria 2927
388 nmdc:mga08x19_552686_c1 3300050514 Bacteria 815
389 nmdc:mga0a205_297209_c1 3300050515 Bacteria 1488
390 Ga0500643_021928 3300053087 Bacteria 2065
391 Ga0500646_0360449 3300053090 Bacteria 531
392 Ga0500595_016289 3300053119 Bacteria 2772
393 Ga0500645_007305 3300053730 Bacteria 3862
394 Ga0501084_0603093 3300054114 Bacteria 928
395 Ga0500661_000948 3300055283 Bacteria 5419
396 2644222026 2643221639 Bacteria 6649903
397 Ga0495650_0000037
398 JGI24735J21928_10185379
399 Ga0058861_11323111
400 Ga0070658_10199510
401 Ga0070658_10476719
402 Ga0070676_10154365
403 Ga0070690_100060396
404 Ga0070670_100478740
405 Ga0070670_100738673
406 Ga0070670_101285994
407 Ga0070677_10026256
408 Ga0068869_100045783
409 Ga0068869_100714589
410 Ga0068869_100795447
411 Ga0068869_101063578
412 Ga0070666_10234131
413 Ga0070680_100185336
414 Ga0068868_100120864
415 Ga0068868_100248581
416 Ga0070660_100650990
417 Ga0070689_100068686
418 Ga0070689_100141405
419 Ga0070687_101133285
420 Ga0070661_100282560
421 Ga0070668_101473425
422 Ga0070669_101248470
423 Ga0070669_101481163
424 Ga0070675_100111941
425 Ga0070675_100473684
426 Ga0070675_100574931
427 Ga0070671_100094982
428 Ga0070671_100388501
429 Ga0070671_101025003
430 Ga0070674_100063595
431 Ga0070673_100422488
432 Ga0070673_100664776
433 Ga0070673_100814262
434 Ga0070688_100079056
435 Ga0070688_100113380
436 Ga0070659_100293504
437 Ga0070667_100064982
438 Ga0070667_100184838
439 Ga0070701_10034412
440 Ga0070711_100294002
441 Ga0070705_100860871
442 Ga0070705_100878287
443 Ga0070700_100321751
444 Ga0070694_100205470
445 Ga0070663_100047679
446 Ga0070663_100583735
447 Ga0070663_101105050
448 Ga0070678_100103362
449 Ga0070678_100264344
450 Ga0070678_101525194
451 Ga0070662_100208660
452 Ga0070662_101737929
453 Ga0070681_10142789
454 Ga0070681_10410701
455 Ga0068867_100212773
456 Ga0068867_100277982
457 Ga0070685_10000659
458 Ga0070685_11092262
459 Ga0070707_101322412
460 Ga0070679_100759435
461 Ga0068853_100242546
462 Ga0068853_101400263
463 Ga0070672_100056591
464 Ga0070672_100821678
465 Ga0070672_100923574
466 Ga0070686_100037871
467 Ga0070686_100998237
468 Ga0070696_101059910
469 Ga0070693_100568781
470 Ga0070665_100106313
471 Ga0070665_100277620
472 Ga0070665_102121638
473 Ga0070704_100373087
474 Ga0068857_101389438
475 Ga0068854_101221419
476 Ga0070702_100041231
477 Ga0068852_100008456
478 Ga0068852_100062194
479 Ga0068852_100388847
480 Ga0068852_101276804
481 Ga0068859_100668169
482 Ga0068859_101590766
483 Ga0068864_100145351
484 Ga0068864_100335949
485 Ga0068864_100696098
486 Ga0068866_10104853
487 Ga0068861_100076697
488 Ga0068861_100082224
489 Ga0068870_10197024
490 Ga0068870_10364794
491 Ga0068870_10745713
492 Ga0068863_100099328
493 Ga0068863_100107049
494 Ga0068863_100182655
495 Ga0068863_101417649
496 Ga0068858_100065220
497 Ga0068858_100247491
498 Ga0068858_100383809
499 Ga0068860_100296378
500 Ga0068860_101143915
501 Ga0068860_101475778
502 Ga0068862_101118218
503 Ga0068862_102307579
504 Ga0068862_102328558
505 Ga0075363_100083894
506 Ga0070716_101007049
507 Ga0075367_10610771
508 Ga0097621_100075105
509 Ga0097621_100322511
510 Ga0097621_100633759
511 Ga0097621_102008423
512 Ga0075370_10297836
513 Ga0068871_100113329
514 Ga0068871_100444945
515 Ga0068871_100506849
516 Ga0075431_100430462
517 Ga0075433_10233765
518 Ga0068865_100251353
519 Ga0075436_100118898
520 Ga0097620_100668178
521 Ga0097620_101590815
522 Ga0105240_10000719
523 Ga0105240_10009244
524 Ga0111539_10836383
525 Ga0105245_10139756
526 Ga0105245_10274908
527 Ga0105245_10359119
528 Ga0105245_10462056
529 Ga0105247_10042197
530 Ga0105241_10104971
531 Ga0105241_11524428
532 Ga0105242_10048317
533 Ga0105242_10377704
534 Ga0105242_10433584
535 Ga0105248_10021704
536 Ga0105248_10330772
537 Ga0105248_10819900
538 Ga0105248_11140992
539 Ga0105248_11188238
540 Ga0105248_11889949
541 Ga0105248_11996923
542 Ga0105237_10000076
543 Ga0105237_10016166
544 Ga0105238_10047373
545 Ga0105238_10162630
546 Ga0105238_12537378
547 Ga0105249_10377198
548 Ga0105239_10025961
549 Ga0105239_10299040
550 Ga0105246_10638505
551 Ga0105246_10775479
552 Ga0157373_10116110
553 Ga0157370_10189162
554 Ga0157370_10359228
555 Ga0157369_10037947
556 Ga0157369_10283730
557 Ga0157374_10042919
558 Ga0157374_10301781
559 Ga0157374_10311442
560 Ga0157374_11750768
561 Ga0157378_10052636
562 Ga0157378_10918582
563 Ga0163162_10196188
564 Ga0163162_10548792
565 Ga0163162_10934530
566 Ga0157372_10309756
567 Ga0157375_10095833
568 Ga0157375_10140878
569 Ga0163163_10653918
570 Ga0163163_11423812
571 Ga0157380_10081469
572 Ga0157377_10158036
573 Ga0157377_10995626
574 Ga0157379_10105480
575 Ga0157379_10155722
576 Ga0157376_10004619
577 Ga0157376_10226245
578 Ga0157376_11733036
579 Ga0163161_10812852
580 Ga0163161_11306598
581 Ga0206356_11774517
582 Ga0206349_1710093
583 Ga0206351_10568405
584 Ga0206351_10982475
585 Ga0206352_10942534
586 Ga0206350_10233412
587 Ga0206350_11193185
588 Ga0213872_10000169
589 Ga0224712_10190019
590 Ga0207697_10102060
591 Ga0207697_10209919
592 Ga0207682_10020750
593 Ga0207642_10009376
594 Ga0207710_10194846
595 Ga0207688_10745981
596 Ga0207680_10182681
597 Ga0207680_10410600
598 Ga0207647_10041061
599 Ga0207645_10019409
600 Ga0207643_10021379
601 Ga0207643_10114799
602 Ga0207643_10199073
603 Ga0207705_10000012
604 Ga0207705_10098269
605 Ga0207705_11112130
606 Ga0207654_10723640
607 Ga0207707_10080765
608 Ga0207707_11148097
609 Ga0207695_10000040
610 Ga0207695_10844422
611 Ga0207671_10008561
612 Ga0207671_10686253
613 Ga0207660_10210376
614 Ga0207657_10423999
615 Ga0207657_10450941
616 Ga0207649_10495115
617 Ga0207652_10060530
618 Ga0207681_10239950
619 Ga0207681_10538944
620 Ga0207694_10003234
621 Ga0207694_10150738
622 Ga0207650_10014067
623 Ga0207650_10358876
624 Ga0207659_10420263
625 Ga0207659_10697434
626 Ga0207687_10068126
627 Ga0207687_10331103
628 Ga0207687_10557254
629 Ga0207687_10731511
630 Ga0207687_11053252
631 Ga0207700_10064275
632 Ga0207664_10596297
633 Ga0207644_10035510
634 Ga0207644_10494532
635 Ga0207644_11768861
636 Ga0207690_10428389
637 Ga0207690_10643424
638 Ga0207706_10050787
639 Ga0207686_10157454
640 Ga0207686_10405136
641 Ga0207709_10999423
642 Ga0207670_10055413
643 Ga0207670_10502629
644 Ga0207670_11740690
645 Ga0207669_10007851
646 Ga0207669_11600598
647 Ga0207691_10120788
648 Ga0207691_10450500
649 Ga0207711_10050528
650 Ga0207711_10512853
651 Ga0207711_10531427
652 Ga0207689_10007950
653 Ga0207689_10069367
654 Ga0207689_10217571
655 Ga0207651_10018335
656 Ga0207651_10311414
657 Ga0207651_10398979
658 Ga0207712_11309210
659 Ga0207640_10787992
660 Ga0207658_10102153
661 Ga0207658_10538461
662 Ga0207677_10888993
663 Ga0207677_11109112
664 Ga0207703_10224990
665 Ga0207703_10285638
666 Ga0207703_11374910
667 Ga0207639_10150598
668 Ga0207678_10095710
669 Ga0207678_10172725
670 Ga0207708_10043521
671 Ga0207641_10006411
672 Ga0207641_10162485
673 Ga0207648_10022317
674 Ga0207648_10182887
675 Ga0207676_10002274
676 Ga0207676_10120732
677 Ga0207676_10508068
678 Ga0207676_10524921
679 Ga0207675_100178403
680 Ga0207675_100435751
681 Ga0207683_10463417
682 Ga0207683_10505276
683 Ga0207683_10983473
684 Ga0207683_11400712
685 Ga0207698_10005987
686 Ga0207698_10231289
687 Ga0207698_11136171
688 Ga0207428_10076803
689 Ga0268266_10000962
690 Ga0268266_10285393
691 Ga0268266_10823275
692 Ga0268265_10092895
693 Ga0268265_11519576
694 Ga0268265_12112921
695 Ga0268265_12667496
696 Ga0268264_10686623
697 Ga0268264_10856425
698 Ga0265334_10010432
699 Ga0265338_10046039
700 Ga0265332_10434691
701 Ga0265339_10457987
702 Ga0265327_10388467
703 Ga0265316_10375848
704 Ga0265316_10698659
705 Ga0307408_101827676
706 Ga0265313_10332412
707 Ga0265314_10080650
708 Ga0307516_10843124
709 Ga0307406_11273309
710 Ga0307416_102286703
711 Ga0307510_10604386
712 Ga0373928_0039098
713 Ga0373960_0451913
714 Ga0373961_0018907
715 Ga0373937_0274235
716 Ga0373937_1261388
717 Ga0395900_0174052
718 Ga0395898_0228096
719 Ga0395898_0566619
720 Ga0436365_0874983
721 Ga0436360_0920960
722 Ga0436361_0159126
723 Ga0436361_0468750
724 Ga0436362_0559224
725 Ga0439441_001671
726 Ga0439448_0257723
727 Ga0495580_0646035
728 Ga0495582_0037131
729 Ga0495639_0262088
730 Ga0495584_0392680
731 Ga0495606_0155685
732 Ga0495630_0651020
733 Ga0495631_0180985
734 Ga0495643_0136594
735 Ga0495640_0414760
736 Ga0495586_0099954
737 Ga0495667_0390162
738 Ga0495668_0126321
739 Ga0495635_0046787
740 Ga0495659_0514667
741 Ga0495588_0192515
742 Ga0495649_0049739
743 Ga0495687_185450
744 Ga0495684_0022980
745 Ga0495686_0368680
746 Ga0495602_0591825
747 Ga0496103_0187651
748 Ga0496109_1327980
749 Ga0496110_0666164
750 Ga0496114_0404640
751 Ga0496117_0168944
752 Ga0496118_0022362
753 Ga0496126_0189825
754 Ga0501031_0002927
755 Ga0501032_0044905
756 Ga0501033_0125333
757 Ga0501034_0002993
758 Ga0501036_0002773
759 Ga0501036_1263694
760 Ga0501038_0003086
761 Ga0501039_0046004
762 Ga0501041_0852305
763 Ga0501043_0032020
764 Ga0501046_0000036
765 Ga0501047_0000701
766 Ga0501048_0326225
767 Ga0501068_0161557
768 Ga0501069_0381463
769 Ga0501070_0426989
770 Ga0501071_0475309
771 Ga0501072_0706422
772 Ga0501072_1452373
773 Ga0501073_0006765
774 Ga0501074_1081392
775 Ga0501079_0324827
776 Ga0501080_0007429
777 Ga0501081_1077922
778 Ga0501035_0057861
779 Ga0501044_0069543
780 nmdc:mga03n38_110241_c1
781 nmdc:mga06z11_352394_c1
782 nmdc:mga06r32_767965_c1
783 nmdc:mga08y16_105934_c1
784 nmdc:mga08x19_552686_c1
785 nmdc:mga0a205_297209_c1
786 Ga0500643_021928
787 Ga0500646_0360449
788 Ga0500595_016289
789 Ga0500645_007305
790 Ga0501084_0603093
791 Ga0500661_000948
792 2644222026

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04014

MazE_antitoxin

Antidote-toxin recognition MazE, bacterial antitoxin

15

59

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z0r-assembly1.cif.gz_B solution structure of the n-terminal dna recognition domain of the bacillus subtilis transcription-state regulator abrb 0.7614 20 54
2mrn-assembly1.cif.gz_B structure of truncated ecmaze 0.7575 3 53
1mvf-assembly2.cif.gz_D maze addiction antidote 0.7518 10 50
2w1t-assembly1.cif.gz_B crystal structure of b. subtilis spovt 0.7423 6 54
2w1t-assembly1.cif.gz_A crystal structure of b. subtilis spovt 0.7149 5 55
ID Description Score Start End Superfamily
2w1tB01 Mainly Beta;Ribbon;Pemi-like Protein 1; Chain: D; 0.7532 6 52 2.10.260.10
1mvfE00 Mainly Beta;Ribbon;Pemi-like Protein 1; Chain: D; 0.7436 10 50 2.10.260.10
2w1tB01 Mainly Beta;Ribbon;Pemi-like Protein 1; Chain: D; 0.7407 6 52 2.10.260.10
2ro4B00 Mainly Beta;Ribbon;Pemi-like Protein 1; Chain: D; 0.7092 6 54 2.10.260.10
1mvfE00 Mainly Beta;Ribbon;Pemi-like Protein 1; Chain: D; 0.6951 10 50 2.10.260.10
ID Description Score Start End GO Terms
AF-A0A3N5II27-F1-model_v4 deleted 0.8986 6 57
AF-A0A6M2A8N5-F1-model_v4 SpoVT-AbrB domain-containing protein 0.8983 6 54 GO:0003677
AF-A0A1Q3R599-F1-model_v4 SpoVT-AbrB domain-containing protein 0.8676 6 64
AF-A0A2E4CFH2-F1-model_v4 AbrB/MazE/SpoVT family DNA-binding domain-containing protein 0.8607 6 79 GO:0003677
AF-A0A1G0K2Y0-F1-model_v4 Transcriptional regulator 0.8595 7 79 GO:0003677

Map