F433587

General Info

Members Datasets Scaffolds Average Seq Length
396 180 792 218

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0067241|Ga0451576_0067241_1803_2477
Length 224
Sequence VRQISAPAGVSPTFWRLLTTVPLAQATVLDVGTGRGRIALALAPLAHRVVGIDRDPEAIAEATQRAEAAGLTNVEFVTADVEKIEFVDIVPRRVPAHPDLVVAHLYFADRLVQEAGKALQPGGVLAFVAFHVDQWRETGRRSRFAVDEDQVRALLGECDFTIEHLEIERDEQHFESVEEALAAAIGLQERWRSDGRWFNYLKFLEQGGRTLTRSHLIVKARRTG

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
128 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
129 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
130 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
131 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
132 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
133 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
156 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
157 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
180 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.51
Rhizosphere 99.49
Stem 0
Stem Tuber 0
Unclassified 4.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0067241 3300045051 Bacteria 3730
2 JGI26128J50194_1001393 3300003347 Bacteria 1530
3 Ga0070670_100021904 3300005331 Bacteria 5498
4 Ga0068869_100012452 3300005334 Bacteria 5622
5 Ga0068869_100076929 3300005334 Bacteria 2481
6 Ga0068869_100271306 3300005334 Bacteria 1361
7 Ga0070682_100001980 3300005337 Bacteria 11420
8 Ga0068868_100228774 3300005338 Bacteria 1559
9 Ga0070689_100063949 3300005340 Bacteria 2863
10 Ga0070691_10002948 3300005341 Bacteria 7629
11 Ga0070661_100001090 3300005344 Bacteria 19190
12 Ga0070692_10004486 3300005345 Bacteria 5838
13 Ga0070669_100068890 3300005353 Bacteria 2612
14 Ga0070673_100622450 3300005364 Bacteria 986
15 Ga0070659_100013198 3300005366 Bacteria 6144
16 Ga0070667_100164676 3300005367 Bacteria 1955
17 Ga0070703_10012388 3300005406 Bacteria 2416
18 Ga0070703_10039127 3300005406 Bacteria 1469
19 Ga0070709_10056566 3300005434 Bacteria 2481
20 Ga0070701_10006908 3300005438 Bacteria 4806
21 Ga0070705_100000512 3300005440 Bacteria 22415
22 Ga0070705_100015068 3300005440 Bacteria 3989
23 Ga0070705_100074423 3300005440 Bacteria 2065
24 Ga0070705_100215306 3300005440 Bacteria 1327
25 Ga0070705_100242504 3300005440 Bacteria 1260
26 Ga0070694_100000995 3300005444 Bacteria 16085
27 Ga0070694_100008340 3300005444 Bacteria 6339
28 Ga0070694_100014169 3300005444 Bacteria 4989
29 Ga0070694_100542907 3300005444 Bacteria 930
30 Ga0070694_100640380 3300005444 Unclassified 859
31 Ga0070708_100015246 3300005445 Bacteria 6340
32 Ga0070708_100161164 3300005445 Bacteria 2090
33 Ga0070708_100220224 3300005445 Bacteria 1780
34 Ga0070708_100332706 3300005445 Bacteria 1431
35 Ga0070708_100436194 3300005445 Bacteria 1236
36 Ga0070708_100450344 3300005445 Bacteria 1214
37 Ga0070708_100604227 3300005445 Bacteria 1034
38 Ga0070663_100001865 3300005455 Bacteria 11756
39 Ga0070662_100032591 3300005457 Bacteria 3662
40 Ga0070662_100264485 3300005457 Bacteria 1387
41 Ga0068867_100008880 3300005459 Bacteria 7090
42 Ga0068867_100050082 3300005459 Bacteria 3077
43 Ga0070706_100004297 3300005467 Bacteria 13803
44 Ga0070706_100052748 3300005467 Bacteria 3753
45 Ga0070706_100080072 3300005467 Bacteria 3024
46 Ga0070706_100367463 3300005467 Bacteria 1340
47 Ga0070706_100373533 3300005467 Bacteria 1328
48 Ga0070707_100010578 3300005468 Bacteria 8589
49 Ga0070707_100044234 3300005468 Bacteria 4262
50 Ga0070707_100056028 3300005468 Bacteria 3780
51 Ga0070707_100738227 3300005468 Bacteria 948
52 Ga0070698_100001755 3300005471 Bacteria 24196
53 Ga0070698_100030035 3300005471 Bacteria 5639
54 Ga0070699_100002285 3300005518 Bacteria 17239
55 Ga0070699_100003629 3300005518 Bacteria 13650
56 Ga0070699_100004024 3300005518 Bacteria 12989
57 Ga0070699_100017431 3300005518 Bacteria 6165
58 Ga0070699_100088520 3300005518 Bacteria 2704
59 Ga0070699_100348463 3300005518 Bacteria 1334
60 Ga0070679_100017185 3300005530 Bacteria 6997
61 Ga0070697_100002557 3300005536 Bacteria 14009
62 Ga0070697_100003342 3300005536 Bacteria 12319
63 Ga0070697_100055350 3300005536 Bacteria 3225
64 Ga0070697_100065363 3300005536 Bacteria 2972
65 Ga0070697_100147084 3300005536 Bacteria 1984
66 Ga0070697_100493836 3300005536 Bacteria 1070
67 Ga0068853_100001202 3300005539 Bacteria 18462
68 Ga0070672_100148400 3300005543 Bacteria 1939
69 Ga0070686_100047347 3300005544 Bacteria 2719
70 Ga0070695_100002923 3300005545 Bacteria 9942
71 Ga0070695_100009145 3300005545 Bacteria 5889
72 Ga0070695_100032119 3300005545 Bacteria 3281
73 Ga0070695_100072059 3300005545 Bacteria 2264
74 Ga0070696_100005764 3300005546 Bacteria 8269
75 Ga0070696_100150997 3300005546 Bacteria 1705
76 Ga0070696_100197302 3300005546 Bacteria 1501
77 Ga0070696_100377400 3300005546 Bacteria 1104
78 Ga0070696_100441067 3300005546 Bacteria 1026
79 Ga0070693_100001523 3300005547 Bacteria 10456
80 Ga0070693_100010346 3300005547 Bacteria 4673
81 Ga0070704_100038663 3300005549 Bacteria 3271
82 Ga0070704_100233754 3300005549 Bacteria 1501
83 Ga0068855_100000888 3300005563 Bacteria 37101
84 Ga0070664_100033903 3300005564 Bacteria 4280
85 Ga0068857_100026498 3300005577 Bacteria 5110
86 Ga0068857_100026962 3300005577 Bacteria 5067
87 Ga0068854_100031896 3300005578 Bacteria 3663
88 Ga0068856_100001697 3300005614 Bacteria 23039
89 Ga0070702_100468131 3300005615 Unclassified 918
90 Ga0068852_100019393 3300005616 Bacteria 5381
91 Ga0068859_100015374 3300005617 Bacteria 7688
92 Ga0068859_100162437 3300005617 Bacteria 2313
93 Ga0068864_100019449 3300005618 Bacteria 5677
94 Ga0068861_100011758 3300005719 Bacteria 6093
95 Ga0068870_10033374 3300005840 Bacteria 2626
96 Ga0068863_100007993 3300005841 Bacteria 10338
97 Ga0068863_100023485 3300005841 Bacteria 5887
98 Ga0068860_100095890 3300005843 Bacteria 2828
99 Ga0068860_100109461 3300005843 Bacteria 2641
100 Ga0068860_100147593 3300005843 Bacteria 2263
101 Ga0068862_100003996 3300005844 Bacteria 12511
102 Ga0081455_10000130 3300005937 Bacteria 87593
103 Ga0081455_10414659 3300005937 Bacteria 930
104 Ga0081539_10000050 3300005985 Bacteria 269342
105 Ga0075432_10035094 3300006058 Unclassified 1743
106 Ga0070715_10071116 3300006163 Bacteria 1555
107 Ga0070716_100016270 3300006173 Bacteria 3834
108 Ga0070712_100153561 3300006175 Bacteria 1770
109 Ga0075428_100005208 3300006844 Bacteria 14452
110 Ga0075428_100024996 3300006844 Bacteria 6608
111 Ga0075428_100064269 3300006844 Bacteria 4018
112 Ga0075430_100000051 3300006846 Bacteria 61002
113 Ga0075430_100035618 3300006846 Bacteria 4222
114 Ga0075430_100125550 3300006846 Bacteria 2139
115 Ga0075430_100153853 3300006846 Bacteria 1915
116 Ga0075430_100343397 3300006846 Bacteria 1233
117 Ga0075431_100001402 3300006847 Bacteria 22101
118 Ga0075431_100006845 3300006847 Bacteria 11323
119 Ga0075431_100009950 3300006847 Bacteria 9552
120 Ga0075431_100010715 3300006847 Bacteria 9212
121 Ga0075431_100033089 3300006847 Bacteria 5328
122 Ga0075431_100148579 3300006847 Bacteria 2414
123 Ga0075431_100463769 3300006847 Bacteria 1261
124 Ga0075433_10001472 3300006852 Bacteria 17368
125 Ga0075433_10002763 3300006852 Bacteria 13428
126 Ga0075433_10022621 3300006852 Bacteria 5278
127 Ga0075433_10542819 3300006852 Bacteria 1022
128 Ga0075434_100031504 3300006871 Bacteria 5228
129 Ga0075434_100054635 3300006871 Bacteria 3967
130 Ga0075434_100070677 3300006871 Bacteria 3481
131 Ga0075434_100218220 3300006871 Bacteria 1927
132 Ga0075434_100387132 3300006871 Bacteria 1419
133 Ga0075429_100000587 3300006880 Bacteria 27992
134 Ga0075429_100001131 3300006880 Bacteria 21511
135 Ga0075429_100020653 3300006880 Bacteria 5716
136 Ga0075429_100028520 3300006880 Bacteria 4846
137 Ga0075429_100037800 3300006880 Bacteria 4202
138 Ga0075429_100536064 3300006880 Unclassified 1026
139 Ga0075436_100002041 3300006914 Bacteria 13918
140 Ga0075436_100009420 3300006914 Bacteria 6676
141 Ga0075436_100076462 3300006914 Bacteria 2318
142 Ga0097620_100015373 3300006931 Bacteria 7688
143 Ga0097620_100162437 3300006931 Bacteria 2313
144 Ga0075435_100032883 3300007076 Bacteria 4098
145 Ga0075435_100035579 3300007076 Bacteria 3952
146 Ga0075435_100076170 3300007076 Bacteria 2748
147 Ga0075435_100349460 3300007076 Bacteria 1267
148 Ga0099794_10003937 3300007265 Bacteria 5758
149 Ga0114129_10003334 3300009147 Bacteria 22561
150 Ga0114129_10011177 3300009147 Bacteria 12799
151 Ga0114129_10023163 3300009147 Bacteria 8808
152 Ga0114129_10035830 3300009147 Bacteria 7007
153 Ga0114129_10083755 3300009147 Bacteria 4428
154 Ga0114129_10143389 3300009147 Bacteria 3273
155 Ga0114129_10193353 3300009147 Bacteria 2761
156 Ga0114129_10244392 3300009147 Bacteria 2412
157 Ga0114129_10252106 3300009147 Bacteria 2369
158 Ga0114129_10367353 3300009147 Unclassified 1903
159 Ga0105243_10043397 3300009148 Bacteria 3524
160 Ga0105243_10092599 3300009148 Bacteria 2492
161 Ga0105243_10105888 3300009148 Bacteria 2343
162 Ga0105241_10000660 3300009174 Bacteria 25867
163 Ga0105248_10106099 3300009177 Bacteria 3168
164 Ga0105249_10058275 3300009553 Bacteria 3540
165 Ga0157373_10004995 3300013100 Bacteria 9967
166 Ga0157369_10029982 3300013105 Bacteria 6004
167 Ga0157378_10788660 3300013297 Bacteria 975
168 Ga0157372_10142271 3300013307 Bacteria 2765
169 Ga0163163_10137470 3300014325 Bacteria 2485
170 Ga0157380_10487802 3300014326 Bacteria 1193
171 Ga0206356_11172235 3300020070 Bacteria 1678
172 Ga0207653_10000607 3300025885 Bacteria 12535
173 Ga0207653_10003828 3300025885 Bacteria 4737
174 Ga0207653_10145330 3300025885 Bacteria 870
175 Ga0207688_10010429 3300025901 Bacteria 5058
176 Ga0207647_10114042 3300025904 Bacteria 1597
177 Ga0207685_10220690 3300025905 Bacteria 901
178 Ga0207645_10000037 3300025907 Bacteria 88771
179 Ga0207643_10000223 3300025908 Bacteria 39814
180 Ga0207684_10000470 3300025910 Bacteria 52370
181 Ga0207684_10003081 3300025910 Bacteria 16509
182 Ga0207684_10118429 3300025910 Bacteria 2269
183 Ga0207684_10119168 3300025910 Bacteria 2262
184 Ga0207684_10126959 3300025910 Bacteria 2189
185 Ga0207684_10196160 3300025910 Bacteria 1742
186 Ga0207684_10273495 3300025910 Bacteria 1457
187 Ga0207707_10000256 3300025912 Bacteria 58159
188 Ga0207660_10000031 3300025917 Bacteria 66315
189 Ga0207660_10000053 3300025917 Bacteria 59218
190 Ga0207652_10000953 3300025921 Bacteria 27077
191 Ga0207646_10000342 3300025922 Bacteria 63021
192 Ga0207646_10003035 3300025922 Bacteria 19317
193 Ga0207646_10003996 3300025922 Bacteria 16330
194 Ga0207646_10112715 3300025922 Bacteria 2441
195 Ga0207646_10115664 3300025922 Bacteria 2409
196 Ga0207646_10142745 3300025922 Bacteria 2157
197 Ga0207681_10075678 3300025923 Bacteria 2362
198 Ga0207690_10049038 3300025932 Bacteria 2812
199 Ga0207706_10025015 3300025933 Bacteria 5353
200 Ga0207686_10029789 3300025934 Bacteria 3224
201 Ga0207709_10142008 3300025935 Bacteria 1652
202 Ga0207709_10207518 3300025935 Bacteria 1404
203 Ga0207709_10320841 3300025935 Bacteria 1159
204 Ga0207665_10024038 3300025939 Bacteria 4015
205 Ga0207711_10009129 3300025941 Bacteria 8280
206 Ga0207689_10000101 3300025942 Bacteria 69326
207 Ga0207689_10091089 3300025942 Bacteria 2506
208 Ga0207689_10184866 3300025942 Bacteria 1719
209 Ga0207679_10003175 3300025945 Bacteria 10145
210 Ga0207640_10010536 3300025981 Bacteria 5212
211 Ga0207658_10163219 3300025986 Bacteria 1828
212 Ga0207678_10007295 3300026067 Bacteria 9799
213 Ga0207708_10055997 3300026075 Bacteria 3007
214 Ga0207702_10009251 3300026078 Bacteria 8280
215 Ga0207641_10194280 3300026088 Bacteria 1867
216 Ga0207641_10466659 3300026088 Bacteria 1222
217 Ga0207648_10002893 3300026089 Bacteria 18174
218 Ga0207648_10069258 3300026089 Bacteria 3074
219 Ga0207674_10000921 3300026116 Bacteria 38304
220 Ga0207674_10004092 3300026116 Bacteria 17668
221 Ga0209995_1001606 3300027471 Bacteria 3506
222 Ga0209968_1003259 3300027526 Bacteria 2436
223 Ga0209999_1020394 3300027543 Bacteria 1217
224 Ga0209983_1000579 3300027665 Bacteria 7904
225 Ga0209588_1007575 3300027671 Bacteria 3197
226 Ga0209971_1000020 3300027682 Bacteria 57940
227 Ga0209966_1000208 3300027695 Bacteria 23932
228 Ga0209998_10000319 3300027717 Bacteria 14406
229 Ga0209974_10015360 3300027876 Bacteria 2542
230 Ga0207428_10226740 3300027907 Unclassified 1399
231 Ga0268265_10075718 3300028380 Bacteria 2637
232 Ga0268265_10609833 3300028380 Bacteria 1044
233 Ga0268264_10003865 3300028381 Bacteria 12853
234 Ga0268264_10326814 3300028381 Unclassified 1452
235 Ga0268264_10340485 3300028381 Bacteria 1424
236 Ga0307408_100027036 3300031548 Bacteria 3950
237 Ga0307410_10741062 3300031852 Bacteria 831
238 Ga0307406_10151756 3300031901 Bacteria 1654
239 Ga0307406_10174265 3300031901 Bacteria 1560
240 Ga0307407_10328824 3300031903 Bacteria 1075
241 Ga0307412_10154960 3300031911 Bacteria 1695
242 Ga0307412_10838902 3300031911 Bacteria 801
243 Ga0307409_100069157 3300031995 Bacteria 2796
244 Ga0307416_100006841 3300032002 Bacteria 7176
245 Ga0307411_10411791 3300032005 Bacteria 1120
246 Ga0307411_10434775 3300032005 Bacteria 1093
247 Ga0373959_0008208 3300034820 Bacteria 1772
248 Ga0373928_0071332 3300035084 Unclassified 860
249 Ga0373940_0018398 3300035088 Bacteria 1753
250 Ga0373940_0040938 3300035088 Bacteria 1273
251 Ga0373951_0068882 3300035091 Bacteria 898
252 Ga0373941_0013176 3300035115 Bacteria 2180
253 Ga0373960_0115469 3300035121 Unclassified 885
254 Ga0373942_0012217 3300035207 Bacteria 2048
255 Ga0395899_0064356 3300037312 Bacteria 2696
256 Ga0395900_0027265 3300037418 Bacteria 5849
257 Ga0395898_0006833 3300037466 Bacteria 12135
258 Ga0395901_0001482 3300038443 Bacteria 24416
259 Ga0451577_0005964 3300042876 Bacteria 12280
260 Ga0451577_0138457 3300042876 Bacteria 2186
261 Ga0451577_0346275 3300042876 Unclassified 1348
262 Ga0453683_0009935 3300044673 Bacteria 6331
263 Ga0453683_0185294 3300044673 Bacteria 1320
264 Ga0453684_0367101 3300044712 Bacteria 1619
265 Ga0453684_0553496 3300044712 Bacteria 1267
266 Ga0451576_0012285 3300045051 Bacteria 9633
267 Ga0451576_0040961 3300045051 Bacteria 4898
268 Ga0451576_0152898 3300045051 Bacteria 2406
269 Ga0495580_0021211 3300046472 Bacteria 4797
270 Ga0496106_0623568 3300048909 Unclassified 863
271 Ga0496113_0468017 3300048916 Bacteria 1013
272 Ga0501031_0529820 3300049568 Bacteria 759
273 Ga0501033_0041093 3300049570 Bacteria 3452
274 Ga0501033_0093321 3300049570 Bacteria 2201
275 Ga0501038_0057719 3300049574 Bacteria 3332
276 Ga0501038_0345285 3300049574 Bacteria 1160
277 Ga0501039_0483307 3300049575 Bacteria 973
278 Ga0501040_0006174 3300049576 Bacteria 7773
279 Ga0501040_0016852 3300049576 Bacteria 4844
280 Ga0501040_0120578 3300049576 Bacteria 1840
281 Ga0501040_0406094 3300049576 Bacteria 978
282 Ga0501041_0012038 3300049577 Bacteria 5120
283 Ga0501041_0137439 3300049577 Bacteria 1523
284 Ga0501041_0248663 3300049577 Unclassified 1118
285 Ga0501041_0310916 3300049577 Bacteria 993
286 Ga0501042_0007014 3300049578 Bacteria 7355
287 Ga0501042_0022895 3300049578 Bacteria 4365
288 Ga0501042_0180485 3300049578 Bacteria 1523
289 Ga0501043_0102316 3300049579 Bacteria 2252
290 Ga0501043_0283945 3300049579 Bacteria 1268
291 Ga0501046_0015832 3300049580 Bacteria 6328
292 Ga0501046_0053031 3300049580 Bacteria 3195
293 Ga0501046_0205353 3300049580 Bacteria 1465
294 Ga0501047_0045854 3300049581 Bacteria 4226
295 Ga0501048_0003682 3300049582 Bacteria 11686
296 Ga0501048_0074339 3300049582 Bacteria 2398
297 Ga0501067_0051730 3300049583 Bacteria 2276
298 Ga0501067_0054447 3300049583 Bacteria 2217
299 Ga0501068_0159578 3300049584 Bacteria 1421
300 Ga0501069_0394744 3300049585 Bacteria 818
301 Ga0501071_0274923 3300049587 Bacteria 1274
302 Ga0501072_0013456 3300049588 Bacteria 6262
303 Ga0501072_0079858 3300049588 Bacteria 2591
304 Ga0501072_0087927 3300049588 Bacteria 2465
305 Ga0501074_0036630 3300049590 Bacteria 3554
306 Ga0501074_0055116 3300049590 Bacteria 2866
307 Ga0501074_0153270 3300049590 Bacteria 1647
308 Ga0501074_0453681 3300049590 Bacteria 909
309 Ga0501075_0050569 3300049591 Bacteria 3124
310 Ga0501075_0050812 3300049591 Bacteria 3117
311 Ga0501075_0054733 3300049591 Bacteria 3002
312 Ga0501076_0004391 3300049592 Bacteria 10023
313 Ga0501076_0019783 3300049592 Bacteria 5150
314 Ga0501076_0055352 3300049592 Bacteria 3146
315 Ga0501076_0153752 3300049592 Bacteria 1872
316 Ga0501076_0275154 3300049592 Bacteria 1379
317 Ga0501077_0015003 3300049593 Bacteria 4871
318 Ga0501077_0158597 3300049593 Bacteria 1436
319 Ga0501077_0167282 3300049593 Unclassified 1397
320 Ga0501077_0212745 3300049593 Bacteria 1229
321 Ga0501077_0372295 3300049593 Bacteria 912
322 Ga0501079_0004711 3300049741 Bacteria 10095
323 Ga0501079_0017884 3300049741 Bacteria 5414
324 Ga0501079_0018195 3300049741 Bacteria 5367
325 Ga0501079_0245712 3300049741 Unclassified 1398
326 Ga0501079_0256679 3300049741 Bacteria 1366
327 Ga0501080_0012681 3300049742 Bacteria 7730
328 Ga0501080_0231401 3300049742 Bacteria 1689
329 Ga0501080_0333305 3300049742 Bacteria 1372
330 Ga0501080_0351422 3300049742 Bacteria 1331
331 Ga0501080_0421191 3300049742 Bacteria 1199
332 Ga0501081_0003005 3300049743 Bacteria 10709
333 Ga0501081_0008579 3300049743 Bacteria 6642
334 Ga0501081_0020691 3300049743 Bacteria 4388
335 Ga0501081_0026021 3300049743 Bacteria 3942
336 Ga0501083_0292577 3300049744 Bacteria 1059
337 Ga0501035_0195596 3300049822 Bacteria 1737
338 Ga0501045_0000957 3300049824 Bacteria 18883
339 Ga0501045_0115294 3300049824 Bacteria 1993
340 Ga0501045_0731137 3300049824 Unclassified 730
341 nmdc:mga05p37_102100_c1 3300050507 Bacteria 3532
342 nmdc:mga05p37_13715_c1 3300050507 Bacteria 9712
343 nmdc:mga05p37_15330_c1 3300050507 Bacteria 9207
344 nmdc:mga05p37_27212_c1 3300050507 Bacteria 6961
345 nmdc:mga05p37_293949_c1 3300050507 Unclassified 1933
346 nmdc:mga05p37_327972_c1 3300050507 Bacteria 1809
347 nmdc:mga05p37_348532_c1 3300050507 Bacteria 1744
348 nmdc:mga05p37_419064_c1 3300050507 Bacteria 1559
349 nmdc:mga05p37_65078_c1 3300050507 Bacteria 4486
350 nmdc:mga05p37_78844_c1 3300050507 Bacteria 4056
351 nmdc:mga05p37_809531_c1 3300050507 Bacteria 1024
352 nmdc:mga09592_143723_c1 3300050508 Bacteria 2057
353 nmdc:mga09592_17541_c1 3300050508 Bacteria 5866
354 nmdc:mga09592_1890_c1 3300050508 Bacteria 16868
355 nmdc:mga09592_4013_c1 3300050508 Bacteria 11873
356 nmdc:mga09592_437194_c1 3300050508 Unclassified 1129
357 nmdc:mga0qj67_1071_c1 3300050509 Bacteria 18948
358 nmdc:mga0qj67_138070_c1 3300050509 Bacteria 1976
359 nmdc:mga0qj67_14629_c1 3300050509 Bacteria 5933
360 nmdc:mga0qj67_243505_c1 3300050509 Bacteria 1459
361 nmdc:mga0qj67_281561_c1 3300050509 Bacteria 1348
362 nmdc:mga0qj67_599068_c1 3300050509 Bacteria 881
363 nmdc:mga06r32_186873_c1 3300050510 Bacteria 2059
364 nmdc:mga06r32_209983_c1 3300050510 Bacteria 1935
365 nmdc:mga06r32_232203_c1 3300050510 Bacteria 1833
366 nmdc:mga06r32_315811_c1 3300050510 Unclassified 1548
367 nmdc:mga06r32_42464_c1 3300050510 Bacteria 4323
368 nmdc:mga06r32_6029_c1 3300050510 Bacteria 10904
369 nmdc:mga06r32_633_c1 3300050510 Bacteria 30525
370 nmdc:mga0n895_110740_c1 3300050512 Bacteria 2762
371 nmdc:mga0n895_11231_c1 3300050512 Bacteria 7977
372 nmdc:mga0n895_24907_c1 3300050512 Bacteria 5647
373 nmdc:mga0n895_380248_c1 3300050512 Bacteria 1429
374 nmdc:mga0n895_7599_c1 3300050512 Bacteria 9320
375 nmdc:mga0rr50_13568_c1 3300050513 Bacteria 5311
376 nmdc:mga0rr50_28035_c1 3300050513 Bacteria 3953
377 nmdc:mga0rr50_484457_c1 3300050513 Bacteria 1051
378 nmdc:mga0rr50_5444_c1 3300050513 Bacteria 7594
379 nmdc:mga0rr50_5513_c1 3300050513 Bacteria 7560
380 nmdc:mga08x19_4116_c1 3300050514 Bacteria 8628
381 nmdc:mga08x19_7573_c1 3300050514 Bacteria 6451
382 nmdc:mga08x19_9387_c1 3300050514 Bacteria 5858
383 nmdc:mga0a205_125689_c1 3300050515 Bacteria 2464
384 nmdc:mga0a205_13267_c1 3300050515 Bacteria 7663
385 nmdc:mga0a205_201229_c1 3300050515 Bacteria 1882
386 nmdc:mga0a205_2884_c1 3300050515 Bacteria 15210
387 nmdc:mga0a205_3306_c1 3300050515 Bacteria 14349
388 Ga0501084_0010643 3300054114 Bacteria 7613
389 Ga0501084_0027344 3300054114 Bacteria 4766
390 Ga0501084_0134126 3300054114 Bacteria 2084
391 Ga0501082_0001921 3300060353 Bacteria 18264
392 Ga0501082_0149822 3300060353 Bacteria 2026
393 Ga0530510_0004443 3300061734 Bacteria 9708
394 Ga0530510_0063981 3300061734 Bacteria 2664
395 Ga0530510_0146964 3300061734 Bacteria 1739
396 Ga0530510_0273115 3300061734 Bacteria 1262
397 Ga0451576_0067241
398 JGI26128J50194_1001393
399 Ga0070670_100021904
400 Ga0068869_100012452
401 Ga0068869_100076929
402 Ga0068869_100271306
403 Ga0070682_100001980
404 Ga0068868_100228774
405 Ga0070689_100063949
406 Ga0070691_10002948
407 Ga0070661_100001090
408 Ga0070692_10004486
409 Ga0070669_100068890
410 Ga0070673_100622450
411 Ga0070659_100013198
412 Ga0070667_100164676
413 Ga0070703_10012388
414 Ga0070703_10039127
415 Ga0070709_10056566
416 Ga0070701_10006908
417 Ga0070705_100000512
418 Ga0070705_100015068
419 Ga0070705_100074423
420 Ga0070705_100215306
421 Ga0070705_100242504
422 Ga0070694_100000995
423 Ga0070694_100008340
424 Ga0070694_100014169
425 Ga0070694_100542907
426 Ga0070694_100640380
427 Ga0070708_100015246
428 Ga0070708_100161164
429 Ga0070708_100220224
430 Ga0070708_100332706
431 Ga0070708_100436194
432 Ga0070708_100450344
433 Ga0070708_100604227
434 Ga0070663_100001865
435 Ga0070662_100032591
436 Ga0070662_100264485
437 Ga0068867_100008880
438 Ga0068867_100050082
439 Ga0070706_100004297
440 Ga0070706_100052748
441 Ga0070706_100080072
442 Ga0070706_100367463
443 Ga0070706_100373533
444 Ga0070707_100010578
445 Ga0070707_100044234
446 Ga0070707_100056028
447 Ga0070707_100738227
448 Ga0070698_100001755
449 Ga0070698_100030035
450 Ga0070699_100002285
451 Ga0070699_100003629
452 Ga0070699_100004024
453 Ga0070699_100017431
454 Ga0070699_100088520
455 Ga0070699_100348463
456 Ga0070679_100017185
457 Ga0070697_100002557
458 Ga0070697_100003342
459 Ga0070697_100055350
460 Ga0070697_100065363
461 Ga0070697_100147084
462 Ga0070697_100493836
463 Ga0068853_100001202
464 Ga0070672_100148400
465 Ga0070686_100047347
466 Ga0070695_100002923
467 Ga0070695_100009145
468 Ga0070695_100032119
469 Ga0070695_100072059
470 Ga0070696_100005764
471 Ga0070696_100150997
472 Ga0070696_100197302
473 Ga0070696_100377400
474 Ga0070696_100441067
475 Ga0070693_100001523
476 Ga0070693_100010346
477 Ga0070704_100038663
478 Ga0070704_100233754
479 Ga0068855_100000888
480 Ga0070664_100033903
481 Ga0068857_100026498
482 Ga0068857_100026962
483 Ga0068854_100031896
484 Ga0068856_100001697
485 Ga0070702_100468131
486 Ga0068852_100019393
487 Ga0068859_100015374
488 Ga0068859_100162437
489 Ga0068864_100019449
490 Ga0068861_100011758
491 Ga0068870_10033374
492 Ga0068863_100007993
493 Ga0068863_100023485
494 Ga0068860_100095890
495 Ga0068860_100109461
496 Ga0068860_100147593
497 Ga0068862_100003996
498 Ga0081455_10000130
499 Ga0081455_10414659
500 Ga0081539_10000050
501 Ga0075432_10035094
502 Ga0070715_10071116
503 Ga0070716_100016270
504 Ga0070712_100153561
505 Ga0075428_100005208
506 Ga0075428_100024996
507 Ga0075428_100064269
508 Ga0075430_100000051
509 Ga0075430_100035618
510 Ga0075430_100125550
511 Ga0075430_100153853
512 Ga0075430_100343397
513 Ga0075431_100001402
514 Ga0075431_100006845
515 Ga0075431_100009950
516 Ga0075431_100010715
517 Ga0075431_100033089
518 Ga0075431_100148579
519 Ga0075431_100463769
520 Ga0075433_10001472
521 Ga0075433_10002763
522 Ga0075433_10022621
523 Ga0075433_10542819
524 Ga0075434_100031504
525 Ga0075434_100054635
526 Ga0075434_100070677
527 Ga0075434_100218220
528 Ga0075434_100387132
529 Ga0075429_100000587
530 Ga0075429_100001131
531 Ga0075429_100020653
532 Ga0075429_100028520
533 Ga0075429_100037800
534 Ga0075429_100536064
535 Ga0075436_100002041
536 Ga0075436_100009420
537 Ga0075436_100076462
538 Ga0097620_100015373
539 Ga0097620_100162437
540 Ga0075435_100032883
541 Ga0075435_100035579
542 Ga0075435_100076170
543 Ga0075435_100349460
544 Ga0099794_10003937
545 Ga0114129_10003334
546 Ga0114129_10011177
547 Ga0114129_10023163
548 Ga0114129_10035830
549 Ga0114129_10083755
550 Ga0114129_10143389
551 Ga0114129_10193353
552 Ga0114129_10244392
553 Ga0114129_10252106
554 Ga0114129_10367353
555 Ga0105243_10043397
556 Ga0105243_10092599
557 Ga0105243_10105888
558 Ga0105241_10000660
559 Ga0105248_10106099
560 Ga0105249_10058275
561 Ga0157373_10004995
562 Ga0157369_10029982
563 Ga0157378_10788660
564 Ga0157372_10142271
565 Ga0163163_10137470
566 Ga0157380_10487802
567 Ga0206356_11172235
568 Ga0207653_10000607
569 Ga0207653_10003828
570 Ga0207653_10145330
571 Ga0207688_10010429
572 Ga0207647_10114042
573 Ga0207685_10220690
574 Ga0207645_10000037
575 Ga0207643_10000223
576 Ga0207684_10000470
577 Ga0207684_10003081
578 Ga0207684_10118429
579 Ga0207684_10119168
580 Ga0207684_10126959
581 Ga0207684_10196160
582 Ga0207684_10273495
583 Ga0207707_10000256
584 Ga0207660_10000031
585 Ga0207660_10000053
586 Ga0207652_10000953
587 Ga0207646_10000342
588 Ga0207646_10003035
589 Ga0207646_10003996
590 Ga0207646_10112715
591 Ga0207646_10115664
592 Ga0207646_10142745
593 Ga0207681_10075678
594 Ga0207690_10049038
595 Ga0207706_10025015
596 Ga0207686_10029789
597 Ga0207709_10142008
598 Ga0207709_10207518
599 Ga0207709_10320841
600 Ga0207665_10024038
601 Ga0207711_10009129
602 Ga0207689_10000101
603 Ga0207689_10091089
604 Ga0207689_10184866
605 Ga0207679_10003175
606 Ga0207640_10010536
607 Ga0207658_10163219
608 Ga0207678_10007295
609 Ga0207708_10055997
610 Ga0207702_10009251
611 Ga0207641_10194280
612 Ga0207641_10466659
613 Ga0207648_10002893
614 Ga0207648_10069258
615 Ga0207674_10000921
616 Ga0207674_10004092
617 Ga0209995_1001606
618 Ga0209968_1003259
619 Ga0209999_1020394
620 Ga0209983_1000579
621 Ga0209588_1007575
622 Ga0209971_1000020
623 Ga0209966_1000208
624 Ga0209998_10000319
625 Ga0209974_10015360
626 Ga0207428_10226740
627 Ga0268265_10075718
628 Ga0268265_10609833
629 Ga0268264_10003865
630 Ga0268264_10326814
631 Ga0268264_10340485
632 Ga0307408_100027036
633 Ga0307410_10741062
634 Ga0307406_10151756
635 Ga0307406_10174265
636 Ga0307407_10328824
637 Ga0307412_10154960
638 Ga0307412_10838902
639 Ga0307409_100069157
640 Ga0307416_100006841
641 Ga0307411_10411791
642 Ga0307411_10434775
643 Ga0373959_0008208
644 Ga0373928_0071332
645 Ga0373940_0018398
646 Ga0373940_0040938
647 Ga0373951_0068882
648 Ga0373941_0013176
649 Ga0373960_0115469
650 Ga0373942_0012217
651 Ga0395899_0064356
652 Ga0395900_0027265
653 Ga0395898_0006833
654 Ga0395901_0001482
655 Ga0451577_0005964
656 Ga0451577_0138457
657 Ga0451577_0346275
658 Ga0453683_0009935
659 Ga0453683_0185294
660 Ga0453684_0367101
661 Ga0453684_0553496
662 Ga0451576_0012285
663 Ga0451576_0040961
664 Ga0451576_0152898
665 Ga0495580_0021211
666 Ga0496106_0623568
667 Ga0496113_0468017
668 Ga0501031_0529820
669 Ga0501033_0041093
670 Ga0501033_0093321
671 Ga0501038_0057719
672 Ga0501038_0345285
673 Ga0501039_0483307
674 Ga0501040_0006174
675 Ga0501040_0016852
676 Ga0501040_0120578
677 Ga0501040_0406094
678 Ga0501041_0012038
679 Ga0501041_0137439
680 Ga0501041_0248663
681 Ga0501041_0310916
682 Ga0501042_0007014
683 Ga0501042_0022895
684 Ga0501042_0180485
685 Ga0501043_0102316
686 Ga0501043_0283945
687 Ga0501046_0015832
688 Ga0501046_0053031
689 Ga0501046_0205353
690 Ga0501047_0045854
691 Ga0501048_0003682
692 Ga0501048_0074339
693 Ga0501067_0051730
694 Ga0501067_0054447
695 Ga0501068_0159578
696 Ga0501069_0394744
697 Ga0501071_0274923
698 Ga0501072_0013456
699 Ga0501072_0079858
700 Ga0501072_0087927
701 Ga0501074_0036630
702 Ga0501074_0055116
703 Ga0501074_0153270
704 Ga0501074_0453681
705 Ga0501075_0050569
706 Ga0501075_0050812
707 Ga0501075_0054733
708 Ga0501076_0004391
709 Ga0501076_0019783
710 Ga0501076_0055352
711 Ga0501076_0153752
712 Ga0501076_0275154
713 Ga0501077_0015003
714 Ga0501077_0158597
715 Ga0501077_0167282
716 Ga0501077_0212745
717 Ga0501077_0372295
718 Ga0501079_0004711
719 Ga0501079_0017884
720 Ga0501079_0018195
721 Ga0501079_0245712
722 Ga0501079_0256679
723 Ga0501080_0012681
724 Ga0501080_0231401
725 Ga0501080_0333305
726 Ga0501080_0351422
727 Ga0501080_0421191
728 Ga0501081_0003005
729 Ga0501081_0008579
730 Ga0501081_0020691
731 Ga0501081_0026021
732 Ga0501083_0292577
733 Ga0501035_0195596
734 Ga0501045_0000957
735 Ga0501045_0115294
736 Ga0501045_0731137
737 nmdc:mga05p37_102100_c1
738 nmdc:mga05p37_13715_c1
739 nmdc:mga05p37_15330_c1
740 nmdc:mga05p37_27212_c1
741 nmdc:mga05p37_293949_c1
742 nmdc:mga05p37_327972_c1
743 nmdc:mga05p37_348532_c1
744 nmdc:mga05p37_419064_c1
745 nmdc:mga05p37_65078_c1
746 nmdc:mga05p37_78844_c1
747 nmdc:mga05p37_809531_c1
748 nmdc:mga09592_143723_c1
749 nmdc:mga09592_17541_c1
750 nmdc:mga09592_1890_c1
751 nmdc:mga09592_4013_c1
752 nmdc:mga09592_437194_c1
753 nmdc:mga0qj67_1071_c1
754 nmdc:mga0qj67_138070_c1
755 nmdc:mga0qj67_14629_c1
756 nmdc:mga0qj67_243505_c1
757 nmdc:mga0qj67_281561_c1
758 nmdc:mga0qj67_599068_c1
759 nmdc:mga06r32_186873_c1
760 nmdc:mga06r32_209983_c1
761 nmdc:mga06r32_232203_c1
762 nmdc:mga06r32_315811_c1
763 nmdc:mga06r32_42464_c1
764 nmdc:mga06r32_6029_c1
765 nmdc:mga06r32_633_c1
766 nmdc:mga0n895_110740_c1
767 nmdc:mga0n895_11231_c1
768 nmdc:mga0n895_24907_c1
769 nmdc:mga0n895_380248_c1
770 nmdc:mga0n895_7599_c1
771 nmdc:mga0rr50_13568_c1
772 nmdc:mga0rr50_28035_c1
773 nmdc:mga0rr50_484457_c1
774 nmdc:mga0rr50_5444_c1
775 nmdc:mga0rr50_5513_c1
776 nmdc:mga08x19_4116_c1
777 nmdc:mga08x19_7573_c1
778 nmdc:mga08x19_9387_c1
779 nmdc:mga0a205_125689_c1
780 nmdc:mga0a205_13267_c1
781 nmdc:mga0a205_201229_c1
782 nmdc:mga0a205_2884_c1
783 nmdc:mga0a205_3306_c1
784 Ga0501084_0010643
785 Ga0501084_0027344
786 Ga0501084_0134126
787 Ga0501082_0001921
788 Ga0501082_0149822
789 Ga0530510_0004443
790 Ga0530510_0063981
791 Ga0530510_0146964
792 Ga0530510_0273115

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08242

Methyltransf_12

Methyltransferase domain

29

125

0.94

PF08241

Methyltransf_11

Methyltransferase domain

29

127

0.9

PF05175

MTS

Methyltransferase small domain

14

142

0.89

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

14

132

0.88

PF13649

Methyltransf_25

Methyltransferase domain

28

123

0.84

PF13847

Methyltransf_31

Methyltransferase domain

23

198

0.84

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

2

84

0.8

PF13489

Methyltransf_23

Methyltransferase domain

11

165

0.79

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

15

150

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4m36-assembly1.cif.gz_A crystal structure of trypanosoma brucei protein arginine methyltransferase 7 0.8739 14 121
2zbp-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methyltransferase from thermus thermophilus in complex with s-adenosyl-l-methionine 0.8418 12 161
3cjr-assembly1.cif.gz_A ribosomal protein l11 methyltransferase (prma) in complex with ribosomal protein l11 (k39a) and inhibitor sinefungin. 0.8362 12 214
5eku-assembly1.cif.gz_B crystal structure of trypanosoma brucei protein arginine methyltransferase prmt7 in complex with s-adenosyl-l-homocysteine 0.8342 14 121
3cjt-assembly8.cif.gz_O ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.8271 12 214
ID Description Score Start End Superfamily
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9816 27 82 3.40.50.150
af_A0A1D6FP61_65_209_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9505 23 67 3.40.50.150
af_Q4E3J0_145_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9308 26 85 3.40.50.150
af_Q8IEC3_50_217_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9149 23 80 3.40.50.150
af_Q8I3G1_737_866_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9141 27 99 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1F8TD40-F1-model_v4 Methyltransferase domain-containing protein 0.9408 25 96
AF-A0A5S9M3Y3-F1-model_v4 Methyltransferase domain-containing protein 0.9138 16 83 GO:0070041
GO:0070475
AF-A0A1E4I6E9-F1-model_v4 Methyltransferase type 12 domain-containing protein 0.9106 21 123 GO:0008168
GO:0032259
AF-A0A0R2STM9-F1-model_v4 TRAM domain-containing protein 0.9093 16 84 GO:0070041
GO:0070475
AF-A0A3B8WWS8-F1-model_v4 23S rRNA (Uracil(1939)-C(5))-methyltransferase RlmD 0.9062 13 97 GO:0070041
GO:0070475

Map