F433552

General Info

Members Datasets Scaffolds Average Seq Length
396 194 792 90

Family's Representative Sequence

Representative Sequence 3300031911|Ga0307412_11035804|Ga0307412_110358042
Length 108
Sequence MPPWSASSITSRSGIRDSSVQLARVIGDVVATIKDANLTGLKLLVLQPITASGEGVGRTLVALDSVGAGVGEHVFFVRGREAAFPFYPGEPPADATVVGIVDHWNTEA

Samples

Sample ID Description Type Environment
1 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
108 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
109 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
115 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
116 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
117 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
118 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
119 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
120 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
121 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
122 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
123 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
124 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
125 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
126 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
127 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
128 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
129 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
130 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
131 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
132 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
169 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
170 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
171 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
182 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.26
Nodule 0
Rhizoplane 0.25
Rhizosphere 97.98
Stem 0
Stem Tuber 0
Unclassified 19.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307412_11035804 3300031911 Bacteria 727
2 JGI24751J29686_10086256 3300002459 Bacteria 652
3 Ga0065707_10001463 3300005295 Bacteria 12001
4 Ga0070690_100206035 3300005330 Bacteria 1371
5 Ga0068869_101191134 3300005334 Bacteria 669
6 Ga0068869_101324919 3300005334 Bacteria 636
7 Ga0068868_100478308 3300005338 Bacteria 1088
8 Ga0068868_102167876 3300005338 Bacteria 529
9 Ga0070689_100316584 3300005340 Bacteria 1302
10 Ga0070689_101587644 3300005340 Bacteria 594
11 Ga0070687_100360404 3300005343 Bacteria 941
12 Ga0070661_100605627 3300005344 Bacteria 886
13 Ga0070661_100831329 3300005344 Bacteria 759
14 Ga0070692_10324745 3300005345 Unclassified 948
15 Ga0070668_102279344 3300005347 Unclassified 501
16 Ga0070669_100080984 3300005353 Bacteria 2418
17 Ga0070669_100120522 3300005353 Bacteria 2001
18 Ga0070669_100892410 3300005353 Unclassified 759
19 Ga0070675_100386574 3300005354 Unclassified 1246
20 Ga0070673_100015038 3300005364 Bacteria 5417
21 Ga0070688_100674472 3300005365 Unclassified 798
22 Ga0070688_101540455 3300005365 Bacteria 542
23 Ga0070667_101819540 3300005367 Unclassified 573
24 Ga0070701_11110950 3300005438 Bacteria 557
25 Ga0070662_100326190 3300005457 Bacteria 1253
26 Ga0068867_100432619 3300005459 Bacteria 1117
27 Ga0070707_100302173 3300005468 Bacteria 1555
28 Ga0070698_100245422 3300005471 Bacteria 1724
29 Ga0070699_100343235 3300005518 Bacteria 1344
30 Ga0070699_101991232 3300005518 Bacteria 531
31 Ga0070697_101092525 3300005536 Bacteria 710
32 Ga0070672_101452685 3300005543 Unclassified 614
33 Ga0070695_100235433 3300005545 Bacteria 1326
34 Ga0070704_100647550 3300005549 Unclassified 933
35 Ga0070664_100027416 3300005564 Bacteria 4734
36 Ga0070664_100191321 3300005564 Bacteria 1823
37 Ga0068857_100009183 3300005577 Bacteria 8584
38 Ga0068854_100111515 3300005578 Bacteria 2064
39 Ga0068859_100065854 3300005617 Unclassified 3657
40 Ga0068859_100810384 3300005617 Bacteria 1024
41 Ga0068859_101020203 3300005617 Bacteria 909
42 Ga0068861_100172835 3300005719 Unclassified 1792
43 Ga0068861_100231040 3300005719 Bacteria 1569
44 Ga0068870_11341772 3300005840 Unclassified 522
45 Ga0068863_100694189 3300005841 Bacteria 1011
46 Ga0068858_101084490 3300005842 Bacteria 786
47 Ga0068862_100109112 3300005844 Bacteria 2427
48 Ga0068862_100602451 3300005844 Bacteria 1055
49 Ga0068862_101065561 3300005844 Unclassified 802
50 Ga0068862_102264961 3300005844 Unclassified 555
51 Ga0070716_100265275 3300006173 Bacteria 1177
52 Ga0075367_10010080 3300006178 Bacteria 4954
53 Ga0075366_10031860 3300006195 Bacteria 3104
54 Ga0097621_100079371 3300006237 Bacteria 2728
55 Ga0068871_100496903 3300006358 Bacteria 1099
56 Ga0068871_100519413 3300006358 Bacteria 1075
57 Ga0075428_100005034 3300006844 Bacteria 14689
58 Ga0075428_100006404 3300006844 Bacteria 13099
59 Ga0075428_100007531 3300006844 Bacteria 12068
60 Ga0075428_102640985 3300006844 Bacteria 512
61 Ga0075430_100000871 3300006846 Bacteria 23716
62 Ga0075430_100013874 3300006846 Bacteria 6867
63 Ga0075430_100052898 3300006846 Unclassified 3419
64 Ga0075430_100292790 3300006846 Unclassified 1347
65 Ga0075430_101280536 3300006846 Bacteria 603
66 Ga0075430_101674558 3300006846 Unclassified 522
67 Ga0075431_100050480 3300006847 Bacteria 4289
68 Ga0075431_100858109 3300006847 Bacteria 879
69 Ga0075431_101656839 3300006847 Bacteria 597
70 Ga0075431_101908997 3300006847 Unclassified 549
71 Ga0075433_10316256 3300006852 Unclassified 1381
72 Ga0075433_10345965 3300006852 Bacteria 1314
73 Ga0075433_10924107 3300006852 Bacteria 761
74 Ga0075434_100332886 3300006871 Bacteria 1539
75 Ga0075434_100491643 3300006871 Bacteria 1248
76 Ga0075434_100586651 3300006871 Bacteria 1134
77 Ga0075429_100005013 3300006880 Bacteria 11398
78 Ga0075429_100013465 3300006880 Bacteria 7094
79 Ga0075429_101438814 3300006880 Bacteria 600
80 Ga0068865_101268810 3300006881 Unclassified 654
81 Ga0075436_100841511 3300006914 Bacteria 684
82 Ga0097620_100065850 3300006931 Unclassified 3657
83 Ga0097620_100810268 3300006931 Bacteria 1024
84 Ga0097620_101020067 3300006931 Bacteria 909
85 Ga0075435_101791327 3300007076 Unclassified 539
86 Ga0111539_10002455 3300009094 Bacteria 24624
87 Ga0111539_10032946 3300009094 Bacteria 6291
88 Ga0111539_10066178 3300009094 Bacteria 4268
89 Ga0111539_10228512 3300009094 Bacteria 2167
90 Ga0111539_10378114 3300009094 Bacteria 1649
91 Ga0111539_10721215 3300009094 Unclassified 1161
92 Ga0111539_10897784 3300009094 Bacteria 1031
93 Ga0111539_13082674 3300009094 Bacteria 538
94 Ga0114129_10002989 3300009147 Bacteria 23677
95 Ga0114129_10006748 3300009147 Bacteria 16297
96 Ga0114129_10006989 3300009147 Bacteria 16066
97 Ga0114129_10451516 3300009147 Unclassified 1686
98 Ga0114129_11953092 3300009147 Bacteria 710
99 Ga0114129_12073851 3300009147 Unclassified 686
100 Ga0105243_10688089 3300009148 Bacteria 995
101 Ga0105243_12285569 3300009148 Bacteria 578
102 Ga0105248_10056342 3300009177 Bacteria 4410
103 Ga0105248_10167050 3300009177 Bacteria 2480
104 Ga0105249_10063707 3300009553 Bacteria 3387
105 Ga0105249_10318202 3300009553 Bacteria 1567
106 Ga0105249_10322502 3300009553 Bacteria 1556
107 Ga0105249_10722107 3300009553 Unclassified 1057
108 Ga0105249_13037977 3300009553 Bacteria 539
109 Ga0157378_13104743 3300013297 Unclassified 516
110 Ga0163162_10449366 3300013306 Bacteria 1421
111 Ga0157375_13560089 3300013308 Unclassified 518
112 Ga0157380_10067226 3300014326 Bacteria 2885
113 Ga0157380_10718440 3300014326 Bacteria 1006
114 Ga0157380_11279718 3300014326 Unclassified 780
115 Ga0157380_11848565 3300014326 Bacteria 664
116 Ga0157377_10730127 3300014745 Bacteria 722
117 Ga0157379_10367625 3300014968 Unclassified 1319
118 Ga0157376_10684452 3300014969 Bacteria 1029
119 Ga0163161_11015257 3300017792 Unclassified 709
120 Ga0163161_12096832 3300017792 Bacteria 503
121 Ga0207697_10071372 3300025315 Unclassified 1455
122 Ga0207642_10532806 3300025899 Unclassified 723
123 Ga0207642_10788690 3300025899 Unclassified 604
124 Ga0207649_10625163 3300025920 Bacteria 830
125 Ga0207649_11617701 3300025920 Bacteria 513
126 Ga0207646_10165862 3300025922 Bacteria 1994
127 Ga0207681_10229930 3300025923 Bacteria 1439
128 Ga0207681_10432531 3300025923 Bacteria 1068
129 Ga0207681_10822484 3300025923 Unclassified 776
130 Ga0207650_10040307 3300025925 Bacteria 3417
131 Ga0207706_10820071 3300025933 Bacteria 789
132 Ga0207686_11187052 3300025934 Unclassified 624
133 Ga0207709_11729484 3300025935 Bacteria 520
134 Ga0207670_10927145 3300025936 Bacteria 730
135 Ga0207665_10060026 3300025939 Bacteria 2574
136 Ga0207665_10319562 3300025939 Bacteria 1164
137 Ga0207691_10681333 3300025940 Bacteria 867
138 Ga0207711_10045628 3300025941 Bacteria 3745
139 Ga0207711_12041610 3300025941 Unclassified 516
140 Ga0207689_10396003 3300025942 Bacteria 1151
141 Ga0207689_10669530 3300025942 Bacteria 875
142 Ga0207679_10112084 3300025945 Unclassified 2155
143 Ga0207651_10772202 3300025960 Unclassified 850
144 Ga0207651_11065521 3300025960 Bacteria 724
145 Ga0207712_10308789 3300025961 Bacteria 1301
146 Ga0207712_10482666 3300025961 Bacteria 1057
147 Ga0207712_11443430 3300025961 Unclassified 616
148 Ga0207712_11452490 3300025961 Unclassified 614
149 Ga0207668_10045680 3300025972 Bacteria 2989
150 Ga0207668_10458933 3300025972 Bacteria 1089
151 Ga0207640_10204346 3300025981 Bacteria 1499
152 Ga0207640_12107017 3300025981 Bacteria 511
153 Ga0207658_11497451 3300025986 Unclassified 617
154 Ga0207677_10504527 3300026023 Bacteria 1047
155 Ga0207703_10846340 3300026035 Bacteria 875
156 Ga0207648_10575000 3300026089 Bacteria 1037
157 Ga0207648_10991191 3300026089 Unclassified 787
158 Ga0207674_10011900 3300026116 Bacteria 9754
159 Ga0207674_11802590 3300026116 Unclassified 579
160 Ga0207675_100058910 3300026118 Bacteria 3584
161 Ga0207675_100156005 3300026118 Bacteria 2175
162 Ga0207675_100189501 3300026118 Unclassified 1972
163 Ga0207675_100444510 3300026118 Bacteria 1284
164 Ga0207675_101374586 3300026118 Bacteria 727
165 Ga0207683_10779952 3300026121 Bacteria 887
166 Ga0207698_11437902 3300026142 Unclassified 705
167 Ga0209966_1059856 3300027695 Bacteria 822
168 Ga0209998_10071622 3300027717 Unclassified 829
169 Ga0207428_10000385 3300027907 Bacteria 55418
170 Ga0207428_10165104 3300027907 Bacteria 1679
171 Ga0207428_10262616 3300027907 Bacteria 1285
172 Ga0268265_10103233 3300028380 Bacteria 2308
173 Ga0268265_10385405 3300028380 Bacteria 1291
174 Ga0268265_11956167 3300028380 Unclassified 593
175 Ga0268264_10375807 3300028381 Unclassified 1360
176 Ga0307408_100015357 3300031548 Bacteria 5097
177 Ga0307408_100026638 3300031548 Bacteria 3974
178 Ga0307405_10084639 3300031731 Bacteria 2082
179 Ga0307405_10105509 3300031731 Unclassified 1898
180 Ga0307405_10203816 3300031731 Bacteria 1439
181 Ga0307405_10608325 3300031731 Bacteria 893
182 Ga0307405_11515682 3300031731 Bacteria 589
183 Ga0307413_10065016 3300031824 Bacteria 2269
184 Ga0307413_10305702 3300031824 Bacteria 1208
185 Ga0307413_10753615 3300031824 Bacteria 814
186 Ga0307413_11529949 3300031824 Bacteria 591
187 Ga0307410_10213659 3300031852 Bacteria 1479
188 Ga0307410_10444974 3300031852 Bacteria 1056
189 Ga0307410_10488096 3300031852 Bacteria 1012
190 Ga0307410_10916088 3300031852 Unclassified 752
191 Ga0307406_10261177 3300031901 Bacteria 1310
192 Ga0307406_10342917 3300031901 Bacteria 1164
193 Ga0307406_10631963 3300031901 Bacteria 886
194 Ga0307407_10069912 3300031903 Bacteria 2085
195 Ga0307407_10458852 3300031903 Bacteria 926
196 Ga0307412_10007909 3300031911 Bacteria 6057
197 Ga0307412_10044835 3300031911 Bacteria 2887
198 Ga0307412_10133811 3300031911 Unclassified 1805
199 Ga0307412_10192834 3300031911 Bacteria 1542
200 Ga0307412_10797581 3300031911 Bacteria 819
201 Ga0307409_100039761 3300031995 Bacteria 3494
202 Ga0307409_100054195 3300031995 Bacteria 3087
203 Ga0307409_100262387 3300031995 Bacteria 1586
204 Ga0307409_100477694 3300031995 Bacteria 1209
205 Ga0307409_101930274 3300031995 Unclassified 620
206 Ga0307416_100001766 3300032002 Bacteria 11975
207 Ga0307416_100030815 3300032002 Bacteria 4029
208 Ga0307416_100044385 3300032002 Bacteria 3490
209 Ga0307416_100443201 3300032002 Bacteria 1349
210 Ga0307416_100618861 3300032002 Unclassified 1164
211 Ga0307416_100759714 3300032002 Bacteria 1063
212 Ga0307416_100872217 3300032002 Bacteria 999
213 Ga0307416_100915359 3300032002 Unclassified 977
214 Ga0307416_101174553 3300032002 Bacteria 873
215 Ga0307416_101886309 3300032002 Bacteria 701
216 Ga0307416_103481757 3300032002 Bacteria 527
217 Ga0307414_10241721 3300032004 Unclassified 1495
218 Ga0307414_10260384 3300032004 Bacteria 1447
219 Ga0307414_11188053 3300032004 Bacteria 706
220 Ga0307411_10160896 3300032005 Bacteria 1681
221 Ga0307411_10263425 3300032005 Bacteria 1362
222 Ga0307411_10383639 3300032005 Bacteria 1156
223 Ga0307411_10389851 3300032005 Bacteria 1148
224 Ga0307411_10421548 3300032005 Bacteria 1109
225 Ga0307411_10465514 3300032005 Bacteria 1061
226 Ga0307411_11060439 3300032005 Bacteria 728
227 Ga0307415_100064351 3300032126 Bacteria 2551
228 Ga0307415_100266749 3300032126 Bacteria 1400
229 Ga0373934_0044499 3300035086 Bacteria 1755
230 Ga0373954_0074551 3300035118 Bacteria 1615
231 Ga0373957_0009503 3300035120 Unclassified 3185
232 Ga0373955_0001674 3300035172 Bacteria 9472
233 Ga0373955_0738026 3300035172 Bacteria 605
234 Ga0373933_0054119 3300035724 Bacteria 2404
235 Ga0373937_0003352 3300036401 Bacteria 13445
236 Ga0395905_0259983 3300037471 Bacteria 1621
237 Ga0439461_0021784 3300041410 Unclassified 1279
238 Ga0451845_0264731 3300041501 Bacteria 596
239 Ga0451853_1295451 3300041512 Bacteria 749
240 Ga0439437_003334 3300042000 Bacteria 1732
241 Ga0439441_017727 3300042001 Bacteria 1282
242 Ga0439441_044838 3300042001 Bacteria 896
243 Ga0439450_015897 3300042008 Bacteria 1548
244 Ga0439450_136325 3300042008 Unclassified 639
245 Ga0450919_013400 3300042121 Bacteria 927
246 Ga0450921_004322 3300042123 Bacteria 1032
247 Ga0450923_030272 3300042125 Bacteria 1100
248 Ga0450923_164118 3300042125 Bacteria 542
249 Ga0450894_050670 3300042131 Bacteria 611
250 Ga0439446_0104810 3300042156 Unclassified 897
251 Ga0439434_0077599 3300042435 Bacteria 1051
252 Ga0439435_0002547 3300042436 Bacteria 3646
253 Ga0439444_0134339 3300042437 Bacteria 587
254 Ga0439464_0001505 3300042439 Bacteria 5512
255 Ga0439464_0266343 3300042439 Unclassified 556
256 Ga0439460_0315123 3300042461 Unclassified 548
257 Ga0450918_015500 3300042531 Bacteria 1325
258 Ga0450893_0116291 3300042532 Unclassified 555
259 Ga0439440_0265399 3300042993 Bacteria 526
260 Ga0451576_0280843 3300045051 Bacteria 1741
261 Ga0451576_0763118 3300045051 Bacteria 1016
262 Ga0466958_0927331 3300045836 Bacteria 568
263 Ga0466967_0170415 3300045976 Bacteria 2048
264 Ga0466967_1294135 3300045976 Bacteria 726
265 Ga0495592_0039536 3300046454 Bacteria 3543
266 Ga0495651_0155161 3300046462 Bacteria 1646
267 Ga0495651_0376038 3300046462 Archaea 933
268 Ga0495653_0604371 3300046463 Archaea 674
269 Ga0495628_0155017 3300046516 Bacteria 1743
270 Ga0495599_0082966 3300046678 Bacteria 2002
271 Ga0496112_0084071 3300048915 Bacteria 3148
272 Ga0501031_0014907 3300049568 Bacteria 5051
273 Ga0501031_0163405 3300049568 Bacteria 1455
274 Ga0501032_0079541 3300049569 Bacteria 2182
275 Ga0501032_0767655 3300049569 Unclassified 609
276 Ga0501033_0004898 3300049570 Bacteria 10654
277 Ga0501033_0011280 3300049570 Bacteria 6842
278 Ga0501034_0036930 3300049571 Bacteria 4946
279 Ga0501034_0344554 3300049571 Bacteria 1419
280 Ga0501036_0002809 3300049572 Bacteria 13795
281 Ga0501036_0145572 3300049572 Bacteria 1998
282 Ga0501037_0006154 3300049573 Bacteria 8766
283 Ga0501037_0322412 3300049573 Bacteria 1069
284 Ga0501038_0014652 3300049574 Bacteria 7145
285 Ga0501038_0028629 3300049574 Bacteria 4949
286 Ga0501038_0965163 3300049574 Bacteria 627
287 Ga0501038_1136212 3300049574 Bacteria 569
288 Ga0501039_0040078 3300049575 Bacteria 3616
289 Ga0501039_0561877 3300049575 Bacteria 895
290 Ga0501039_0695286 3300049575 Bacteria 795
291 Ga0501040_0660805 3300049576 Bacteria 755
292 Ga0501040_1010647 3300049576 Bacteria 603
293 Ga0501041_0235546 3300049577 Unclassified 1150
294 Ga0501041_0998061 3300049577 Unclassified 539
295 Ga0501042_0003260 3300049578 Bacteria 10150
296 Ga0501042_0169835 3300049578 Bacteria 1574
297 Ga0501042_1028382 3300049578 Bacteria 600
298 Ga0501043_0021356 3300049579 Bacteria 5074
299 Ga0501043_0033291 3300049579 Bacteria 4054
300 Ga0501046_0003141 3300049580 Bacteria 15253
301 Ga0501046_0040492 3300049580 Bacteria 3722
302 Ga0501047_0021257 3300049581 Bacteria 6229
303 Ga0501047_0048321 3300049581 Bacteria 4108
304 Ga0501047_0360216 3300049581 Bacteria 1290
305 Ga0501048_0249617 3300049582 Bacteria 1259
306 Ga0501048_1124438 3300049582 Bacteria 565
307 Ga0501067_0019516 3300049583 Bacteria 3754
308 Ga0501067_0066283 3300049583 Bacteria 1998
309 Ga0501068_0003546 3300049584 Bacteria 8428
310 Ga0501068_0160170 3300049584 Bacteria 1418
311 Ga0501069_0003601 3300049585 Bacteria 7980
312 Ga0501069_0043605 3300049585 Bacteria 2483
313 Ga0501070_0033767 3300049586 Bacteria 4281
314 Ga0501070_0103182 3300049586 Bacteria 2358
315 Ga0501071_0000412 3300049587 Bacteria 21243
316 Ga0501071_0126751 3300049587 Bacteria 1895
317 Ga0501071_1122461 3300049587 Unclassified 607
318 Ga0501072_0301729 3300049588 Bacteria 1273
319 Ga0501072_0640794 3300049588 Bacteria 837
320 Ga0501072_0744423 3300049588 Unclassified 769
321 Ga0501072_0953835 3300049588 Unclassified 669
322 Ga0501073_0121931 3300049589 Bacteria 1806
323 Ga0501074_0001966 3300049590 Bacteria 14128
324 Ga0501074_0002359 3300049590 Bacteria 13144
325 Ga0501075_0183380 3300049591 Bacteria 1597
326 Ga0501075_0569926 3300049591 Unclassified 864
327 Ga0501075_0799433 3300049591 Bacteria 718
328 Ga0501075_0843368 3300049591 Bacteria 697
329 Ga0501076_0049705 3300049592 Bacteria 3317
330 Ga0501076_0058547 3300049592 Bacteria 3063
331 Ga0501076_0428893 3300049592 Bacteria 1088
332 Ga0501076_1088833 3300049592 Bacteria 658
333 Ga0501077_0734608 3300049593 Bacteria 634
334 Ga0501217_059651 3300049661 Bacteria 1016
335 Ga0501251_034007 3300049681 Unclassified 741
336 Ga0501255_066220 3300049684 Unclassified 583
337 Ga0501261_056791 3300049690 Bacteria 655
338 Ga0501079_0004976 3300049741 Bacteria 9851
339 Ga0501079_0294837 3300049741 Bacteria 1268
340 Ga0501079_1235961 3300049741 Bacteria 588
341 Ga0501080_0043857 3300049742 Bacteria 4164
342 Ga0501080_0063483 3300049742 Bacteria 3437
343 Ga0501080_0247642 3300049742 Bacteria 1625
344 Ga0501081_0014692 3300049743 Bacteria 5165
345 Ga0501081_0239484 3300049743 Bacteria 1323
346 Ga0501081_0341504 3300049743 Bacteria 1103
347 Ga0501083_0015567 3300049744 Bacteria 5324
348 Ga0501275_084756 3300049772 Unclassified 519
349 Ga0501035_0011575 3300049822 Bacteria 8178
350 Ga0501035_0069865 3300049822 Bacteria 3111
351 Ga0501035_1383013 3300049822 Unclassified 540
352 Ga0501044_0004807 3300049823 Bacteria 15102
353 Ga0501044_0022948 3300049823 Bacteria 6642
354 Ga0501045_0016887 3300049824 Bacteria 5183
355 Ga0501045_0386233 3300049824 Bacteria 1042
356 Ga0501045_0520873 3300049824 Bacteria 883
357 nmdc:mga0k408_26828_c1 3300050493 Bacteria 3267
358 nmdc:mga06z11_880545_c1 3300050494 Unclassified 546
359 nmdc:mga07m45_242524_c1 3300050496 Bacteria 1048
360 nmdc:mga05p37_10708_c1 3300050507 Bacteria 10885
361 nmdc:mga05p37_120743_c1 3300050507 Bacteria 3219
362 nmdc:mga05p37_152689_c1 3300050507 Bacteria 2823
363 nmdc:mga05p37_1773708_c1 3300050507 Bacteria 597
364 nmdc:mga05p37_3194_c1 3300050507 Bacteria 19066
365 nmdc:mga05p37_71048_c1 3300050507 Bacteria 4282
366 nmdc:mga09592_19848_c1 3300050508 Bacteria 5522
367 nmdc:mga09592_385216_c1 3300050508 Bacteria 1212
368 nmdc:mga09592_4490_c1 3300050508 Bacteria 11287
369 nmdc:mga0qj67_11747_c1 3300050509 Bacteria 6573
370 nmdc:mga0qj67_137471_c1 3300050509 Bacteria 1980
371 nmdc:mga0qj67_1428358_c1 3300050509 Bacteria 533
372 nmdc:mga0qj67_451238_c1 3300050509 Bacteria 1036
373 nmdc:mga0qj67_4652_c1 3300050509 Bacteria 9957
374 nmdc:mga06r32_131556_c1 3300050510 Bacteria 2474
375 nmdc:mga06r32_157239_c1 3300050510 Bacteria 2255
376 nmdc:mga06r32_1906598_c1 3300050510 Unclassified 529
377 nmdc:mga06r32_694917_c1 3300050510 Bacteria 983
378 nmdc:mga06r32_75259_c1 3300050510 Bacteria 3276
379 nmdc:mga08y16_289547_c1 3300050511 Bacteria 1689
380 nmdc:mga08y16_401515_c1 3300050511 Bacteria 1403
381 nmdc:mga08y16_44038_c1 3300050511 Bacteria 4676
382 nmdc:mga08y16_680_c1 3300050511 Bacteria 32152
383 nmdc:mga0n895_467088_c1 3300050512 Bacteria 1273
384 nmdc:mga0n895_575214_c1 3300050512 Unclassified 1131
385 nmdc:mga0rr50_110080_c1 3300050513 Bacteria 2178
386 nmdc:mga08x19_11440_c1 3300050514 Bacteria 5340
387 nmdc:mga08x19_13805_c1 3300050514 Bacteria 4893
388 nmdc:mga0a205_1250289_c1 3300050515 Bacteria 590
389 nmdc:mga0a205_270202_c1 3300050515 Bacteria 1577
390 Ga0501084_0106422 3300054114 Bacteria 2356
391 Ga0501084_0432642 3300054114 Bacteria 1112
392 Ga0501084_1064307 3300054114 Bacteria 679
393 Ga0501082_0034633 3300060353 Bacteria 4352
394 Ga0501082_0075326 3300060353 Bacteria 2908
395 Ga0501082_0384053 3300060353 Bacteria 1225
396 Ga0530510_0500748 3300061734 Bacteria 921
397 Ga0307412_11035804
398 JGI24751J29686_10086256
399 Ga0065707_10001463
400 Ga0070690_100206035
401 Ga0068869_101191134
402 Ga0068869_101324919
403 Ga0068868_100478308
404 Ga0068868_102167876
405 Ga0070689_100316584
406 Ga0070689_101587644
407 Ga0070687_100360404
408 Ga0070661_100605627
409 Ga0070661_100831329
410 Ga0070692_10324745
411 Ga0070668_102279344
412 Ga0070669_100080984
413 Ga0070669_100120522
414 Ga0070669_100892410
415 Ga0070675_100386574
416 Ga0070673_100015038
417 Ga0070688_100674472
418 Ga0070688_101540455
419 Ga0070667_101819540
420 Ga0070701_11110950
421 Ga0070662_100326190
422 Ga0068867_100432619
423 Ga0070707_100302173
424 Ga0070698_100245422
425 Ga0070699_100343235
426 Ga0070699_101991232
427 Ga0070697_101092525
428 Ga0070672_101452685
429 Ga0070695_100235433
430 Ga0070704_100647550
431 Ga0070664_100027416
432 Ga0070664_100191321
433 Ga0068857_100009183
434 Ga0068854_100111515
435 Ga0068859_100065854
436 Ga0068859_100810384
437 Ga0068859_101020203
438 Ga0068861_100172835
439 Ga0068861_100231040
440 Ga0068870_11341772
441 Ga0068863_100694189
442 Ga0068858_101084490
443 Ga0068862_100109112
444 Ga0068862_100602451
445 Ga0068862_101065561
446 Ga0068862_102264961
447 Ga0070716_100265275
448 Ga0075367_10010080
449 Ga0075366_10031860
450 Ga0097621_100079371
451 Ga0068871_100496903
452 Ga0068871_100519413
453 Ga0075428_100005034
454 Ga0075428_100006404
455 Ga0075428_100007531
456 Ga0075428_102640985
457 Ga0075430_100000871
458 Ga0075430_100013874
459 Ga0075430_100052898
460 Ga0075430_100292790
461 Ga0075430_101280536
462 Ga0075430_101674558
463 Ga0075431_100050480
464 Ga0075431_100858109
465 Ga0075431_101656839
466 Ga0075431_101908997
467 Ga0075433_10316256
468 Ga0075433_10345965
469 Ga0075433_10924107
470 Ga0075434_100332886
471 Ga0075434_100491643
472 Ga0075434_100586651
473 Ga0075429_100005013
474 Ga0075429_100013465
475 Ga0075429_101438814
476 Ga0068865_101268810
477 Ga0075436_100841511
478 Ga0097620_100065850
479 Ga0097620_100810268
480 Ga0097620_101020067
481 Ga0075435_101791327
482 Ga0111539_10002455
483 Ga0111539_10032946
484 Ga0111539_10066178
485 Ga0111539_10228512
486 Ga0111539_10378114
487 Ga0111539_10721215
488 Ga0111539_10897784
489 Ga0111539_13082674
490 Ga0114129_10002989
491 Ga0114129_10006748
492 Ga0114129_10006989
493 Ga0114129_10451516
494 Ga0114129_11953092
495 Ga0114129_12073851
496 Ga0105243_10688089
497 Ga0105243_12285569
498 Ga0105248_10056342
499 Ga0105248_10167050
500 Ga0105249_10063707
501 Ga0105249_10318202
502 Ga0105249_10322502
503 Ga0105249_10722107
504 Ga0105249_13037977
505 Ga0157378_13104743
506 Ga0163162_10449366
507 Ga0157375_13560089
508 Ga0157380_10067226
509 Ga0157380_10718440
510 Ga0157380_11279718
511 Ga0157380_11848565
512 Ga0157377_10730127
513 Ga0157379_10367625
514 Ga0157376_10684452
515 Ga0163161_11015257
516 Ga0163161_12096832
517 Ga0207697_10071372
518 Ga0207642_10532806
519 Ga0207642_10788690
520 Ga0207649_10625163
521 Ga0207649_11617701
522 Ga0207646_10165862
523 Ga0207681_10229930
524 Ga0207681_10432531
525 Ga0207681_10822484
526 Ga0207650_10040307
527 Ga0207706_10820071
528 Ga0207686_11187052
529 Ga0207709_11729484
530 Ga0207670_10927145
531 Ga0207665_10060026
532 Ga0207665_10319562
533 Ga0207691_10681333
534 Ga0207711_10045628
535 Ga0207711_12041610
536 Ga0207689_10396003
537 Ga0207689_10669530
538 Ga0207679_10112084
539 Ga0207651_10772202
540 Ga0207651_11065521
541 Ga0207712_10308789
542 Ga0207712_10482666
543 Ga0207712_11443430
544 Ga0207712_11452490
545 Ga0207668_10045680
546 Ga0207668_10458933
547 Ga0207640_10204346
548 Ga0207640_12107017
549 Ga0207658_11497451
550 Ga0207677_10504527
551 Ga0207703_10846340
552 Ga0207648_10575000
553 Ga0207648_10991191
554 Ga0207674_10011900
555 Ga0207674_11802590
556 Ga0207675_100058910
557 Ga0207675_100156005
558 Ga0207675_100189501
559 Ga0207675_100444510
560 Ga0207675_101374586
561 Ga0207683_10779952
562 Ga0207698_11437902
563 Ga0209966_1059856
564 Ga0209998_10071622
565 Ga0207428_10000385
566 Ga0207428_10165104
567 Ga0207428_10262616
568 Ga0268265_10103233
569 Ga0268265_10385405
570 Ga0268265_11956167
571 Ga0268264_10375807
572 Ga0307408_100015357
573 Ga0307408_100026638
574 Ga0307405_10084639
575 Ga0307405_10105509
576 Ga0307405_10203816
577 Ga0307405_10608325
578 Ga0307405_11515682
579 Ga0307413_10065016
580 Ga0307413_10305702
581 Ga0307413_10753615
582 Ga0307413_11529949
583 Ga0307410_10213659
584 Ga0307410_10444974
585 Ga0307410_10488096
586 Ga0307410_10916088
587 Ga0307406_10261177
588 Ga0307406_10342917
589 Ga0307406_10631963
590 Ga0307407_10069912
591 Ga0307407_10458852
592 Ga0307412_10007909
593 Ga0307412_10044835
594 Ga0307412_10133811
595 Ga0307412_10192834
596 Ga0307412_10797581
597 Ga0307409_100039761
598 Ga0307409_100054195
599 Ga0307409_100262387
600 Ga0307409_100477694
601 Ga0307409_101930274
602 Ga0307416_100001766
603 Ga0307416_100030815
604 Ga0307416_100044385
605 Ga0307416_100443201
606 Ga0307416_100618861
607 Ga0307416_100759714
608 Ga0307416_100872217
609 Ga0307416_100915359
610 Ga0307416_101174553
611 Ga0307416_101886309
612 Ga0307416_103481757
613 Ga0307414_10241721
614 Ga0307414_10260384
615 Ga0307414_11188053
616 Ga0307411_10160896
617 Ga0307411_10263425
618 Ga0307411_10383639
619 Ga0307411_10389851
620 Ga0307411_10421548
621 Ga0307411_10465514
622 Ga0307411_11060439
623 Ga0307415_100064351
624 Ga0307415_100266749
625 Ga0373934_0044499
626 Ga0373954_0074551
627 Ga0373957_0009503
628 Ga0373955_0001674
629 Ga0373955_0738026
630 Ga0373933_0054119
631 Ga0373937_0003352
632 Ga0395905_0259983
633 Ga0439461_0021784
634 Ga0451845_0264731
635 Ga0451853_1295451
636 Ga0439437_003334
637 Ga0439441_017727
638 Ga0439441_044838
639 Ga0439450_015897
640 Ga0439450_136325
641 Ga0450919_013400
642 Ga0450921_004322
643 Ga0450923_030272
644 Ga0450923_164118
645 Ga0450894_050670
646 Ga0439446_0104810
647 Ga0439434_0077599
648 Ga0439435_0002547
649 Ga0439444_0134339
650 Ga0439464_0001505
651 Ga0439464_0266343
652 Ga0439460_0315123
653 Ga0450918_015500
654 Ga0450893_0116291
655 Ga0439440_0265399
656 Ga0451576_0280843
657 Ga0451576_0763118
658 Ga0466958_0927331
659 Ga0466967_0170415
660 Ga0466967_1294135
661 Ga0495592_0039536
662 Ga0495651_0155161
663 Ga0495651_0376038
664 Ga0495653_0604371
665 Ga0495628_0155017
666 Ga0495599_0082966
667 Ga0496112_0084071
668 Ga0501031_0014907
669 Ga0501031_0163405
670 Ga0501032_0079541
671 Ga0501032_0767655
672 Ga0501033_0004898
673 Ga0501033_0011280
674 Ga0501034_0036930
675 Ga0501034_0344554
676 Ga0501036_0002809
677 Ga0501036_0145572
678 Ga0501037_0006154
679 Ga0501037_0322412
680 Ga0501038_0014652
681 Ga0501038_0028629
682 Ga0501038_0965163
683 Ga0501038_1136212
684 Ga0501039_0040078
685 Ga0501039_0561877
686 Ga0501039_0695286
687 Ga0501040_0660805
688 Ga0501040_1010647
689 Ga0501041_0235546
690 Ga0501041_0998061
691 Ga0501042_0003260
692 Ga0501042_0169835
693 Ga0501042_1028382
694 Ga0501043_0021356
695 Ga0501043_0033291
696 Ga0501046_0003141
697 Ga0501046_0040492
698 Ga0501047_0021257
699 Ga0501047_0048321
700 Ga0501047_0360216
701 Ga0501048_0249617
702 Ga0501048_1124438
703 Ga0501067_0019516
704 Ga0501067_0066283
705 Ga0501068_0003546
706 Ga0501068_0160170
707 Ga0501069_0003601
708 Ga0501069_0043605
709 Ga0501070_0033767
710 Ga0501070_0103182
711 Ga0501071_0000412
712 Ga0501071_0126751
713 Ga0501071_1122461
714 Ga0501072_0301729
715 Ga0501072_0640794
716 Ga0501072_0744423
717 Ga0501072_0953835
718 Ga0501073_0121931
719 Ga0501074_0001966
720 Ga0501074_0002359
721 Ga0501075_0183380
722 Ga0501075_0569926
723 Ga0501075_0799433
724 Ga0501075_0843368
725 Ga0501076_0049705
726 Ga0501076_0058547
727 Ga0501076_0428893
728 Ga0501076_1088833
729 Ga0501077_0734608
730 Ga0501217_059651
731 Ga0501251_034007
732 Ga0501255_066220
733 Ga0501261_056791
734 Ga0501079_0004976
735 Ga0501079_0294837
736 Ga0501079_1235961
737 Ga0501080_0043857
738 Ga0501080_0063483
739 Ga0501080_0247642
740 Ga0501081_0014692
741 Ga0501081_0239484
742 Ga0501081_0341504
743 Ga0501083_0015567
744 Ga0501275_084756
745 Ga0501035_0011575
746 Ga0501035_0069865
747 Ga0501035_1383013
748 Ga0501044_0004807
749 Ga0501044_0022948
750 Ga0501045_0016887
751 Ga0501045_0386233
752 Ga0501045_0520873
753 nmdc:mga0k408_26828_c1
754 nmdc:mga06z11_880545_c1
755 nmdc:mga07m45_242524_c1
756 nmdc:mga05p37_10708_c1
757 nmdc:mga05p37_120743_c1
758 nmdc:mga05p37_152689_c1
759 nmdc:mga05p37_1773708_c1
760 nmdc:mga05p37_3194_c1
761 nmdc:mga05p37_71048_c1
762 nmdc:mga09592_19848_c1
763 nmdc:mga09592_385216_c1
764 nmdc:mga09592_4490_c1
765 nmdc:mga0qj67_11747_c1
766 nmdc:mga0qj67_137471_c1
767 nmdc:mga0qj67_1428358_c1
768 nmdc:mga0qj67_451238_c1
769 nmdc:mga0qj67_4652_c1
770 nmdc:mga06r32_131556_c1
771 nmdc:mga06r32_157239_c1
772 nmdc:mga06r32_1906598_c1
773 nmdc:mga06r32_694917_c1
774 nmdc:mga06r32_75259_c1
775 nmdc:mga08y16_289547_c1
776 nmdc:mga08y16_401515_c1
777 nmdc:mga08y16_44038_c1
778 nmdc:mga08y16_680_c1
779 nmdc:mga0n895_467088_c1
780 nmdc:mga0n895_575214_c1
781 nmdc:mga0rr50_110080_c1
782 nmdc:mga08x19_11440_c1
783 nmdc:mga08x19_13805_c1
784 nmdc:mga0a205_1250289_c1
785 nmdc:mga0a205_270202_c1
786 Ga0501084_0106422
787 Ga0501084_0432642
788 Ga0501084_1064307
789 Ga0501082_0034633
790 Ga0501082_0075326
791 Ga0501082_0384053
792 Ga0530510_0500748

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03319

EutN_CcmL

Ethanolamine utilisation protein EutN/carboxysome

20

102

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hd3-assembly2.cif.gz_J crystal structure of the ethanolamine utilization protein eutn from escherichia coli, nesg target er316 0.9121 1 88
4i7a-assembly1.cif.gz_A grpn pentameric microcompartment shell protein from rhodospirillum rubrum 0.9108 1 88
4i7a-assembly1.cif.gz_B grpn pentameric microcompartment shell protein from rhodospirillum rubrum 0.9066 1 87
4i7a-assembly1.cif.gz_A grpn pentameric microcompartment shell protein from rhodospirillum rubrum 0.9008 1 88
4i7a-assembly1.cif.gz_B grpn pentameric microcompartment shell protein from rhodospirillum rubrum 0.8964 1 87
ID Description Score Start End Superfamily
4i7aB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.9066 1 87 2.40.50.220
4i7aB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.8964 1 87 2.40.50.220
2z9hB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.882 1 88 2.40.50.220
2z9hB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.873 1 88 2.40.50.220
4n8x100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);EutN/Ccml 0.8567 1 87 2.40.50.220
ID Description Score Start End GO Terms
AF-A0A523NDQ4-F1-model_v4 Ethanolamine utilization protein EutN 0.988 1 60 GO:0031469
AF-A0A3N5X188-F1-model_v4 Ethanolamine utilization protein EutN 0.9839 2 55 GO:0031469
AF-A0A534P787-F1-model_v4 Ethanolamine utilization protein EutN 0.9799 1 49 GO:0031469
AF-A0A523N5H6-F1-model_v4 Ethanolamine utilization protein EutN 0.9797 1 48 GO:0031469
AF-X1HQN0-F1-model_v4 Ethanolamine utilization protein EutN 0.9747 1 60 GO:0031469

Map