F433505

General Info

Members Datasets Scaffolds Average Seq Length
396 194 396 405

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10000044|Ga0105249_1000004437
Length 455
Sequence MNERRPLDARLRADPANLSMSETDTDAGDEFERVTPREQNHGTVGLWRRYRRLPRNVFAISLVSLLNDVSSEIIYPLLPLFLSLTLGASPAIVGLIEGAAESLASLLKLFSGYFSDRRGKRKVFVVIGYALANLARPLLAFANSWHQVLAIRLTDRVGKGIRSAPRDAMIADTVSVQERGLAFGFHRAMDHTGAVIGPLVCYLLVMLLASDRNSLTSWDFTKIFLLASIPALAAVIVVSFFVRETPRQIASLRPDESAKDQLPQLSFRGFDGNFKRFLGVLALFTLSNSSDAFLLLRARDAGVSVASLPLLWAALHASKVLSSIFGGDLSDRLGRRRLIVSGWILYAAVYAGFAFVTSNVSVWILFLIYGIYFGLAEGAEKALVADLVRPEQRGTAFGLYNLAFGITVLPASLLMGAIWYWRGPATAFLVSAALGSTAAVLLLSLVKQRKPGTQG

Samples

Sample ID Description Type Environment
1 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
178 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
183 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
184 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
185 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
186 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.77
Rhizosphere 96.97
Stem 0
Stem Tuber 0
Unclassified 1.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1000089 3300000532 Bacteria 7086
2 JGI24751J29686_10000013 3300002459 Bacteria 113565
3 JGI25406J46586_10002162 3300003203 Bacteria 9293
4 Ga0065714_10002186 3300005288 Bacteria 191932
5 Ga0065704_10003229 3300005289 Bacteria 6476
6 Ga0065712_10000113 3300005290 Bacteria 191931
7 Ga0065712_10002668 3300005290 Bacteria 6597
8 Ga0065712_10089566 3300005290 Bacteria 2464
9 Ga0065715_10005754 3300005293 Bacteria 4856
10 Ga0065715_10090024 3300005293 Bacteria 7832
11 Ga0065715_10091511 3300005293 Bacteria 5732
12 Ga0065707_10001531 3300005295 Bacteria 6255
13 Ga0065707_10010867 3300005295 Bacteria 2539
14 Ga0065707_10093298 3300005295 Bacteria 3647
15 Ga0070658_10002765 3300005327 Bacteria 14589
16 Ga0070683_100000440 3300005329 Bacteria 28884
17 Ga0070683_100036707 3300005329 Unclassified 4485
18 Ga0070690_100006228 3300005330 Bacteria 6770
19 Ga0070690_100041233 3300005330 Unclassified 2922
20 Ga0070690_100071274 3300005330 Bacteria 2258
21 Ga0070690_100113711 3300005330 Unclassified 1809
22 Ga0070690_100138968 3300005330 Unclassified 1647
23 Ga0070670_100000129 3300005331 Bacteria 71325
24 Ga0070670_100103180 3300005331 Bacteria 2456
25 Ga0070670_100116626 3300005331 Unclassified 2302
26 Ga0070670_100155392 3300005331 Unclassified 1981
27 Ga0068869_100051146 3300005334 Bacteria 2997
28 Ga0068869_100094662 3300005334 Unclassified 2252
29 Ga0068869_100260398 3300005334 Unclassified 1388
30 Ga0070666_10060634 3300005335 Unclassified 2561
31 Ga0070680_100018902 3300005336 Bacteria 5451
32 Ga0070680_100023160 3300005336 Bacteria 4951
33 Ga0070682_100002914 3300005337 Bacteria 9492
34 Ga0070682_100025154 3300005337 Bacteria 3551
35 Ga0070682_100028715 3300005337 Bacteria 3346
36 Ga0070682_100029171 3300005337 Bacteria 3321
37 Ga0068868_100058990 3300005338 Bacteria 3034
38 Ga0070689_100064266 3300005340 Bacteria 2856
39 Ga0070661_100039573 3300005344 Bacteria 3436
40 Ga0070692_10008899 3300005345 Bacteria 4500
41 Ga0070692_10013410 3300005345 Bacteria 3820
42 Ga0070692_10036037 3300005345 Bacteria 2509
43 Ga0070692_10066973 3300005345 Bacteria 1905
44 Ga0070669_100038209 3300005353 Unclassified 3485
45 Ga0070669_100061200 3300005353 Bacteria 2766
46 Ga0070669_100096528 3300005353 Bacteria 2224
47 Ga0070669_100206713 3300005353 Bacteria 1547
48 Ga0070675_100011568 3300005354 Bacteria 6911
49 Ga0070675_100236237 3300005354 Bacteria 1596
50 Ga0070671_100185672 3300005355 Unclassified 1761
51 Ga0070671_100201943 3300005355 Unclassified 1686
52 Ga0070673_100038785 3300005364 Unclassified 3640
53 Ga0070673_100043690 3300005364 Bacteria 3464
54 Ga0070673_100185804 3300005364 Bacteria 1782
55 Ga0070688_100002224 3300005365 Bacteria 9791
56 Ga0070688_100018977 3300005365 Bacteria 3978
57 Ga0070688_100030479 3300005365 Bacteria 3238
58 Ga0070659_100093853 3300005366 Bacteria 2409
59 Ga0070659_100118247 3300005366 Bacteria 2144
60 Ga0070667_100081417 3300005367 Bacteria 2771
61 Ga0070667_100112313 3300005367 Bacteria 2364
62 Ga0070703_10004680 3300005406 Bacteria 3826
63 Ga0070709_10023156 3300005434 Bacteria 3643
64 Ga0070701_10081116 3300005438 Unclassified 1756
65 Ga0070701_10086779 3300005438 Unclassified 1706
66 Ga0070700_100026221 3300005441 Bacteria 3439
67 Ga0070694_100004857 3300005444 Bacteria 8093
68 Ga0070694_100018467 3300005444 Bacteria 4425
69 Ga0070694_100033237 3300005444 Bacteria 3393
70 Ga0070708_100000180 3300005445 Bacteria 45454
71 Ga0070708_100000587 3300005445 Bacteria 27275
72 Ga0070708_100005408 3300005445 Bacteria 10129
73 Ga0070708_100046690 3300005445 Bacteria 3822
74 Ga0070708_100119074 3300005445 Bacteria 2433
75 Ga0070708_100149997 3300005445 Bacteria 2168
76 Ga0070678_100013367 3300005456 Bacteria 5144
77 Ga0070678_100098522 3300005456 Unclassified 2260
78 Ga0070681_10005204 3300005458 Bacteria 12560
79 Ga0070681_10012844 3300005458 Bacteria 8315
80 Ga0070681_10156665 3300005458 Bacteria 2202
81 Ga0068867_100102132 3300005459 Unclassified 2191
82 Ga0068867_100168471 3300005459 Bacteria 1733
83 Ga0070706_100000019 3300005467 Bacteria 166483
84 Ga0070706_100023990 3300005467 Bacteria 5616
85 Ga0070706_100058599 3300005467 Bacteria 3554
86 Ga0070706_100271169 3300005467 Unclassified 1584
87 Ga0070707_100003360 3300005468 Bacteria 15109
88 Ga0070707_100292738 3300005468 Bacteria 1582
89 Ga0070698_100029396 3300005471 Bacteria 5705
90 Ga0070698_100031011 3300005471 Bacteria 5543
91 Ga0070699_100007133 3300005518 Bacteria 9711
92 Ga0070699_100013495 3300005518 Bacteria 7037
93 Ga0070699_100037212 3300005518 Unclassified 4210
94 Ga0070699_100039063 3300005518 Bacteria 4110
95 Ga0070679_100010998 3300005530 Bacteria 8602
96 Ga0070679_100018357 3300005530 Bacteria 6787
97 Ga0070679_100202010 3300005530 Bacteria 1953
98 Ga0070679_100226433 3300005530 Bacteria 1830
99 Ga0070684_100000920 3300005535 Bacteria 20890
100 Ga0070684_100003911 3300005535 Bacteria 11285
101 Ga0070684_100078813 3300005535 Bacteria 2911
102 Ga0070697_100000042 3300005536 Bacteria 94533
103 Ga0070697_100002759 3300005536 Bacteria 13522
104 Ga0070697_100024221 3300005536 Bacteria 4832
105 Ga0070697_100047479 3300005536 Bacteria 3481
106 Ga0070697_100080742 3300005536 Bacteria 2679
107 Ga0070697_100192626 3300005536 Bacteria 1731
108 Ga0068853_100068112 3300005539 Bacteria 3093
109 Ga0070672_100016306 3300005543 Bacteria 5317
110 Ga0070672_100024305 3300005543 Bacteria 4475
111 Ga0070672_100046398 3300005543 Bacteria 3366
112 Ga0070672_100130953 3300005543 Unclassified 2061
113 Ga0070686_100007940 3300005544 Bacteria 5934
114 Ga0070695_100007469 3300005545 Bacteria 6473
115 Ga0070695_100017748 3300005545 Bacteria 4318
116 Ga0070695_100020482 3300005545 Bacteria 4040
117 Ga0070695_100054421 3300005545 Bacteria 2575
118 Ga0070696_100006190 3300005546 Bacteria 8001
119 Ga0070696_100022034 3300005546 Bacteria 4325
120 Ga0070693_100002560 3300005547 Bacteria 8383
121 Ga0070693_100006607 3300005547 Bacteria 5629
122 Ga0070693_100045214 3300005547 Unclassified 2495
123 Ga0070704_100018694 3300005549 Bacteria 4438
124 Ga0070704_100020683 3300005549 Bacteria 4249
125 Ga0070704_100021850 3300005549 Bacteria 4155
126 Ga0068855_100004796 3300005563 Bacteria 16509
127 Ga0070664_100001870 3300005564 Bacteria 16892
128 Ga0070664_100027689 3300005564 Bacteria 4711
129 Ga0070664_100034607 3300005564 Bacteria 4237
130 Ga0068857_100011003 3300005577 Bacteria 7878
131 Ga0068857_100011523 3300005577 Bacteria 7692
132 Ga0068857_100030528 3300005577 Bacteria 4759
133 Ga0068857_100199999 3300005577 Unclassified 1821
134 Ga0068854_100036580 3300005578 Bacteria 3443
135 Ga0068854_100113742 3300005578 Unclassified 2045
136 Ga0068854_100142154 3300005578 Bacteria 1843
137 Ga0068856_100109839 3300005614 Bacteria 2754
138 Ga0070702_100026096 3300005615 Bacteria 3136
139 Ga0070702_100054109 3300005615 Unclassified 2308
140 Ga0068859_100026913 3300005617 Bacteria 5768
141 Ga0068859_100027753 3300005617 Bacteria 5678
142 Ga0068859_100047313 3300005617 Bacteria 4321
143 Ga0068859_100077205 3300005617 Bacteria 3372
144 Ga0068859_100123703 3300005617 Unclassified 2654
145 Ga0068859_100248313 3300005617 Bacteria 1870
146 Ga0068864_100024763 3300005618 Bacteria 5049
147 Ga0068864_100116280 3300005618 Bacteria 2386
148 Ga0068864_100164427 3300005618 Bacteria 2019
149 Ga0068866_10107430 3300005718 Unclassified 1551
150 Ga0068870_10005624 3300005840 Bacteria 5481
151 Ga0068863_100019275 3300005841 Bacteria 6524
152 Ga0068863_100103483 3300005841 Unclassified 2708
153 Ga0068858_100095575 3300005842 Unclassified 2769
154 Ga0068858_100126232 3300005842 Unclassified 2396
155 Ga0068858_100225854 3300005842 Unclassified 1774
156 Ga0068858_100257436 3300005842 Unclassified 1658
157 Ga0068860_100020300 3300005843 Bacteria 6435
158 Ga0068860_100062312 3300005843 Bacteria 3543
159 Ga0068860_100133419 3300005843 Unclassified 2384
160 Ga0068862_100163051 3300005844 Bacteria 1991
161 Ga0068862_100280056 3300005844 Bacteria 1528
162 Ga0081455_10003198 3300005937 Bacteria 18967
163 Ga0081538_10065947 3300005981 Unclassified 2034
164 Ga0081539_10000174 3300005985 Bacteria 151265
165 Ga0081539_10000783 3300005985 Bacteria 61928
166 Ga0081539_10002677 3300005985 Bacteria 24223
167 Ga0070716_100018163 3300006173 Bacteria 3659
168 Ga0070716_100039971 3300006173 Bacteria 2607
169 Ga0097621_100007146 3300006237 Bacteria 7959
170 Ga0097621_100156504 3300006237 Unclassified 1956
171 Ga0068871_100019886 3300006358 Bacteria 5134
172 Ga0068871_100064164 3300006358 Bacteria 3006
173 Ga0075428_100163741 3300006844 Bacteria 2413
174 Ga0075431_100162984 3300006847 Bacteria 2292
175 Ga0075433_10035607 3300006852 Bacteria 4283
176 Ga0075434_100048534 3300006871 Bacteria 4212
177 Ga0075434_100057562 3300006871 Bacteria 3863
178 Ga0075434_100063622 3300006871 Bacteria 3672
179 Ga0075434_100069301 3300006871 Bacteria 3517
180 Ga0075434_100075114 3300006871 Bacteria 3373
181 Ga0075434_100352974 3300006871 Unclassified 1492
182 Ga0075429_100018287 3300006880 Bacteria 6068
183 Ga0068865_100027544 3300006881 Unclassified 3755
184 Ga0068865_100120507 3300006881 Bacteria 1950
185 Ga0068865_100154164 3300006881 Bacteria 1746
186 Ga0075436_100022459 3300006914 Bacteria 4334
187 Ga0075436_100056728 3300006914 Bacteria 2705
188 Ga0097620_100026915 3300006931 Bacteria 5768
189 Ga0097620_100027755 3300006931 Bacteria 5678
190 Ga0097620_100047313 3300006931 Bacteria 4321
191 Ga0097620_100077203 3300006931 Bacteria 3372
192 Ga0097620_100123696 3300006931 Unclassified 2654
193 Ga0099794_10003895 3300007265 Bacteria 5780
194 Ga0099794_10032755 3300007265 Bacteria 2441
195 Ga0105240_10057075 3300009093 Bacteria 4881
196 Ga0111539_10013585 3300009094 Bacteria 10180
197 Ga0111539_10142253 3300009094 Bacteria 2808
198 Ga0105245_10005427 3300009098 Bacteria 11195
199 Ga0105245_10047033 3300009098 Bacteria 3857
200 Ga0105247_10105993 3300009101 Bacteria 1803
201 Ga0114129_10038799 3300009147 Bacteria 6714
202 Ga0114129_10279265 3300009147 Unclassified 2232
203 Ga0105243_10037454 3300009148 Unclassified 3770
204 Ga0105241_10042588 3300009174 Bacteria 3436
205 Ga0105242_10047578 3300009176 Unclassified 3483
206 Ga0105242_10233818 3300009176 Bacteria 1648
207 Ga0105248_10014958 3300009177 Bacteria 8542
208 Ga0105248_10036451 3300009177 Bacteria 5500
209 Ga0105248_10223676 3300009177 Unclassified 2119
210 Ga0105237_10002569 3300009545 Bacteria 22400
211 Ga0105238_10003652 3300009551 Bacteria 15343
212 Ga0105249_10000044 3300009553 Bacteria 184637
213 Ga0105249_10073041 3300009553 Bacteria 3172
214 Ga0105239_10040519 3300010375 Bacteria 5103
215 Ga0105239_10149354 3300010375 Bacteria 2608
216 Ga0105246_10008236 3300011119 Bacteria 6403
217 Ga0105246_10021640 3300011119 Unclassified 4140
218 Ga0105246_10047458 3300011119 Bacteria 2933
219 Ga0157371_10071980 3300013102 Bacteria 2448
220 Ga0157369_10088764 3300013105 Bacteria 3301
221 Ga0157374_10160302 3300013296 Unclassified 2191
222 Ga0157378_10012900 3300013297 Bacteria 7316
223 Ga0157378_10017829 3300013297 Bacteria 6233
224 Ga0157378_10029514 3300013297 Bacteria 4842
225 Ga0157378_10061703 3300013297 Bacteria 3347
226 Ga0157378_10252399 3300013297 Bacteria 1689
227 Ga0163162_10000025 3300013306 Bacteria 184648
228 Ga0163162_10038000 3300013306 Bacteria 4805
229 Ga0163162_10257297 3300013306 Bacteria 1877
230 Ga0157372_10031443 3300013307 Bacteria 5812
231 Ga0157375_10053540 3300013308 Unclassified 3971
232 Ga0157375_10079549 3300013308 Bacteria 3314
233 Ga0157375_10151446 3300013308 Bacteria 2455
234 Ga0157375_10162042 3300013308 Bacteria 2379
235 Ga0163163_10000536 3300014325 Bacteria 33560
236 Ga0163163_10036214 3300014325 Bacteria 4793
237 Ga0163163_10051914 3300014325 Bacteria 4043
238 Ga0163163_10170896 3300014325 Bacteria 2220
239 Ga0163163_10188510 3300014325 Unclassified 2111
240 Ga0157380_10001448 3300014326 Bacteria 15532
241 Ga0157380_10010426 3300014326 Bacteria 6687
242 Ga0157380_10011038 3300014326 Bacteria 6516
243 Ga0157380_10016677 3300014326 Bacteria 5422
244 Ga0157380_10043819 3300014326 Bacteria 3504
245 Ga0157380_10061869 3300014326 Unclassified 2997
246 Ga0157380_10097592 3300014326 Bacteria 2439
247 Ga0157377_10041245 3300014745 Unclassified 2560
248 Ga0157379_10106171 3300014968 Bacteria 2521
249 Ga0157379_10116554 3300014968 Bacteria 2402
250 Ga0157376_10010240 3300014969 Bacteria 6848
251 Ga0163161_10115821 3300017792 Unclassified 2009
252 Ga0213876_10000038 3300021384 Bacteria 182431
253 Ga0213876_10079339 3300021384 Bacteria 1735
254 Ga0207656_10001307 3300025321 Bacteria 8191
255 Ga0207653_10005271 3300025885 Bacteria 4040
256 Ga0207642_10082825 3300025899 Unclassified 1563
257 Ga0207680_10070985 3300025903 Unclassified 2157
258 Ga0207647_10048128 3300025904 Bacteria 2649
259 Ga0207645_10017579 3300025907 Bacteria 4715
260 Ga0207645_10035453 3300025907 Bacteria 3203
261 Ga0207645_10172077 3300025907 Bacteria 1420
262 Ga0207705_10043405 3300025909 Bacteria 3230
263 Ga0207684_10000079 3300025910 Bacteria 179842
264 Ga0207684_10153827 3300025910 Bacteria 1979
265 Ga0207654_10037979 3300025911 Bacteria 2699
266 Ga0207707_10007341 3300025912 Bacteria 9602
267 Ga0207707_10057446 3300025912 Bacteria 3387
268 Ga0207707_10120153 3300025912 Bacteria 2297
269 Ga0207671_10003041 3300025914 Bacteria 17169
270 Ga0207671_10095388 3300025914 Bacteria 2246
271 Ga0207660_10084323 3300025917 Bacteria 2342
272 Ga0207662_10005895 3300025918 Bacteria 6574
273 Ga0207662_10010572 3300025918 Bacteria 5101
274 Ga0207649_10008088 3300025920 Bacteria 5723
275 Ga0207649_10011431 3300025920 Unclassified 4895
276 Ga0207652_10003970 3300025921 Bacteria 12084
277 Ga0207652_10015520 3300025921 Bacteria 6195
278 Ga0207646_10040176 3300025922 Bacteria 4207
279 Ga0207646_10261214 3300025922 Bacteria 1565
280 Ga0207681_10010629 3300025923 Bacteria 5644
281 Ga0207681_10105153 3300025923 Unclassified 2043
282 Ga0207650_10000001 3300025925 Bacteria 1545726
283 Ga0207659_10007063 3300025926 Bacteria 6891
284 Ga0207690_10049182 3300025932 Bacteria 2809
285 Ga0207690_10075765 3300025932 Bacteria 2334
286 Ga0207706_10014274 3300025933 Bacteria 7199
287 Ga0207669_10051656 3300025937 Bacteria 2464
288 Ga0207665_10001987 3300025939 Bacteria 13787
289 Ga0207665_10041107 3300025939 Bacteria 3086
290 Ga0207691_10019869 3300025940 Bacteria 6354
291 Ga0207691_10022946 3300025940 Bacteria 5880
292 Ga0207691_10036960 3300025940 Bacteria 4524
293 Ga0207691_10039552 3300025940 Bacteria 4363
294 Ga0207711_10008133 3300025941 Bacteria 8780
295 Ga0207711_10168354 3300025941 Bacteria 1987
296 Ga0207689_10004823 3300025942 Bacteria 12164
297 Ga0207689_10064210 3300025942 Bacteria 3021
298 Ga0207661_10000302 3300025944 Bacteria 31330
299 Ga0207661_10003744 3300025944 Bacteria 10594
300 Ga0207679_10016390 3300025945 Unclassified 4921
301 Ga0207679_10050327 3300025945 Bacteria 3044
302 Ga0207679_10164195 3300025945 Bacteria 1821
303 Ga0207679_10284423 3300025945 Bacteria 1419
304 Ga0207667_10046109 3300025949 Bacteria 4615
305 Ga0207651_10026854 3300025960 Bacteria 3605
306 Ga0207712_10000039 3300025961 Bacteria 182548
307 Ga0207668_10018034 3300025972 Bacteria 4434
308 Ga0207640_10080831 3300025981 Bacteria 2220
309 Ga0207640_10085306 3300025981 Bacteria 2171
310 Ga0207640_10165962 3300025981 Unclassified 1640
311 Ga0207658_10043728 3300025986 Bacteria 3258
312 Ga0207658_10162761 3300025986 Unclassified 1830
313 Ga0207703_10056982 3300026035 Unclassified 3184
314 Ga0207703_10216240 3300026035 Unclassified 1711
315 Ga0207639_10096410 3300026041 Bacteria 2379
316 Ga0207639_10157538 3300026041 Unclassified 1909
317 Ga0207708_10205565 3300026075 Bacteria 1572
318 Ga0207641_10027396 3300026088 Bacteria 4706
319 Ga0207641_10140772 3300026088 Bacteria 2177
320 Ga0207641_10156646 3300026088 Bacteria 2067
321 Ga0207648_10013956 3300026089 Bacteria 7448
322 Ga0207648_10021064 3300026089 Bacteria 5864
323 Ga0207648_10067073 3300026089 Bacteria 3129
324 Ga0207648_10086898 3300026089 Unclassified 2728
325 Ga0207676_10002604 3300026095 Bacteria 12861
326 Ga0207676_10030703 3300026095 Bacteria 4036
327 Ga0207676_10118740 3300026095 Bacteria 2226
328 Ga0207676_10233242 3300026095 Unclassified 1646
329 Ga0207674_10007014 3300026116 Bacteria 13170
330 Ga0207674_10020390 3300026116 Bacteria 7162
331 Ga0207674_10022220 3300026116 Bacteria 6817
332 Ga0207674_10025327 3300026116 Bacteria 6330
333 Ga0207675_100019343 3300026118 Bacteria 6354
334 Ga0207675_100030061 3300026118 Bacteria 5058
335 Ga0207675_100181399 3300026118 Unclassified 2016
336 Ga0207683_10045855 3300026121 Bacteria 3823
337 Ga0207683_10130524 3300026121 Bacteria 2260
338 Ga0207428_10013006 3300027907 Bacteria 7289
339 Ga0268265_10107505 3300028380 Bacteria 2269
340 Ga0268265_10177865 3300028380 Bacteria 1825
341 Ga0268264_10180702 3300028381 Bacteria 1916
342 Ga0268264_10182602 3300028381 Unclassified 1906
343 Ga0307408_100036860 3300031548 Bacteria 3440
344 Ga0307408_100090445 3300031548 Bacteria 2310
345 Ga0307408_100136212 3300031548 Unclassified 1922
346 Ga0307405_10015355 3300031731 Bacteria 4146
347 Ga0307405_10067426 3300031731 Bacteria 2286
348 Ga0307413_10035671 3300031824 Bacteria 2855
349 Ga0307406_10077301 3300031901 Bacteria 2201
350 Ga0307406_10113328 3300031901 Bacteria 1871
351 Ga0307407_10107136 3300031903 Bacteria 1747
352 Ga0307409_100002262 3300031995 Bacteria 9965
353 Ga0307409_100382466 3300031995 Bacteria 1338
354 Ga0307416_100001200 3300032002 Bacteria 13945
355 Ga0307416_100111643 3300032002 Bacteria 2411
356 Ga0307414_10066096 3300032004 Bacteria 2583
357 Ga0307411_10006527 3300032005 Bacteria 5847
358 Ga0373944_0011479 3300035089 Archaea 2428
359 Ga0373946_0010984 3300035171 Bacteria 3367
360 Ga0373935_0021631 3300035692 Bacteria 3940
361 Ga0395905_0044236 3300037471 Bacteria 4179
362 Ga0395901_0226880 3300038443 Bacteria 1951
363 Ga0436365_0038900 3300039437 Bacteria 45987
364 Ga0436365_0302059 3300039437 Bacteria 1735
365 Ga0436365_1023949 3300039437 Bacteria 126686
366 Ga0451577_0027841 3300042876 Bacteria 5114
367 Ga0451576_0084913 3300045051 Bacteria 3293
368 Ga0496104_0138028 3300048907 Unclassified 2343
369 Ga0496106_0064870 3300048909 Bacteria 2779
370 Ga0496108_0035963 3300048911 Bacteria 4119
371 Ga0496109_0084708 3300048912 Bacteria 2925
372 Ga0496112_0023210 3300048915 Bacteria 5922
373 Ga0496113_0021210 3300048916 Bacteria 4580
374 Ga0496113_0095987 3300048916 Bacteria 2292
375 Ga0501292_001847 3300049515 Bacteria 2655
376 Ga0501299_000266 3300049522 Bacteria 5989
377 Ga0501032_0002645 3300049569 Bacteria 13969
378 Ga0501038_0002878 3300049574 Bacteria 16052
379 Ga0501069_0012023 3300049585 Bacteria 4596
380 Ga0501198_004717 3300049649 Bacteria 1900
381 Ga0501217_002116 3300049661 Bacteria 3853
382 Ga0501223_009239 3300049663 Bacteria 2001
383 Ga0501235_007600 3300049669 Bacteria 2361
384 Ga0501249_003852 3300049679 Bacteria 3028
385 Ga0501080_0034251 3300049742 Bacteria 4740
386 nmdc:mga05p37_105816_c1 3300050507 Unclassified 3461
387 nmdc:mga05p37_254185_c1 3300050507 Unclassified 2106
388 nmdc:mga06r32_74883_c1 3300050510 Bacteria 3283
389 nmdc:mga08y16_9954_c1 3300050511 Bacteria 9981
390 nmdc:mga0n895_139450_c1 3300050512 Bacteria 2452
391 nmdc:mga0n895_87215_c1 3300050512 Bacteria 3118
392 nmdc:mga0rr50_76599_c1 3300050513 Bacteria 2568
393 nmdc:mga08x19_30832_c1 3300050514 Bacteria 3370
394 nmdc:mga0a205_50394_c1 3300050515 Bacteria 4020
395 nmdc:mga0a205_58119_c1 3300050515 Bacteria 3735
396 nmdc:mga0a205_67234_c1 3300050515 Bacteria 3462

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10002765 Ga0070658_1000276514 351
2 3300005344 Ga0070661_100039573 Ga0070661_1000395733 351
3 3300005366 Ga0070659_100118247 Ga0070659_1001182471 351
4 3300005445 Ga0070708_100000587 Ga0070708_10000058720 351
5 3300013102 Ga0157371_10071980 Ga0157371_100719801 351
6 3300025932 Ga0207690_10049182 Ga0207690_100491822 351
7 3300005530 Ga0070679_100226433 Ga0070679_1002264331 356
8 3300005564 Ga0070664_100027689 Ga0070664_1000276893 356
9 3300025945 Ga0207679_10164195 Ga0207679_101641953 356
10 3300026088 Ga0207641_10140772 Ga0207641_101407723 356
11 3300048912 Ga0496109_0084708 Ga0496109_0084708_1589_2788 356
12 3300031548 Ga0307408_100090445 Ga0307408_1000904453 358
13 3300031901 Ga0307406_10113328 Ga0307406_101133283 358
14 3300031995 Ga0307409_100382466 Ga0307409_1003824661 358
15 3300005329 Ga0070683_100000440 Ga0070683_10000044014 359
16 3300005331 Ga0070670_100155392 Ga0070670_1001553922 359
17 3300005367 Ga0070667_100112313 Ga0070667_1001123133 359
18 3300005459 Ga0068867_100168471 Ga0068867_1001684711 359
19 3300005543 Ga0070672_100046398 Ga0070672_1000463982 359
20 3300005577 Ga0068857_100011003 Ga0068857_1000110034 359
21 3300005578 Ga0068854_100142154 Ga0068854_1001421542 359
22 3300005618 Ga0068864_100116280 Ga0068864_1001162803 359
23 3300005842 Ga0068858_100225854 Ga0068858_1002258542 359
24 3300006881 Ga0068865_100120507 Ga0068865_1001205072 359
25 3300013308 Ga0157375_10162042 Ga0157375_101620423 359
26 3300025907 Ga0207645_10017579 Ga0207645_100175791 359
27 3300025909 Ga0207705_10043405 Ga0207705_100434053 359
28 3300025937 Ga0207669_10051656 Ga0207669_100516563 359
29 3300025940 Ga0207691_10039552 Ga0207691_100395522 359
30 3300025941 Ga0207711_10168354 Ga0207711_101683542 359
31 3300025944 Ga0207661_10003744 Ga0207661_100037442 359
32 3300025972 Ga0207668_10018034 Ga0207668_100180344 359
33 3300025981 Ga0207640_10085306 Ga0207640_100853062 359
34 3300025986 Ga0207658_10162761 Ga0207658_101627612 359
35 3300026035 Ga0207703_10216240 Ga0207703_102162402 359
36 3300026095 Ga0207676_10030703 Ga0207676_100307033 359
37 3300026116 Ga0207674_10007014 Ga0207674_100070144 359
38 3300048915 Ga0496112_0023210 Ga0496112_0023210_510_1709 359
39 3300048916 Ga0496113_0021210 Ga0496113_0021210_662_1861 359
40 3300005617 Ga0068859_100027753 Ga0068859_1000277534 360
41 3300006931 Ga0097620_100027755 Ga0097620_1000277554 360
42 3300025907 Ga0207645_10172077 Ga0207645_101720771 360
43 3300005536 Ga0070697_100002759 Ga0070697_1000027597 361
44 3300026041 Ga0207639_10096410 Ga0207639_100964102 361
45 3300005445 Ga0070708_100046690 Ga0070708_1000466903 362
46 3300031548 Ga0307408_100036860 Ga0307408_1000368604 363
47 3300031731 Ga0307405_10015355 Ga0307405_100153553 363
48 3300031824 Ga0307413_10035671 Ga0307413_100356712 363
49 3300031901 Ga0307406_10077301 Ga0307406_100773013 363
50 3300031903 Ga0307407_10107136 Ga0307407_101071361 363
51 3300031995 Ga0307409_100002262 Ga0307409_1000022624 363
52 3300032002 Ga0307416_100001200 Ga0307416_1000012002 363
53 3300032004 Ga0307414_10066096 Ga0307414_100660962 363
54 3300032005 Ga0307411_10006527 Ga0307411_100065274 363
55 3300005355 Ga0070671_100201943 Ga0070671_1002019432 364
56 3300005535 Ga0070684_100003911 Ga0070684_1000039112 364
57 3300005543 Ga0070672_100016306 Ga0070672_1000163064 364
58 3300013105 Ga0157369_10088764 Ga0157369_100887642 364
59 3300025920 Ga0207649_10008088 Ga0207649_100080884 364
60 3300025945 Ga0207679_10284423 Ga0207679_102844231 364
61 3300025981 Ga0207640_10165962 Ga0207640_101659622 364
62 3300026088 Ga0207641_10156646 Ga0207641_101566462 364
63 3300005434 Ga0070709_10023156 Ga0070709_100231563 366
64 3300005444 Ga0070694_100018467 Ga0070694_1000184671 366
65 3300005445 Ga0070708_100000180 Ga0070708_10000018010 366
66 3300005445 Ga0070708_100149997 Ga0070708_1001499971 366
67 3300005468 Ga0070707_100003360 Ga0070707_10000336014 366
68 3300005518 Ga0070699_100039063 Ga0070699_1000390632 366
69 3300005530 Ga0070679_100202010 Ga0070679_1002020102 366
70 3300005536 Ga0070697_100047479 Ga0070697_1000474793 366
71 3300005549 Ga0070704_100020683 Ga0070704_1000206833 366
72 3300006173 Ga0070716_100018163 Ga0070716_1000181632 366
73 3300007265 Ga0099794_10003895 Ga0099794_100038953 366
74 3300013297 Ga0157378_10252399 Ga0157378_102523992 366
75 3300025910 Ga0207684_10153827 Ga0207684_101538272 366
76 3300025922 Ga0207646_10040176 Ga0207646_100401764 366
77 3300025939 Ga0207665_10001987 Ga0207665_100019875 366
78 3300005329 Ga0070683_100036707 Ga0070683_1000367074 367
79 3300005337 Ga0070682_100002914 Ga0070682_1000029147 367
80 3300005458 Ga0070681_10005204 Ga0070681_100052048 367
81 3300005530 Ga0070679_100010998 Ga0070679_1000109987 367
82 3300005535 Ga0070684_100000920 Ga0070684_10000092010 367
83 3300005564 Ga0070664_100001870 Ga0070664_1000018707 367
84 3300005577 Ga0068857_100199999 Ga0068857_1001999992 367
85 3300006871 Ga0075434_100057562 Ga0075434_1000575624 367
86 3300006914 Ga0075436_100056728 Ga0075436_1000567282 367
87 3300025912 Ga0207707_10007341 Ga0207707_100073415 367
88 3300025920 Ga0207649_10011431 Ga0207649_100114311 367
89 3300025921 Ga0207652_10003970 Ga0207652_100039708 367
90 3300025944 Ga0207661_10000302 Ga0207661_1000030229 367
91 3300025945 Ga0207679_10016390 Ga0207679_100163904 367
92 3300026116 Ga0207674_10025327 Ga0207674_100253272 367
93 3300050515 nmdc:mga0a205_67234_c1 nmdc:mga0a205_67234_c1_2015_3166 367
94 3300005330 Ga0070690_100071274 Ga0070690_1000712742 369
95 3300005331 Ga0070670_100103180 Ga0070670_1001031802 369
96 3300005354 Ga0070675_100011568 Ga0070675_1000115682 369
97 3300005354 Ga0070675_100236237 Ga0070675_1002362371 369
98 3300005364 Ga0070673_100043690 Ga0070673_1000436902 369
99 3300005365 Ga0070688_100030479 Ga0070688_1000304793 369
100 3300005367 Ga0070667_100081417 Ga0070667_1000814172 369
101 3300005535 Ga0070684_100078813 Ga0070684_1000788132 369
102 3300005543 Ga0070672_100024305 Ga0070672_1000243053 369
103 3300005564 Ga0070664_100034607 Ga0070664_1000346073 369
104 3300005577 Ga0068857_100011523 Ga0068857_1000115234 369
105 3300005617 Ga0068859_100026913 Ga0068859_1000269133 369
106 3300005840 Ga0068870_10005624 Ga0068870_100056245 369
107 3300005844 Ga0068862_100163051 Ga0068862_1001630512 369
108 3300006871 Ga0075434_100352974 Ga0075434_1003529741 369
109 3300006931 Ga0097620_100026915 Ga0097620_1000269154 369
110 3300025918 Ga0207662_10005895 Ga0207662_100058955 369
111 3300025923 Ga0207681_10010629 Ga0207681_100106293 369
112 3300025926 Ga0207659_10007063 Ga0207659_100070635 369
113 3300025940 Ga0207691_10022946 Ga0207691_100229465 369
114 3300025945 Ga0207679_10050327 Ga0207679_100503272 369
115 3300025960 Ga0207651_10026854 Ga0207651_100268542 369
116 3300025986 Ga0207658_10043728 Ga0207658_100437282 369
117 3300026116 Ga0207674_10022220 Ga0207674_100222201 369
118 3300028380 Ga0268265_10107505 Ga0268265_101075052 369
119 3300005468 Ga0070707_100292738 Ga0070707_1002927381 370
120 3300005981 Ga0081538_10065947 Ga0081538_100659471 370
121 3300025922 Ga0207646_10261214 Ga0207646_102612141 370
122 3300005340 Ga0070689_100064266 Ga0070689_1000642662 371
123 3300005365 Ga0070688_100002224 Ga0070688_1000022249 371
124 3300005467 Ga0070706_100058599 Ga0070706_1000585993 372
125 3300005536 Ga0070697_100192626 Ga0070697_1001926262 372
126 3300005334 Ga0068869_100260398 Ga0068869_1002603981 373
127 3300005336 Ga0070680_100023160 Ga0070680_1000231602 373
128 3300005536 Ga0070697_100024221 Ga0070697_1000242213 375
129 3300009177 Ga0105248_10036451 Ga0105248_100364513 375
130 3300014968 Ga0157379_10106171 Ga0157379_101061712 375
131 3300005337 Ga0070682_100029171 Ga0070682_1000291712 376
132 3300005445 Ga0070708_100119074 Ga0070708_1001190742 376
133 3300005458 Ga0070681_10156665 Ga0070681_101566652 376
134 3300005467 Ga0070706_100271169 Ga0070706_1002711692 376
135 3300005536 Ga0070697_100080742 Ga0070697_1000807421 376
136 3300005539 Ga0068853_100068112 Ga0068853_1000681122 376
137 3300005545 Ga0070695_100007469 Ga0070695_1000074694 376
138 3300005563 Ga0068855_100004796 Ga0068855_10000479615 376
139 3300006880 Ga0075429_100018287 Ga0075429_1000182873 376
140 3300009098 Ga0105245_10005427 Ga0105245_100054276 376
141 3300010375 Ga0105239_10149354 Ga0105239_101493543 376
142 3300025912 Ga0207707_10120153 Ga0207707_101201532 376
143 3300025949 Ga0207667_10046109 Ga0207667_100461093 376
144 3300035089 Ga0373944_0011479 Ga0373944_0011479_1172_2359 376
145 3300035171 Ga0373946_0010984 Ga0373946_0010984_1212_2399 376
146 3300035692 Ga0373935_0021631 Ga0373935_0021631_2032_3219 376
147 3300005336 Ga0070680_100018902 Ga0070680_1000189022 377
148 3300005337 Ga0070682_100025154 Ga0070682_1000251541 377
149 3300005458 Ga0070681_10012844 Ga0070681_100128447 377
150 3300005530 Ga0070679_100018357 Ga0070679_1000183572 377
151 3300007265 Ga0099794_10032755 Ga0099794_100327552 377
152 3300009553 Ga0105249_10073041 Ga0105249_100730413 377
153 3300025917 Ga0207660_10084323 Ga0207660_100843232 377
154 3300025921 Ga0207652_10015520 Ga0207652_100155202 377
155 3300032002 Ga0307416_100111643 Ga0307416_1001116432 377
156 3300049585 Ga0501069_0012023 Ga0501069_0012023_447_1628 377
157 3300005330 Ga0070690_100041233 Ga0070690_1000412332 378
158 3300005544 Ga0070686_100007940 Ga0070686_1000079405 378
159 3300013297 Ga0157378_10061703 Ga0157378_100617034 378
160 3300014326 Ga0157380_10016677 Ga0157380_100166775 378
161 3300025907 Ga0207645_10035453 Ga0207645_100354532 378
162 3300025933 Ga0207706_10014274 Ga0207706_100142745 378
163 3300026089 Ga0207648_10021064 Ga0207648_100210643 378
164 3300049742 Ga0501080_0034251 Ga0501080_0034251_3466_4704 378
165 3300005353 Ga0070669_100061200 Ga0070669_1000612003 379
166 3300005985 Ga0081539_10000174 Ga0081539_1000017477 379
167 3300014326 Ga0157380_10097592 Ga0157380_100975923 379
168 3300025923 Ga0207681_10105153 Ga0207681_101051532 379
169 3300025940 Ga0207691_10036960 Ga0207691_100369602 379
170 3300028381 Ga0268264_10180702 Ga0268264_101807021 379
171 3300005937 Ga0081455_10003198 Ga0081455_1000319810 380
172 3300013308 Ga0157375_10151446 Ga0157375_101514463 380
173 3300005546 Ga0070696_100022034 Ga0070696_1000220342 381
174 3300005547 Ga0070693_100002560 Ga0070693_1000025602 381
175 3300026088 Ga0207641_10027396 Ga0207641_100273961 383
176 3300014325 Ga0163163_10188510 Ga0163163_101885103 384
177 3300042876 Ga0451577_0027841 Ga0451577_0027841_758_1954 386
178 3300005345 Ga0070692_10008899 Ga0070692_100088993 388
179 3300011119 Ga0105246_10008236 Ga0105246_100082363 388
180 3300005518 Ga0070699_100037212 Ga0070699_1000372123 389
181 3300005364 Ga0070673_100185804 Ga0070673_1001858042 390
182 3300005456 Ga0070678_100013367 Ga0070678_1000133675 390
183 3300013297 Ga0157378_10029514 Ga0157378_100295145 390
184 3300026089 Ga0207648_10067073 Ga0207648_100670732 390
185 3300026121 Ga0207683_10130524 Ga0207683_101305242 390
186 3300049569 Ga0501032_0002645 Ga0501032_0002645_3993_5228 390
187 3300005288 Ga0065714_10002186 Ga0065714_1000218669 392
188 3300005290 Ga0065712_10000113 Ga0065712_1000011369 392
189 3300005293 Ga0065715_10090024 Ga0065715_100900249 392
190 3300005295 Ga0065707_10010867 Ga0065707_100108673 392
191 3300005577 Ga0068857_100030528 Ga0068857_1000305282 392
192 3300005618 Ga0068864_100164427 Ga0068864_1001644272 392
193 3300005841 Ga0068863_100019275 Ga0068863_1000192755 392
194 3300005985 Ga0081539_10002677 Ga0081539_1000267721 392
195 3300011119 Ga0105246_10021640 Ga0105246_100216404 392
196 3300025904 Ga0207647_10048128 Ga0207647_100481283 392
197 3300026089 Ga0207648_10086898 Ga0207648_100868982 392
198 3300026116 Ga0207674_10020390 Ga0207674_100203905 392
199 3300048916 Ga0496113_0095987 Ga0496113_0095987_235_1413 392
200 3300050512 nmdc:mga0n895_139450_c1 nmdc:mga0n895_139450_c1_406_1584 392
201 3300005547 Ga0070693_100045214 Ga0070693_1000452143 393
202 3300005549 Ga0070704_100018694 Ga0070704_1000186943 393
203 3300005718 Ga0068866_10107430 Ga0068866_101074301 393
204 3300025912 Ga0207707_10057446 Ga0207707_100574463 393
205 3300026075 Ga0207708_10205565 Ga0207708_102055652 393
206 3300005331 Ga0070670_100116626 Ga0070670_1001166262 394
207 3300005843 Ga0068860_100133419 Ga0068860_1001334193 394
208 3300048907 Ga0496104_0138028 Ga0496104_0138028_783_2006 394
209 3300005445 Ga0070708_100005408 Ga0070708_1000054086 395
210 3300005467 Ga0070706_100023990 Ga0070706_1000239903 395
211 3300005518 Ga0070699_100007133 Ga0070699_1000071336 395
212 3300005549 Ga0070704_100021850 Ga0070704_1000218504 395
213 3300005844 Ga0068862_100280056 Ga0068862_1002800561 395
214 3300006852 Ga0075433_10035607 Ga0075433_100356073 395
215 3300006871 Ga0075434_100048534 Ga0075434_1000485343 395
216 3300050512 nmdc:mga0n895_87215_c1 nmdc:mga0n895_87215_c1_1282_2592 395
217 3300006173 Ga0070716_100039971 Ga0070716_1000399713 396
218 3300009177 Ga0105248_10014958 Ga0105248_100149584 396
219 3300013308 Ga0157375_10079549 Ga0157375_100795493 396
220 3300025939 Ga0207665_10041107 Ga0207665_100411073 396
221 3300013297 Ga0157378_10012900 Ga0157378_100129003 397
222 3300050515 nmdc:mga0a205_58119_c1 nmdc:mga0a205_58119_c1_1280_2503 397
223 3300013306 Ga0163162_10038000 Ga0163162_100380003 398
224 3300013306 Ga0163162_10257297 Ga0163162_102572972 398
225 3300005353 Ga0070669_100206713 Ga0070669_1002067131 400
226 3300005536 Ga0070697_100000042 Ga0070697_10000004257 400
227 3300005614 Ga0068856_100109839 Ga0068856_1001098394 400
228 3300021384 Ga0213876_10079339 Ga0213876_100793392 401
229 3300039437 Ga0436365_0302059 Ga0436365_0302059_422_1711 401
230 3300021384 Ga0213876_10000038 Ga0213876_1000003865 402
231 3300026041 Ga0207639_10157538 Ga0207639_101575382 402
232 3300039437 Ga0436365_0038900 Ga0436365_0038900_15343_16665 402
233 3300048911 Ga0496108_0035963 Ga0496108_0035963_2509_3819 402
234 3300005290 Ga0065712_10002668 Ga0065712_100026683 403
235 3300005293 Ga0065715_10005754 Ga0065715_100057544 403
236 3300005330 Ga0070690_100006228 Ga0070690_1000062284 403
237 3300005353 Ga0070669_100096528 Ga0070669_1000965282 403
238 3300005438 Ga0070701_10081116 Ga0070701_100811162 403
239 3300005546 Ga0070696_100006190 Ga0070696_1000061903 403
240 3300006844 Ga0075428_100163741 Ga0075428_1001637412 403
241 3300006871 Ga0075434_100069301 Ga0075434_1000693014 403
242 3300006881 Ga0068865_100154164 Ga0068865_1001541642 403
243 3300009094 Ga0111539_10142253 Ga0111539_101422532 403
244 3300009147 Ga0114129_10038799 Ga0114129_100387997 403
245 3300009553 Ga0105249_10000044 Ga0105249_1000004437 403
246 3300013306 Ga0163162_10000025 Ga0163162_10000025120 403
247 3300014326 Ga0157380_10010426 Ga0157380_100104264 403
248 3300014326 Ga0157380_10011038 Ga0157380_100110382 403
249 3300014326 Ga0157380_10043819 Ga0157380_100438192 403
250 3300025961 Ga0207712_10000039 Ga0207712_10000039135 403
251 3300025981 Ga0207640_10080831 Ga0207640_100808312 403
252 3300026118 Ga0207675_100019343 Ga0207675_1000193438 403
253 3300006871 Ga0075434_100063622 Ga0075434_1000636223 404
254 3300014325 Ga0163163_10051914 Ga0163163_100519141 404
255 3300025941 Ga0207711_10008133 Ga0207711_100081333 404
256 3300050515 nmdc:mga0a205_50394_c1 nmdc:mga0a205_50394_c1_2525_3832 404
257 3300003203 JGI25406J46586_10002162 JGI25406J46586_100021625 405
258 3300005467 Ga0070706_100000019 Ga0070706_100000019108 405
259 3300005545 Ga0070695_100054421 Ga0070695_1000544213 405
260 3300005617 Ga0068859_100248313 Ga0068859_1002483131 405
261 3300005985 Ga0081539_10000783 Ga0081539_1000078317 405
262 3300050513 nmdc:mga0rr50_76599_c1 nmdc:mga0rr50_76599_c1_946_2247 405
263 3300002459 JGI24751J29686_10000013 JGI24751J29686_1000001361 406
264 3300005289 Ga0065704_10003229 Ga0065704_100032294 406
265 3300005293 Ga0065715_10091511 Ga0065715_100915114 406
266 3300005295 Ga0065707_10001531 Ga0065707_100015314 406
267 3300005330 Ga0070690_100113711 Ga0070690_1001137111 406
268 3300005331 Ga0070670_100000129 Ga0070670_10000012942 406
269 3300005337 Ga0070682_100028715 Ga0070682_1000287153 406
270 3300005345 Ga0070692_10013410 Ga0070692_100134103 406
271 3300005441 Ga0070700_100026221 Ga0070700_1000262214 406
272 3300005444 Ga0070694_100033237 Ga0070694_1000332374 406
273 3300005471 Ga0070698_100029396 Ga0070698_1000293963 406
274 3300005545 Ga0070695_100017748 Ga0070695_1000177484 406
275 3300005615 Ga0070702_100026096 Ga0070702_1000260962 406
276 3300005842 Ga0068858_100095575 Ga0068858_1000955753 406
277 3300005843 Ga0068860_100020300 Ga0068860_1000203005 406
278 3300006237 Ga0097621_100007146 Ga0097621_1000071467 406
279 3300006358 Ga0068871_100019886 Ga0068871_1000198862 406
280 3300006914 Ga0075436_100022459 Ga0075436_1000224593 406
281 3300009094 Ga0111539_10013585 Ga0111539_100135853 406
282 3300009101 Ga0105247_10105993 Ga0105247_101059932 406
283 3300009147 Ga0114129_10279265 Ga0114129_102792652 406
284 3300009174 Ga0105241_10042588 Ga0105241_100425882 406
285 3300014325 Ga0163163_10000536 Ga0163163_1000053619 406
286 3300014326 Ga0157380_10001448 Ga0157380_100014485 406
287 3300025910 Ga0207684_10000079 Ga0207684_10000079122 406
288 3300025911 Ga0207654_10037979 Ga0207654_100379793 406
289 3300025914 Ga0207671_10095388 Ga0207671_100953882 406
290 3300025925 Ga0207650_10000001 Ga0207650_10000001111 406
291 3300026035 Ga0207703_10056982 Ga0207703_100569823 406
292 3300026095 Ga0207676_10118740 Ga0207676_101187403 406
293 3300026118 Ga0207675_100181399 Ga0207675_1001813992 406
294 3300027907 Ga0207428_10013006 Ga0207428_100130065 406
295 3300028380 Ga0268265_10177865 Ga0268265_101778652 406
296 3300031548 Ga0307408_100136212 Ga0307408_1001362122 406
297 3300031731 Ga0307405_10067426 Ga0307405_100674263 406
298 3300037471 Ga0395905_0044236 Ga0395905_0044236_2102_3412 406
299 3300038443 Ga0395901_0226880 Ga0395901_0226880_368_1678 406
300 3300039437 Ga0436365_1023949 Ga0436365_1023949_27909_29255 406
301 3300049522 Ga0501299_000266 Ga0501299_000266_465_1685 406
302 3300049574 Ga0501038_0002878 Ga0501038_0002878_5283_6566 406
303 3300049661 Ga0501217_002116 Ga0501217_002116_1993_3213 406
304 3300049669 Ga0501235_007600 Ga0501235_007600_619_1839 406
305 3300050507 nmdc:mga05p37_254185_c1 nmdc:mga05p37_254185_c1_468_1790 406
306 3300050511 nmdc:mga08y16_9954_c1 nmdc:mga08y16_9954_c1_6034_7290 406
307 3300050514 nmdc:mga08x19_30832_c1 nmdc:mga08x19_30832_c1_1089_2309 406
308 3300005345 Ga0070692_10066973 Ga0070692_100669732 407
309 3300005353 Ga0070669_100038209 Ga0070669_1000382093 407
310 3300005366 Ga0070659_100093853 Ga0070659_1000938533 407
311 3300005518 Ga0070699_100013495 Ga0070699_1000134958 407
312 3300005617 Ga0068859_100047313 Ga0068859_1000473133 407
313 3300005618 Ga0068864_100024763 Ga0068864_1000247634 407
314 3300005842 Ga0068858_100126232 Ga0068858_1001262323 407
315 3300006871 Ga0075434_100075114 Ga0075434_1000751143 407
316 3300006931 Ga0097620_100047313 Ga0097620_1000473134 407
317 3300009176 Ga0105242_10233818 Ga0105242_102338181 407
318 3300009551 Ga0105238_10003652 Ga0105238_100036523 407
319 3300014325 Ga0163163_10170896 Ga0163163_101708962 407
320 3300025932 Ga0207690_10075765 Ga0207690_100757651 407
321 3300026095 Ga0207676_10002604 Ga0207676_100026045 407
322 3300045051 Ga0451576_0084913 Ga0451576_0084913_634_1875 407
323 3300048909 Ga0496106_0064870 Ga0496106_0064870_1477_2718 407
324 3300005295 Ga0065707_10093298 Ga0065707_100932984 408
325 3300005334 Ga0068869_100051146 Ga0068869_1000511463 408
326 3300013307 Ga0157372_10031443 Ga0157372_100314434 408
327 3300025942 Ga0207689_10064210 Ga0207689_100642102 408
328 3300000532 CNAas_1000089 CNAas_10000895 409
329 3300005290 Ga0065712_10089566 Ga0065712_100895663 409
330 3300005330 Ga0070690_100138968 Ga0070690_1001389681 409
331 3300005334 Ga0068869_100094662 Ga0068869_1000946621 409
332 3300005335 Ga0070666_10060634 Ga0070666_100606341 409
333 3300005338 Ga0068868_100058990 Ga0068868_1000589902 409
334 3300005345 Ga0070692_10036037 Ga0070692_100360373 409
335 3300005355 Ga0070671_100185672 Ga0070671_1001856721 409
336 3300005364 Ga0070673_100038785 Ga0070673_1000387854 409
337 3300005365 Ga0070688_100018977 Ga0070688_1000189772 409
338 3300005406 Ga0070703_10004680 Ga0070703_100046803 409
339 3300005438 Ga0070701_10086779 Ga0070701_100867791 409
340 3300005444 Ga0070694_100004857 Ga0070694_1000048573 409
341 3300005456 Ga0070678_100098522 Ga0070678_1000985222 409
342 3300005459 Ga0068867_100102132 Ga0068867_1001021322 409
343 3300005471 Ga0070698_100031011 Ga0070698_1000310112 409
344 3300005543 Ga0070672_100130953 Ga0070672_1001309532 409
345 3300005545 Ga0070695_100020482 Ga0070695_1000204822 409
346 3300005547 Ga0070693_100006607 Ga0070693_1000066073 409
347 3300005578 Ga0068854_100036580 Ga0068854_1000365803 409
348 3300005578 Ga0068854_100113742 Ga0068854_1001137422 409
349 3300005615 Ga0070702_100054109 Ga0070702_1000541091 409
350 3300005617 Ga0068859_100077205 Ga0068859_1000772051 409
351 3300005617 Ga0068859_100123703 Ga0068859_1001237032 409
352 3300005841 Ga0068863_100103483 Ga0068863_1001034832 409
353 3300005842 Ga0068858_100257436 Ga0068858_1002574361 409
354 3300005843 Ga0068860_100062312 Ga0068860_1000623122 409
355 3300006237 Ga0097621_100156504 Ga0097621_1001565042 409
356 3300006358 Ga0068871_100064164 Ga0068871_1000641642 409
357 3300006847 Ga0075431_100162984 Ga0075431_1001629842 409
358 3300006881 Ga0068865_100027544 Ga0068865_1000275443 409
359 3300006931 Ga0097620_100077203 Ga0097620_1000772033 409
360 3300006931 Ga0097620_100123696 Ga0097620_1001236962 409
361 3300009093 Ga0105240_10057075 Ga0105240_100570754 409
362 3300009098 Ga0105245_10047033 Ga0105245_100470333 409
363 3300009148 Ga0105243_10037454 Ga0105243_100374542 409
364 3300009176 Ga0105242_10047578 Ga0105242_100475782 409
365 3300009177 Ga0105248_10223676 Ga0105248_102236762 409
366 3300009545 Ga0105237_10002569 Ga0105237_1000256913 409
367 3300010375 Ga0105239_10040519 Ga0105239_100405192 409
368 3300011119 Ga0105246_10047458 Ga0105246_100474582 409
369 3300013296 Ga0157374_10160302 Ga0157374_101603022 409
370 3300013297 Ga0157378_10017829 Ga0157378_100178292 409
371 3300013308 Ga0157375_10053540 Ga0157375_100535402 409
372 3300014325 Ga0163163_10036214 Ga0163163_100362142 409
373 3300014326 Ga0157380_10061869 Ga0157380_100618692 409
374 3300014745 Ga0157377_10041245 Ga0157377_100412452 409
375 3300014968 Ga0157379_10116554 Ga0157379_101165543 409
376 3300014969 Ga0157376_10010240 Ga0157376_100102406 409
377 3300017792 Ga0163161_10115821 Ga0163161_101158213 409
378 3300025321 Ga0207656_10001307 Ga0207656_100013075 409
379 3300025885 Ga0207653_10005271 Ga0207653_100052712 409
380 3300025899 Ga0207642_10082825 Ga0207642_100828251 409
381 3300025903 Ga0207680_10070985 Ga0207680_100709852 409
382 3300025914 Ga0207671_10003041 Ga0207671_1000304115 409
383 3300025918 Ga0207662_10010572 Ga0207662_100105725 409
384 3300025940 Ga0207691_10019869 Ga0207691_100198694 409
385 3300025942 Ga0207689_10004823 Ga0207689_100048235 409
386 3300026089 Ga0207648_10013956 Ga0207648_100139565 409
387 3300026095 Ga0207676_10233242 Ga0207676_102332422 409
388 3300026118 Ga0207675_100030061 Ga0207675_1000300613 409
389 3300026121 Ga0207683_10045855 Ga0207683_100458553 409
390 3300028381 Ga0268264_10182602 Ga0268264_101826021 409
391 3300049515 Ga0501292_001847 Ga0501292_001847_1034_2263 409
392 3300049649 Ga0501198_004717 Ga0501198_004717_430_1659 409
393 3300049663 Ga0501223_009239 Ga0501223_009239_379_1608 409
394 3300049679 Ga0501249_003852 Ga0501249_003852_1207_2436 409
395 3300050507 nmdc:mga05p37_105816_c1 nmdc:mga05p37_105816_c1_1154_2419 409
396 3300050510 nmdc:mga06r32_74883_c1 nmdc:mga06r32_74883_c1_1785_3080 409

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

98

273

0.87

PF07690

MFS_1

Major Facilitator Superfamily

60

315

0.86

PF07690

MFS_1

Major Facilitator Superfamily

276

455

0.83

PF12832

MFS_1_like

MFS_1 like family

70

430

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lz0-assembly1.cif.gz_A cryo-em structure of human mct1 in complex with basigin-2 in the presence of lactate 0.8654 10 396
6lyy-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate azd3965 in the outward-open conformation. 0.8533 15 395
6lz0-assembly1.cif.gz_A cryo-em structure of human mct1 in complex with basigin-2 in the presence of lactate 0.8419 10 396
7lo7-assembly1.cif.gz_Z nora in complex with fab25 0.8408 12 395
7ckr-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate bay-8002 in the outward-open conformation. 0.8401 14 395
ID Description Score Start End Superfamily
af_Q58713_262_398_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9728 261 395 1.20.1250.20
af_Q58713_262_398_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9452 261 395 1.20.1250.20
af_Q8BGC3_251_439_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9352 223 395 1.20.1250.20
af_E7FGJ9_372_605_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9263 223 395 1.20.1250.20
af_E7FB53_277_463_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9193 225 395 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2V8N916-F1-model_v4 MFS transporter 0.9871 4 358 GO:0016020
GO:0022857
AF-A0A842UZ45-F1-model_v4 MFS transporter 0.9775 13 399 GO:0016020
GO:0022857
AF-A0A523Z5U6-F1-model_v4 MFS transporter 0.9735 6 399 GO:0016020
GO:0022857
AF-A0A7C4U9G0-F1-model_v4 MFS transporter 0.9726 11 401 GO:0016020
GO:0022857
AF-A0A432IYQ6-F1-model_v4 MFS transporter 0.9699 4 398 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
90.5 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map