F433490

General Info

Members Datasets Scaffolds Average Seq Length
396 254 394 111

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_12315515|Ga0105240_123155151
Length 99
Sequence MRLVTGIIKPFKLDDVKAALESFGVAGITVSEVQGYGRQRGHTEVYRGAEYRVDFVPKVRVEVLVDSAATGKIGDGKVWVTPIDNVVRVRTGERGRDAL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
3 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
114 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
115 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
120 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
135 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
136 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
137 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
144 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
145 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
146 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
147 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
148 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
149 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
150 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
151 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
152 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
178 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
179 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
212 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
223 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
224 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
225 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
234 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
235 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
236 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
237 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.94
Metatranscriptomes 5.56
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.08
Nodule 0
Rhizoplane 3.03
Rhizosphere 84.85
Stem 0
Stem Tuber 0
Unclassified 4.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1282315 2162886007 Bacteria 2179
2 rootH1_10018086 3300003323 Bacteria 8267
3 JGI25405J52794_10081626 3300003911 Bacteria 712
4 Ga0058860_11632997 3300004801 Bacteria 567
5 Ga0065704_10125167 3300005289 Bacteria 1707
6 Ga0065707_10106596 3300005295 Bacteria 2589
7 Ga0070683_100625174 3300005329 Bacteria 1031
8 Ga0070690_100432836 3300005330 Bacteria 972
9 Ga0070677_10409498 3300005333 Bacteria 716
10 Ga0068869_100724660 3300005334 Bacteria 850
11 Ga0070687_100678225 3300005343 Bacteria 717
12 Ga0070673_100220080 3300005364 Bacteria 1643
13 Ga0070667_100206698 3300005367 Bacteria 1744
14 Ga0070667_100454224 3300005367 Bacteria 1171
15 Ga0070667_100662258 3300005367 Bacteria 964
16 Ga0070709_11302770 3300005434 Bacteria 586
17 Ga0070714_100076106 3300005435 Bacteria 2913
18 Ga0070713_100877443 3300005436 Bacteria 862
19 Ga0070710_10484616 3300005437 Bacteria 844
20 Ga0070705_100347625 3300005440 Bacteria 1080
21 Ga0070700_100248069 3300005441 Bacteria 1276
22 Ga0070700_101262729 3300005441 Bacteria 619
23 Ga0070708_100050199 3300005445 Bacteria 3693
24 Ga0070708_100372142 3300005445 Bacteria 1347
25 Ga0070708_100563006 3300005445 Bacteria 1075
26 Ga0070663_101470126 3300005455 Bacteria 605
27 Ga0070678_100155806 3300005456 Bacteria 1845
28 Ga0068867_100618453 3300005459 Bacteria 947
29 Ga0070706_100494920 3300005467 Bacteria 1138
30 Ga0070699_100549596 3300005518 Bacteria 1051
31 Ga0070699_100565014 3300005518 Bacteria 1036
32 Ga0070697_101875847 3300005536 Bacteria 536
33 Ga0070686_100746841 3300005544 Bacteria 784
34 Ga0070695_100212927 3300005545 Bacteria 1388
35 Ga0070695_100798722 3300005545 Bacteria 756
36 Ga0070696_101224250 3300005546 Bacteria 635
37 Ga0070665_101751481 3300005548 Bacteria 628
38 Ga0070664_100561528 3300005564 Bacteria 1056
39 Ga0070664_101569347 3300005564 Bacteria 623
40 Ga0068854_100485691 3300005578 Bacteria 1038
41 Ga0068856_100019411 3300005614 Bacteria 6597
42 Ga0070702_100089007 3300005615 Bacteria 1868
43 Ga0070702_101135673 3300005615 Bacteria 626
44 Ga0068859_101248013 3300005617 Bacteria 819
45 Ga0068864_101969316 3300005618 Bacteria 590
46 Ga0068861_100164918 3300005719 Bacteria 1831
47 Ga0068861_101272044 3300005719 Bacteria 714
48 Ga0068863_102497827 3300005841 Bacteria 526
49 Ga0068858_100000002 3300005842 Bacteria 351633
50 Ga0068858_101212077 3300005842 Bacteria 742
51 Ga0068860_102481997 3300005843 Bacteria 538
52 Ga0081455_10014949 3300005937 Bacteria 7561
53 Ga0075365_10002642 3300006038 Bacteria 8890
54 Ga0075365_10120478 3300006038 Bacteria 1809
55 Ga0075365_10241598 3300006038 Bacteria 1268
56 Ga0075365_10317669 3300006038 Bacteria 1097
57 Ga0075365_10875128 3300006038 Bacteria 633
58 Ga0075368_10177984 3300006042 Bacteria 896
59 Ga0075364_10746682 3300006051 Bacteria 667
60 Ga0075364_10864668 3300006051 Bacteria 616
61 Ga0075364_10918807 3300006051 Bacteria 596
62 Ga0075432_10235350 3300006058 Bacteria 738
63 Ga0075362_10138436 3300006177 Bacteria 1162
64 Ga0075367_10192634 3300006178 Bacteria 1272
65 Ga0075367_10597854 3300006178 Bacteria 701
66 Ga0097621_100861945 3300006237 Bacteria 842
67 Ga0075370_10340459 3300006353 Bacteria 895
68 Ga0075428_100239400 3300006844 Bacteria 1958
69 Ga0075428_100249478 3300006844 Bacteria 1913
70 Ga0075428_100583153 3300006844 Bacteria 1195
71 Ga0075428_101172679 3300006844 Bacteria 810
72 Ga0075430_100001313 3300006846 Bacteria 20062
73 Ga0075430_100117597 3300006846 Bacteria 2216
74 Ga0075430_100148565 3300006846 Bacteria 1951
75 Ga0075430_100598154 3300006846 Bacteria 910
76 Ga0075431_100000292 3300006847 Bacteria 39252
77 Ga0075431_100010793 3300006847 Bacteria 9186
78 Ga0075431_101192627 3300006847 Bacteria 724
79 Ga0075433_10332989 3300006852 Bacteria 1342
80 Ga0075429_100004169 3300006880 Bacteria 12374
81 Ga0075429_100004291 3300006880 Bacteria 12241
82 Ga0068865_101031092 3300006881 Bacteria 722
83 Ga0097620_101247955 3300006931 Bacteria 819
84 Ga0099794_10458912 3300007265 Bacteria 668
85 Ga0105250_10000004 3300009092 Bacteria 438653
86 Ga0105240_10468733 3300009093 Bacteria 1406
87 Ga0105240_10502129 3300009093 Bacteria 1348
88 Ga0105240_12315515 3300009093 Bacteria 556
89 Ga0111539_10002142 3300009094 Bacteria 26411
90 Ga0111539_10398739 3300009094 Bacteria 1602
91 Ga0105245_10003505 3300009098 Bacteria 14045
92 Ga0105245_10005851 3300009098 Bacteria 10797
93 Ga0105245_10919851 3300009098 Bacteria 917
94 Ga0105245_11191948 3300009098 Bacteria 809
95 Ga0105245_11551525 3300009098 Bacteria 714
96 Ga0114129_10000366 3300009147 Bacteria 52352
97 Ga0114129_11092191 3300009147 Bacteria 999
98 Ga0114129_13471764 3300009147 Bacteria 505
99 Ga0105243_12022679 3300009148 Bacteria 611
100 Ga0105242_10021921 3300009176 Bacteria 5019
101 Ga0105248_10021988 3300009177 Bacteria 7067
102 Ga0105237_10107232 3300009545 Bacteria 2785
103 Ga0105237_12124757 3300009545 Bacteria 571
104 Ga0105239_10930402 3300010375 Bacteria 998
105 Ga0105239_11650845 3300010375 Bacteria 741
106 Ga0105246_10368115 3300011119 Bacteria 1183
107 Ga0105246_10584592 3300011119 Bacteria 962
108 Ga0105246_11855164 3300011119 Bacteria 577
109 Ga0157324_1007227 3300012506 Bacteria 860
110 Ga0157378_10098584 3300013297 Bacteria 2665
111 Ga0157378_10140164 3300013297 Bacteria 2245
112 Ga0157378_10696891 3300013297 Bacteria 1035
113 Ga0157378_10820449 3300013297 Bacteria 957
114 Ga0157378_10898263 3300013297 Bacteria 916
115 Ga0157378_11151824 3300013297 Bacteria 814
116 Ga0157378_11941509 3300013297 Bacteria 638
117 Ga0163162_10433343 3300013306 Bacteria 1447
118 Ga0163162_10450628 3300013306 Bacteria 1419
119 Ga0163162_11584679 3300013306 Bacteria 747
120 Ga0157375_11035508 3300013308 Bacteria 959
121 Ga0163163_10030640 3300014325 Bacteria 5185
122 Ga0163163_10543691 3300014325 Bacteria 1224
123 Ga0157380_10561369 3300014326 Bacteria 1122
124 Ga0157380_10618167 3300014326 Bacteria 1075
125 Ga0157379_10000007 3300014968 Bacteria 142402
126 Ga0157379_10000021 3300014968 Bacteria 92053
127 Ga0157379_10128731 3300014968 Bacteria 2278
128 Ga0157379_10480838 3300014968 Bacteria 1149
129 Ga0157379_11839934 3300014968 Bacteria 596
130 Ga0157376_10390534 3300014969 Bacteria 1343
131 Ga0157376_10391056 3300014969 Bacteria 1342
132 Ga0163161_10609770 3300017792 Bacteria 901
133 Ga0213874_10147310 3300021377 Bacteria 819
134 Ga0213876_10032053 3300021384 Bacteria 2773
135 Ga0207696_1000056 3300025711 Bacteria 251959
136 Ga0207682_10316506 3300025893 Bacteria 733
137 Ga0207642_10712331 3300025899 Bacteria 633
138 Ga0207680_10557644 3300025903 Bacteria 818
139 Ga0207699_11104889 3300025906 Bacteria 587
140 Ga0207643_10325568 3300025908 Bacteria 961
141 Ga0207684_10464268 3300025910 Bacteria 1086
142 Ga0207695_10442587 3300025913 Bacteria 1183
143 Ga0207671_11452086 3300025914 Bacteria 531
144 Ga0207660_11703606 3300025917 Bacteria 507
145 Ga0207662_10212886 3300025918 Bacteria 1255
146 Ga0207694_10043599 3300025924 Bacteria 3463
147 Ga0207659_10419531 3300025926 Bacteria 1122
148 Ga0207659_10533139 3300025926 Bacteria 996
149 Ga0207687_10002124 3300025927 Bacteria 13528
150 Ga0207687_10019573 3300025927 Bacteria 4486
151 Ga0207700_11685156 3300025928 Bacteria 559
152 Ga0207664_10064986 3300025929 Bacteria 2920
153 Ga0207644_11216922 3300025931 Bacteria 633
154 Ga0207709_10077303 3300025935 Bacteria 2133
155 Ga0207711_10008431 3300025941 Bacteria 8619
156 Ga0207711_11315542 3300025941 Bacteria 665
157 Ga0207667_10006356 3300025949 Bacteria 14323
158 Ga0207667_10764445 3300025949 Bacteria 965
159 Ga0207651_10064899 3300025960 Bacteria 2558
160 Ga0207658_10235105 3300025986 Bacteria 1549
161 Ga0207658_10492959 3300025986 Bacteria 1090
162 Ga0207677_10425652 3300026023 Bacteria 1132
163 Ga0207703_10000001 3300026035 Bacteria 822925
164 Ga0207708_10016842 3300026075 Bacteria 5502
165 Ga0207708_10191182 3300026075 Bacteria 1629
166 Ga0207702_10069757 3300026078 Bacteria 3023
167 Ga0207648_10108487 3300026089 Bacteria 2437
168 Ga0207648_11507508 3300026089 Bacteria 632
169 Ga0207648_11592610 3300026089 Bacteria 614
170 Ga0207676_11641224 3300026095 Bacteria 641
171 Ga0207683_10159234 3300026121 Bacteria 2040
172 Ga0207683_10195206 3300026121 Bacteria 1839
173 Ga0207683_10743532 3300026121 Bacteria 910
174 Ga0207428_10305966 3300027907 Bacteria 1176
175 Ga0207428_10878801 3300027907 Bacteria 634
176 Ga0268264_10408555 3300028381 Bacteria 1306
177 Ga0268264_11125549 3300028381 Bacteria 794
178 Ga0265334_10186111 3300028573 Bacteria 724
179 Ga0265320_10054872 3300031240 Bacteria 1921
180 Ga0265320_10510138 3300031240 Bacteria 531
181 Ga0265329_10242271 3300031242 Bacteria 600
182 Ga0265327_10147998 3300031251 Bacteria 1092
183 Ga0316579_10256840 3300031691 Bacteria 845
184 Ga0265314_10287813 3300031711 Bacteria 927
185 Ga0316576_10048867 3300031727 Bacteria 3070
186 Ga0316576_10708220 3300031727 Bacteria 729
187 Ga0316578_10196387 3300031728 Bacteria 1215
188 Ga0307405_10050118 3300031731 Bacteria 2584
189 Ga0316577_10282862 3300031733 Bacteria 939
190 Ga0307413_10215643 3300031824 Bacteria 1398
191 Ga0307410_10215479 3300031852 Bacteria 1474
192 Ga0307410_11704447 3300031852 Bacteria 558
193 Ga0307406_10412744 3300031901 Bacteria 1073
194 Ga0307406_10817749 3300031901 Bacteria 787
195 Ga0307407_11652755 3300031903 Bacteria 509
196 Ga0307412_10230714 3300031911 Bacteria 1425
197 Ga0307409_100011772 3300031995 Bacteria 5537
198 Ga0307409_100787756 3300031995 Bacteria 957
199 Ga0307416_100393826 3300032002 Bacteria 1420
200 Ga0307416_101720901 3300032002 Bacteria 731
201 Ga0307416_102583774 3300032002 Bacteria 606
202 Ga0307414_10502653 3300032004 Bacteria 1073
203 Ga0307411_10221184 3300032005 Bacteria 1469
204 Ga0307415_100030000 3300032126 Bacteria 3483
205 Ga0307415_100873002 3300032126 Bacteria 827
206 Ga0307510_10354426 3300033180 Bacteria 917
207 Ga0373950_0039393 3300034818 Bacteria 900
208 Ga0373934_0457845 3300035086 Bacteria 535
209 Ga0373961_0087161 3300035241 Bacteria 991
210 Ga0316574_0000037 3300035398 Bacteria 32045
211 Ga0316574_0410235 3300035398 Bacteria 852
212 Ga0373947_0369970 3300035725 Bacteria 964
213 Ga0373937_0076990 3300036401 Bacteria 3082
214 Ga0316582_1094989 3300036647 Bacteria 543
215 Ga0436365_0403426 3300039437 Bacteria 1083
216 Ga0436365_1030136 3300039437 Bacteria 710
217 Ga0436363_0915075 3300039450 Bacteria 819
218 Ga0451797_1487861 3300041453 Bacteria 2079
219 Ga0451802_0340793 3300041460 Bacteria 585
220 Ga0451835_0776476 3300041492 Bacteria 1076
221 Ga0451837_0076459 3300041494 Bacteria 887
222 Ga0451841_0229688 3300041498 Bacteria 1745
223 Ga0451843_0722448 3300041509 Bacteria 2418
224 Ga0451843_1718143 3300041509 Bacteria 1096
225 Ga0439445_0172494 3300042004 Bacteria 634
226 Ga0450898_023279 3300042134 Bacteria 1101
227 Ga0451577_0142153 3300042876 Bacteria 2157
228 Ga0451577_0981309 3300042876 Bacteria 759
229 Ga0439440_0132290 3300042993 Bacteria 703
230 Ga0466965_0466313 3300044683 Bacteria 705
231 Ga0466966_0076131 3300044684 Bacteria 2096
232 Ga0466963_0496223 3300044694 Bacteria 862
233 Ga0453684_0254874 3300044712 Bacteria 2013
234 Ga0453684_1925324 3300044712 Bacteria 597
235 Ga0466957_0365428 3300044842 Bacteria 981
236 Ga0466957_0568448 3300044842 Bacteria 791
237 Ga0466959_0086141 3300045049 Bacteria 2260
238 Ga0451576_0070940 3300045051 Bacteria 3626
239 Ga0466967_0026267 3300045976 Bacteria 4820
240 Ga0495592_0364709 3300046454 Bacteria 923
241 Ga0495592_0917708 3300046454 Bacteria 514
242 Ga0495603_0028977 3300046455 Bacteria 3340
243 Ga0495603_0378120 3300046455 Bacteria 812
244 Ga0495641_0101754 3300046461 Bacteria 1282
245 Ga0495641_0555568 3300046461 Bacteria 524
246 Ga0495639_0431364 3300046475 Bacteria 668
247 Ga0495594_0165580 3300046499 Bacteria 1257
248 Ga0495608_0129825 3300046511 Bacteria 1613
249 Ga0495618_0269781 3300046514 Bacteria 1064
250 Ga0495628_0387260 3300046516 Bacteria 1023
251 Ga0495630_1102130 3300046517 Bacteria 602
252 Ga0495652_0688088 3300046529 Bacteria 689
253 Ga0495640_0312816 3300046533 Bacteria 973
254 Ga0495586_0423242 3300046535 Bacteria 767
255 Ga0495622_0114607 3300046557 Bacteria 1233
256 Ga0495622_0306226 3300046557 Bacteria 692
257 Ga0495667_0113728 3300046559 Bacteria 1749
258 Ga0495634_0857767 3300046642 Bacteria 515
259 Ga0495635_0278971 3300046663 Bacteria 1123
260 Ga0495647_0128415 3300046681 Bacteria 1072
261 Ga0495624_0232434 3300046690 Bacteria 1117
262 Ga0495589_0477493 3300046794 Bacteria 570
263 Ga0495604_0952970 3300047317 Bacteria 534
264 Ga0495674_0842913 3300047319 Bacteria 711
265 Ga0495674_0921831 3300047319 Bacteria 673
266 Ga0495672_0072375 3300047320 Bacteria 1947
267 Ga0495672_0499779 3300047320 Bacteria 541
268 Ga0495676_0526667 3300047321 Bacteria 774
269 Ga0495680_0115478 3300047322 Bacteria 1986
270 Ga0495614_0129553 3300048089 Bacteria 1116
271 Ga0496100_1254648 3300048903 Bacteria 585
272 Ga0496104_0617491 3300048907 Bacteria 994
273 Ga0496105_0685428 3300048908 Bacteria 788
274 Ga0496106_0507836 3300048909 Bacteria 968
275 Ga0496108_0897407 3300048911 Bacteria 761
276 Ga0496110_0787994 3300048913 Bacteria 855
277 Ga0496112_0747657 3300048915 Bacteria 904
278 Ga0496113_0217056 3300048916 Bacteria 1524
279 Ga0496114_0235876 3300048917 Bacteria 1608
280 Ga0496115_1243867 3300048918 Bacteria 557
281 Ga0496126_0000007 3300048929 Bacteria 787364
282 Ga0501316_002380 3300049532 Bacteria 1739
283 Ga0501317_027514 3300049533 Bacteria 808
284 Ga0501032_0011963 3300049569 Bacteria 6215
285 Ga0501032_0946896 3300049569 Bacteria 542
286 Ga0501033_0001699 3300049570 Bacteria 19265
287 Ga0501033_0008640 3300049570 Bacteria 7883
288 Ga0501033_0011945 3300049570 Bacteria 6635
289 Ga0501033_0129765 3300049570 Bacteria 1827
290 Ga0501034_0000257 3300049571 Bacteria 96799
291 Ga0501034_0000523 3300049571 Bacteria 61646
292 Ga0501034_0001758 3300049571 Bacteria 27750
293 Ga0501034_0014003 3300049571 Bacteria 8255
294 Ga0501034_0055774 3300049571 Bacteria 3976
295 Ga0501034_0059574 3300049571 Bacteria 3835
296 Ga0501036_0201115 3300049572 Bacteria 1675
297 Ga0501036_0751777 3300049572 Bacteria 804
298 Ga0501037_0104304 3300049573 Bacteria 2044
299 Ga0501038_0052380 3300049574 Bacteria 3519
300 Ga0501039_0144341 3300049575 Bacteria 1870
301 Ga0501042_0870470 3300049578 Bacteria 656
302 Ga0501043_0009847 3300049579 Bacteria 7494
303 Ga0501043_0650777 3300049579 Bacteria 774
304 Ga0501043_1193395 3300049579 Bacteria 535
305 Ga0501046_0767076 3300049580 Bacteria 677
306 Ga0501047_0101019 3300049581 Bacteria 2764
307 Ga0501067_0006233 3300049583 Bacteria 6614
308 Ga0501067_0201597 3300049583 Bacteria 1108
309 Ga0501067_0533619 3300049583 Bacteria 657
310 Ga0501067_0745484 3300049583 Bacteria 551
311 Ga0501068_0000191 3300049584 Bacteria 28943
312 Ga0501068_0002466 3300049584 Bacteria 9824
313 Ga0501068_0131873 3300049584 Bacteria 1563
314 Ga0501068_0160821 3300049584 Bacteria 1415
315 Ga0501069_0014151 3300049585 Bacteria 4260
316 Ga0501069_0095910 3300049585 Bacteria 1680
317 Ga0501070_0007432 3300049586 Bacteria 9304
318 Ga0501070_0043057 3300049586 Bacteria 3758
319 Ga0501070_0311185 3300049586 Bacteria 1282
320 Ga0501070_0537208 3300049586 Bacteria 937
321 Ga0501070_1040872 3300049586 Bacteria 633
322 Ga0501071_0592774 3300049587 Bacteria 852
323 Ga0501071_1299095 3300049587 Bacteria 562
324 Ga0501072_0002518 3300049588 Bacteria 13723
325 Ga0501072_0038772 3300049588 Bacteria 3739
326 Ga0501072_0501773 3300049588 Bacteria 960
327 Ga0501073_0000071 3300049589 Bacteria 62958
328 Ga0501073_0019137 3300049589 Bacteria 4947
329 Ga0501074_0000174 3300049590 Bacteria 34633
330 Ga0501074_0007811 3300049590 Bacteria 7745
331 Ga0501074_0041157 3300049590 Bacteria 3346
332 Ga0501074_1303468 3300049590 Bacteria 509
333 Ga0501080_0007867 3300049742 Bacteria 9647
334 Ga0501080_0046898 3300049742 Bacteria 4022
335 Ga0501080_0249924 3300049742 Bacteria 1617
336 Ga0501080_0875429 3300049742 Bacteria 784
337 Ga0501080_0991962 3300049742 Bacteria 729
338 Ga0501083_0027796 3300049744 Bacteria 3901
339 Ga0501035_1365763 3300049822 Bacteria 544
340 Ga0501044_0001601 3300049823 Bacteria 26470
341 Ga0501044_0026709 3300049823 Bacteria 6110
342 nmdc:mga03683_65165_c2 3300050489 Bacteria 1163
343 nmdc:mga00v17_567965_c1 3300050491 Bacteria 733
344 nmdc:mga0yw44_10710_c1 3300050492 Bacteria 4696
345 nmdc:mga0yw44_137615_c1 3300050492 Bacteria 1585
346 nmdc:mga0yw44_167795_c1 3300050492 Bacteria 1440
347 nmdc:mga0yw44_1929_c1 3300050492 Bacteria 8577
348 nmdc:mga0yw44_221552_c1 3300050492 Bacteria 1254
349 nmdc:mga0yw44_432079_c1 3300050492 Bacteria 892
350 nmdc:mga0yw44_702293_c1 3300050492 Bacteria 687
351 nmdc:mga0yw44_9835_c1 3300050492 Bacteria 4856
352 nmdc:mga06z11_171144_c1 3300050494 Bacteria 1247
353 nmdc:mga06z11_534698_c1 3300050494 Bacteria 711
354 nmdc:mga07m45_820183_c1 3300050496 Bacteria 533
355 nmdc:mga05p37_1911_c1 3300050507 Bacteria 24238
356 nmdc:mga05p37_65846_c1 3300050507 Bacteria 4457
357 nmdc:mga09592_202596_c1 3300050508 Bacteria 1719
358 nmdc:mga09592_5931_c1 3300050508 Bacteria 9958
359 nmdc:mga0qj67_1575_c1 3300050509 Bacteria 16033
360 nmdc:mga0qj67_520222_c1 3300050509 Bacteria 956
361 nmdc:mga0qj67_652133_c1 3300050509 Bacteria 840
362 nmdc:mga0qj67_8501_c1 3300050509 Bacteria 7617
363 nmdc:mga06r32_1148480_c1 3300050510 Bacteria 724
364 nmdc:mga06r32_1365_c1 3300050510 Bacteria 22070
365 nmdc:mga06r32_48806_c1 3300050510 Bacteria 4048
366 nmdc:mga08y16_411952_c1 3300050511 Bacteria 1382
367 nmdc:mga08y16_84531_c1 3300050511 Bacteria 3308
368 nmdc:mga0a205_57874_c2 3300050515 Bacteria 1905
369 Ga0495612_0299045 3300053078 Bacteria 722
370 Ga0500566_0000154 3300053094 Bacteria 35104
371 Ga0500568_0062982 3300053139 Bacteria 1431
372 Ga0500568_0103459 3300053139 Bacteria 1067
373 Ga0500616_0000141 3300053153 Bacteria 122164
374 Ga0500616_0000200 3300053153 Bacteria 97730
375 Ga0500616_0176630 3300053153 Bacteria 965
376 Ga0587093_019435 3300059478 Bacteria 895
377 Ga0587073_0007277 3300059492 Bacteria 1742
378 Ga0587083_0077781 3300059505 Bacteria 784
379 Ga0587085_007336 3300059506 Bacteria 1373
380 Ga0587088_004738 3300059508 Bacteria 1745
381 Ga0587094_009746 3300059513 Bacteria 1233
382 Ga0587129_000524 3300059608 Bacteria 1750
383 Ga0587113_001046 3300059625 Bacteria 1723
384 Ga0587115_002952 3300059626 Bacteria 1746
385 Ga0587117_008350 3300059627 Bacteria 1213
386 Ga0587128_003484 3300059630 Bacteria 1749
387 Ga0587128_019874 3300059630 Bacteria 1021
388 Ga0587130_005159 3300059631 Bacteria 1163
389 Ga0587072_056132 3300059643 Bacteria 801
390 Ga0587075_009374 3300059644 Bacteria 1274
391 Ga0587076_158886 3300059645 Bacteria 554
392 Ga0587102_001229 3300059649 Bacteria 1740
393 Ga0587120_018495 3300059659 Bacteria 649
394 Ga0587071_060751 3300060344 Bacteria 803

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_12315515 Ga0105240_123155151 99
2 3300010375 Ga0105239_11650845 Ga0105239_116508452 99
3 3300025949 Ga0207667_10764445 Ga0207667_107644451 99
4 3300044694 Ga0466963_0496223 Ga0466963_0496223_489_827 99
5 3300044842 Ga0466957_0365428 Ga0466957_0365428_66_404 99
6 3300045976 Ga0466967_0026267 Ga0466967_0026267_3085_3423 99
7 3300048929 Ga0496126_0000007 Ga0496126_0000007_744707_745045 99
8 3300059478 Ga0587093_019435 Ga0587093_019435_54_392 99
9 3300059492 Ga0587073_0007277 Ga0587073_0007277_55_393 99
10 3300059505 Ga0587083_0077781 Ga0587083_0077781_407_745 99
11 3300059506 Ga0587085_007336 Ga0587085_007336_996_1334 99
12 3300059508 Ga0587088_004738 Ga0587088_004738_1368_1706 99
13 3300059513 Ga0587094_009746 Ga0587094_009746_849_1187 99
14 3300059608 Ga0587129_000524 Ga0587129_000524_1373_1711 99
15 3300059625 Ga0587113_001046 Ga0587113_001046_44_382 99
16 3300059626 Ga0587115_002952 Ga0587115_002952_40_378 99
17 3300059627 Ga0587117_008350 Ga0587117_008350_836_1174 99
18 3300059630 Ga0587128_003484 Ga0587128_003484_40_378 99
19 3300059630 Ga0587128_019874 Ga0587128_019874_672_1010 99
20 3300059631 Ga0587130_005159 Ga0587130_005159_44_382 99
21 3300059643 Ga0587072_056132 Ga0587072_056132_426_764 99
22 3300059644 Ga0587075_009374 Ga0587075_009374_897_1235 99
23 3300059649 Ga0587102_001229 Ga0587102_001229_1365_1703 99
24 3300059659 Ga0587120_018495 Ga0587120_018495_280_618 99
25 3300060344 Ga0587071_060751 Ga0587071_060751_426_764 99
26 3300047321 Ga0495676_0526667 Ga0495676_0526667_50_379 102
27 3300053139 Ga0500568_0103459 Ga0500568_0103459_63_401 103
28 3300053153 Ga0500616_0000141 Ga0500616_0000141_29480_29818 103
29 3300004801 Ga0058860_11632997 Ga0058860_116329971 105
30 3300005364 Ga0070673_100220080 Ga0070673_1002200802 105
31 3300013306 Ga0163162_11584679 Ga0163162_115846792 105
32 3300025960 Ga0207651_10064899 Ga0207651_100648992 105
33 3300026121 Ga0207683_10159234 Ga0207683_101592342 105
34 3300035086 Ga0373934_0457845 Ga0373934_0457845_38_379 105
35 3300035725 Ga0373947_0369970 Ga0373947_0369970_462_803 105
36 3300046475 Ga0495639_0431364 Ga0495639_0431364_312_653 105
37 3300046511 Ga0495608_0129825 Ga0495608_0129825_105_446 105
38 3300046517 Ga0495630_1102130 Ga0495630_1102130_134_475 105
39 3300046559 Ga0495667_0113728 Ga0495667_0113728_1322_1663 105
40 3300046642 Ga0495634_0857767 Ga0495634_0857767_53_394 105
41 3300046681 Ga0495647_0128415 Ga0495647_0128415_280_621 105
42 3300046690 Ga0495624_0232434 Ga0495624_0232434_333_674 105
43 3300047317 Ga0495604_0952970 Ga0495604_0952970_76_417 105
44 3300047319 Ga0495674_0842913 Ga0495674_0842913_77_418 105
45 3300048089 Ga0495614_0129553 Ga0495614_0129553_597_938 105
46 3300048916 Ga0496113_0217056 Ga0496113_0217056_488_829 105
47 iso_pu_bacteria 2643221601 2644015901 108
48 iso_pu_bacteria 2643221631 2644176418 108
49 3300009093 Ga0105240_10468733 Ga0105240_104687331 109
50 2162886007 SwRhRL2b_contig_1282315 SwRhRL2b_0352.00003590 112
51 3300003323 rootH1_10018086 rootH1_100180869 112
52 3300003911 JGI25405J52794_10081626 JGI25405J52794_100816262 112
53 3300005289 Ga0065704_10125167 Ga0065704_101251672 112
54 3300005295 Ga0065707_10106596 Ga0065707_101065964 112
55 3300005329 Ga0070683_100625174 Ga0070683_1006251742 112
56 3300005330 Ga0070690_100432836 Ga0070690_1004328362 112
57 3300005333 Ga0070677_10409498 Ga0070677_104094982 112
58 3300005334 Ga0068869_100724660 Ga0068869_1007246602 112
59 3300005343 Ga0070687_100678225 Ga0070687_1006782251 112
60 3300005367 Ga0070667_100206698 Ga0070667_1002066982 112
61 3300005367 Ga0070667_100454224 Ga0070667_1004542242 112
62 3300005367 Ga0070667_100662258 Ga0070667_1006622582 112
63 3300005434 Ga0070709_11302770 Ga0070709_113027701 112
64 3300005435 Ga0070714_100076106 Ga0070714_1000761062 112
65 3300005436 Ga0070713_100877443 Ga0070713_1008774432 112
66 3300005437 Ga0070710_10484616 Ga0070710_104846161 112
67 3300005440 Ga0070705_100347625 Ga0070705_1003476252 112
68 3300005441 Ga0070700_100248069 Ga0070700_1002480691 112
69 3300005441 Ga0070700_101262729 Ga0070700_1012627291 112
70 3300005445 Ga0070708_100050199 Ga0070708_1000501994 112
71 3300005445 Ga0070708_100372142 Ga0070708_1003721422 112
72 3300005445 Ga0070708_100563006 Ga0070708_1005630062 112
73 3300005455 Ga0070663_101470126 Ga0070663_1014701261 112
74 3300005456 Ga0070678_100155806 Ga0070678_1001558062 112
75 3300005459 Ga0068867_100618453 Ga0068867_1006184532 112
76 3300005467 Ga0070706_100494920 Ga0070706_1004949202 112
77 3300005518 Ga0070699_100549596 Ga0070699_1005495962 112
78 3300005518 Ga0070699_100565014 Ga0070699_1005650142 112
79 3300005536 Ga0070697_101875847 Ga0070697_1018758472 112
80 3300005544 Ga0070686_100746841 Ga0070686_1007468412 112
81 3300005545 Ga0070695_100212927 Ga0070695_1002129271 112
82 3300005545 Ga0070695_100798722 Ga0070695_1007987222 112
83 3300005546 Ga0070696_101224250 Ga0070696_1012242501 112
84 3300005548 Ga0070665_101751481 Ga0070665_1017514811 112
85 3300005564 Ga0070664_100561528 Ga0070664_1005615282 112
86 3300005564 Ga0070664_101569347 Ga0070664_1015693471 112
87 3300005578 Ga0068854_100485691 Ga0068854_1004856912 112
88 3300005614 Ga0068856_100019411 Ga0068856_1000194116 112
89 3300005615 Ga0070702_100089007 Ga0070702_1000890072 112
90 3300005615 Ga0070702_101135673 Ga0070702_1011356731 112
91 3300005617 Ga0068859_101248013 Ga0068859_1012480132 112
92 3300005618 Ga0068864_101969316 Ga0068864_1019693162 112
93 3300005719 Ga0068861_100164918 Ga0068861_1001649182 112
94 3300005719 Ga0068861_101272044 Ga0068861_1012720441 112
95 3300005841 Ga0068863_102497827 Ga0068863_1024978272 112
96 3300005842 Ga0068858_100000002 Ga0068858_100000002264 112
97 3300005842 Ga0068858_101212077 Ga0068858_1012120771 112
98 3300005843 Ga0068860_102481997 Ga0068860_1024819971 112
99 3300005937 Ga0081455_10014949 Ga0081455_100149494 112
100 3300006038 Ga0075365_10002642 Ga0075365_100026426 112
101 3300006038 Ga0075365_10120478 Ga0075365_101204783 112
102 3300006038 Ga0075365_10241598 Ga0075365_102415982 112
103 3300006038 Ga0075365_10317669 Ga0075365_103176692 112
104 3300006038 Ga0075365_10875128 Ga0075365_108751282 112
105 3300006042 Ga0075368_10177984 Ga0075368_101779842 112
106 3300006051 Ga0075364_10746682 Ga0075364_107466821 112
107 3300006051 Ga0075364_10864668 Ga0075364_108646682 112
108 3300006051 Ga0075364_10918807 Ga0075364_109188072 112
109 3300006058 Ga0075432_10235350 Ga0075432_102353502 112
110 3300006177 Ga0075362_10138436 Ga0075362_101384363 112
111 3300006178 Ga0075367_10192634 Ga0075367_101926343 112
112 3300006178 Ga0075367_10597854 Ga0075367_105978541 112
113 3300006237 Ga0097621_100861945 Ga0097621_1008619452 112
114 3300006353 Ga0075370_10340459 Ga0075370_103404592 112
115 3300006844 Ga0075428_100239400 Ga0075428_1002394002 112
116 3300006844 Ga0075428_100249478 Ga0075428_1002494782 112
117 3300006844 Ga0075428_100583153 Ga0075428_1005831532 112
118 3300006844 Ga0075428_101172679 Ga0075428_1011726792 112
119 3300006846 Ga0075430_100001313 Ga0075430_10000131310 112
120 3300006846 Ga0075430_100117597 Ga0075430_1001175973 112
121 3300006846 Ga0075430_100148565 Ga0075430_1001485652 112
122 3300006846 Ga0075430_100598154 Ga0075430_1005981542 112
123 3300006847 Ga0075431_100000292 Ga0075431_10000029234 112
124 3300006847 Ga0075431_100010793 Ga0075431_1000107932 112
125 3300006847 Ga0075431_101192627 Ga0075431_1011926271 112
126 3300006852 Ga0075433_10332989 Ga0075433_103329893 112
127 3300006880 Ga0075429_100004169 Ga0075429_1000041695 112
128 3300006880 Ga0075429_100004291 Ga0075429_1000042911 112
129 3300006881 Ga0068865_101031092 Ga0068865_1010310922 112
130 3300006931 Ga0097620_101247955 Ga0097620_1012479552 112
131 3300007265 Ga0099794_10458912 Ga0099794_104589122 112
132 3300009092 Ga0105250_10000004 Ga0105250_1000000436 112
133 3300009093 Ga0105240_10502129 Ga0105240_105021293 112
134 3300009094 Ga0111539_10002142 Ga0111539_1000214213 112
135 3300009094 Ga0111539_10398739 Ga0111539_103987392 112
136 3300009098 Ga0105245_10003505 Ga0105245_1000350518 112
137 3300009098 Ga0105245_10005851 Ga0105245_100058516 112
138 3300009098 Ga0105245_10919851 Ga0105245_109198512 112
139 3300009098 Ga0105245_11191948 Ga0105245_111919482 112
140 3300009098 Ga0105245_11551525 Ga0105245_115515251 112
141 3300009147 Ga0114129_10000366 Ga0114129_1000036612 112
142 3300009147 Ga0114129_11092191 Ga0114129_110921911 112
143 3300009147 Ga0114129_13471764 Ga0114129_134717641 112
144 3300009148 Ga0105243_12022679 Ga0105243_120226791 112
145 3300009176 Ga0105242_10021921 Ga0105242_100219213 112
146 3300009177 Ga0105248_10021988 Ga0105248_100219882 112
147 3300009545 Ga0105237_10107232 Ga0105237_101072325 112
148 3300009545 Ga0105237_12124757 Ga0105237_121247572 112
149 3300010375 Ga0105239_10930402 Ga0105239_109304022 112
150 3300011119 Ga0105246_10368115 Ga0105246_103681153 112
151 3300011119 Ga0105246_10584592 Ga0105246_105845922 112
152 3300011119 Ga0105246_11855164 Ga0105246_118551642 112
153 3300012506 Ga0157324_1007227 Ga0157324_10072271 112
154 3300013297 Ga0157378_10098584 Ga0157378_100985842 112
155 3300013297 Ga0157378_10140164 Ga0157378_101401642 112
156 3300013297 Ga0157378_10696891 Ga0157378_106968912 112
157 3300013297 Ga0157378_10820449 Ga0157378_108204491 112
158 3300013297 Ga0157378_10898263 Ga0157378_108982632 112
159 3300013297 Ga0157378_11151824 Ga0157378_111518242 112
160 3300013297 Ga0157378_11941509 Ga0157378_119415091 112
161 3300013306 Ga0163162_10433343 Ga0163162_104333432 112
162 3300013306 Ga0163162_10450628 Ga0163162_104506282 112
163 3300013308 Ga0157375_11035508 Ga0157375_110355082 112
164 3300014325 Ga0163163_10030640 Ga0163163_100306401 112
165 3300014325 Ga0163163_10543691 Ga0163163_105436912 112
166 3300014326 Ga0157380_10561369 Ga0157380_105613692 112
167 3300014326 Ga0157380_10618167 Ga0157380_106181672 112
168 3300014968 Ga0157379_10000007 Ga0157379_1000000753 112
169 3300014968 Ga0157379_10000021 Ga0157379_1000002169 112
170 3300014968 Ga0157379_10128731 Ga0157379_101287314 112
171 3300014968 Ga0157379_10480838 Ga0157379_104808382 112
172 3300014968 Ga0157379_11839934 Ga0157379_118399341 112
173 3300014969 Ga0157376_10390534 Ga0157376_103905342 112
174 3300014969 Ga0157376_10391056 Ga0157376_103910562 112
175 3300017792 Ga0163161_10609770 Ga0163161_106097702 112
176 3300021377 Ga0213874_10147310 Ga0213874_101473102 112
177 3300021384 Ga0213876_10032053 Ga0213876_100320532 112
178 3300025711 Ga0207696_1000056 Ga0207696_100005636 112
179 3300025893 Ga0207682_10316506 Ga0207682_103165062 112
180 3300025899 Ga0207642_10712331 Ga0207642_107123312 112
181 3300025903 Ga0207680_10557644 Ga0207680_105576442 112
182 3300025906 Ga0207699_11104889 Ga0207699_111048892 112
183 3300025908 Ga0207643_10325568 Ga0207643_103255682 112
184 3300025910 Ga0207684_10464268 Ga0207684_104642682 112
185 3300025913 Ga0207695_10442587 Ga0207695_104425872 112
186 3300025914 Ga0207671_11452086 Ga0207671_114520861 112
187 3300025917 Ga0207660_11703606 Ga0207660_117036061 112
188 3300025918 Ga0207662_10212886 Ga0207662_102128862 112
189 3300025924 Ga0207694_10043599 Ga0207694_100435993 112
190 3300025926 Ga0207659_10419531 Ga0207659_104195312 112
191 3300025926 Ga0207659_10533139 Ga0207659_105331392 112
192 3300025927 Ga0207687_10002124 Ga0207687_1000212418 112
193 3300025927 Ga0207687_10019573 Ga0207687_100195735 112
194 3300025928 Ga0207700_11685156 Ga0207700_116851562 112
195 3300025929 Ga0207664_10064986 Ga0207664_100649862 112
196 3300025931 Ga0207644_11216922 Ga0207644_112169221 112
197 3300025935 Ga0207709_10077303 Ga0207709_100773032 112
198 3300025941 Ga0207711_10008431 Ga0207711_100084312 112
199 3300025941 Ga0207711_11315542 Ga0207711_113155421 112
200 3300025949 Ga0207667_10006356 Ga0207667_1000635614 112
201 3300025986 Ga0207658_10235105 Ga0207658_102351051 112
202 3300025986 Ga0207658_10492959 Ga0207658_104929592 112
203 3300026023 Ga0207677_10425652 Ga0207677_104256522 112
204 3300026035 Ga0207703_10000001 Ga0207703_10000001507 112
205 3300026075 Ga0207708_10016842 Ga0207708_100168422 112
206 3300026075 Ga0207708_10191182 Ga0207708_101911822 112
207 3300026078 Ga0207702_10069757 Ga0207702_100697572 112
208 3300026089 Ga0207648_10108487 Ga0207648_101084872 112
209 3300026089 Ga0207648_11507508 Ga0207648_115075081 112
210 3300026089 Ga0207648_11592610 Ga0207648_115926101 112
211 3300026095 Ga0207676_11641224 Ga0207676_116412242 112
212 3300026121 Ga0207683_10195206 Ga0207683_101952062 112
213 3300026121 Ga0207683_10743532 Ga0207683_107435321 112
214 3300027907 Ga0207428_10305966 Ga0207428_103059663 112
215 3300027907 Ga0207428_10878801 Ga0207428_108788011 112
216 3300028381 Ga0268264_10408555 Ga0268264_104085552 112
217 3300028381 Ga0268264_11125549 Ga0268264_111255492 112
218 3300028573 Ga0265334_10186111 Ga0265334_101861112 112
219 3300031240 Ga0265320_10054872 Ga0265320_100548723 112
220 3300031240 Ga0265320_10510138 Ga0265320_105101381 112
221 3300031242 Ga0265329_10242271 Ga0265329_102422711 112
222 3300031251 Ga0265327_10147998 Ga0265327_101479982 112
223 3300031691 Ga0316579_10256840 Ga0316579_102568401 112
224 3300031711 Ga0265314_10287813 Ga0265314_102878131 112
225 3300031727 Ga0316576_10048867 Ga0316576_100488673 112
226 3300031727 Ga0316576_10708220 Ga0316576_107082201 112
227 3300031728 Ga0316578_10196387 Ga0316578_101963872 112
228 3300031731 Ga0307405_10050118 Ga0307405_100501183 112
229 3300031733 Ga0316577_10282862 Ga0316577_102828622 112
230 3300031824 Ga0307413_10215643 Ga0307413_102156432 112
231 3300031852 Ga0307410_10215479 Ga0307410_102154792 112
232 3300031852 Ga0307410_11704447 Ga0307410_117044472 112
233 3300031901 Ga0307406_10412744 Ga0307406_104127442 112
234 3300031901 Ga0307406_10817749 Ga0307406_108177492 112
235 3300031903 Ga0307407_11652755 Ga0307407_116527551 112
236 3300031911 Ga0307412_10230714 Ga0307412_102307142 112
237 3300031995 Ga0307409_100011772 Ga0307409_1000117723 112
238 3300031995 Ga0307409_100787756 Ga0307409_1007877562 112
239 3300032002 Ga0307416_100393826 Ga0307416_1003938262 112
240 3300032002 Ga0307416_101720901 Ga0307416_1017209012 112
241 3300032002 Ga0307416_102583774 Ga0307416_1025837741 112
242 3300032004 Ga0307414_10502653 Ga0307414_105026532 112
243 3300032005 Ga0307411_10221184 Ga0307411_102211842 112
244 3300032126 Ga0307415_100030000 Ga0307415_1000300003 112
245 3300032126 Ga0307415_100873002 Ga0307415_1008730021 112
246 3300033180 Ga0307510_10354426 Ga0307510_103544262 112
247 3300034818 Ga0373950_0039393 Ga0373950_0039393_260_598 112
248 3300035241 Ga0373961_0087161 Ga0373961_0087161_546_884 112
249 3300035398 Ga0316574_0000037 Ga0316574_0000037_12920_13258 112
250 3300035398 Ga0316574_0410235 Ga0316574_0410235_238_576 112
251 3300036401 Ga0373937_0076990 Ga0373937_0076990_2144_2482 112
252 3300036647 Ga0316582_1094989 Ga0316582_1094989_42_380 112
253 3300039437 Ga0436365_0403426 Ga0436365_0403426_65_406 112
254 3300039437 Ga0436365_1030136 Ga0436365_1030136_107_445 112
255 3300039450 Ga0436363_0915075 Ga0436363_0915075_20_361 112
256 3300041453 Ga0451797_1487861 Ga0451797_1487861_1704_2042 112
257 3300041460 Ga0451802_0340793 Ga0451802_0340793_39_377 112
258 3300041492 Ga0451835_0776476 Ga0451835_0776476_274_612 112
259 3300041494 Ga0451837_0076459 Ga0451837_0076459_65_403 112
260 3300041498 Ga0451841_0229688 Ga0451841_0229688_24_362 112
261 3300041509 Ga0451843_0722448 Ga0451843_0722448_786_1124 112
262 3300041509 Ga0451843_1718143 Ga0451843_1718143_614_952 112
263 3300042004 Ga0439445_0172494 Ga0439445_0172494_163_504 112
264 3300042134 Ga0450898_023279 Ga0450898_023279_16_354 112
265 3300042876 Ga0451577_0142153 Ga0451577_0142153_1245_1583 112
266 3300042876 Ga0451577_0981309 Ga0451577_0981309_175_513 112
267 3300042993 Ga0439440_0132290 Ga0439440_0132290_115_453 112
268 3300044683 Ga0466965_0466313 Ga0466965_0466313_35_376 112
269 3300044684 Ga0466966_0076131 Ga0466966_0076131_1208_1546 112
270 3300044712 Ga0453684_0254874 Ga0453684_0254874_1618_1956 112
271 3300044712 Ga0453684_1925324 Ga0453684_1925324_149_487 112
272 3300044842 Ga0466957_0568448 Ga0466957_0568448_149_487 112
273 3300045049 Ga0466959_0086141 Ga0466959_0086141_1538_1876 112
274 3300045051 Ga0451576_0070940 Ga0451576_0070940_1111_1449 112
275 3300046454 Ga0495592_0364709 Ga0495592_0364709_14_355 112
276 3300046454 Ga0495592_0917708 Ga0495592_0917708_73_414 112
277 3300046455 Ga0495603_0028977 Ga0495603_0028977_466_807 112
278 3300046455 Ga0495603_0378120 Ga0495603_0378120_221_559 112
279 3300046461 Ga0495641_0101754 Ga0495641_0101754_514_855 112
280 3300046461 Ga0495641_0555568 Ga0495641_0555568_64_405 112
281 3300046499 Ga0495594_0165580 Ga0495594_0165580_37_378 112
282 3300046514 Ga0495618_0269781 Ga0495618_0269781_652_993 112
283 3300046516 Ga0495628_0387260 Ga0495628_0387260_294_632 112
284 3300046529 Ga0495652_0688088 Ga0495652_0688088_165_506 112
285 3300046533 Ga0495640_0312816 Ga0495640_0312816_503_844 112
286 3300046535 Ga0495586_0423242 Ga0495586_0423242_419_757 112
287 3300046557 Ga0495622_0114607 Ga0495622_0114607_176_514 112
288 3300046557 Ga0495622_0306226 Ga0495622_0306226_205_543 112
289 3300046663 Ga0495635_0278971 Ga0495635_0278971_646_987 112
290 3300046794 Ga0495589_0477493 Ga0495589_0477493_148_489 112
291 3300047319 Ga0495674_0921831 Ga0495674_0921831_74_415 112
292 3300047320 Ga0495672_0072375 Ga0495672_0072375_656_994 112
293 3300047320 Ga0495672_0499779 Ga0495672_0499779_26_367 112
294 3300047322 Ga0495680_0115478 Ga0495680_0115478_46_387 112
295 3300048903 Ga0496100_1254648 Ga0496100_1254648_59_400 112
296 3300048907 Ga0496104_0617491 Ga0496104_0617491_218_559 112
297 3300048908 Ga0496105_0685428 Ga0496105_0685428_70_411 112
298 3300048909 Ga0496106_0507836 Ga0496106_0507836_339_677 112
299 3300048911 Ga0496108_0897407 Ga0496108_0897407_184_525 112
300 3300048913 Ga0496110_0787994 Ga0496110_0787994_20_361 112
301 3300048915 Ga0496112_0747657 Ga0496112_0747657_287_628 112
302 3300048917 Ga0496114_0235876 Ga0496114_0235876_81_422 112
303 3300048918 Ga0496115_1243867 Ga0496115_1243867_20_361 112
304 3300049532 Ga0501316_002380 Ga0501316_002380_24_362 112
305 3300049533 Ga0501317_027514 Ga0501317_027514_24_362 112
306 3300049569 Ga0501032_0011963 Ga0501032_0011963_528_869 112
307 3300049569 Ga0501032_0946896 Ga0501032_0946896_66_407 112
308 3300049570 Ga0501033_0001699 Ga0501033_0001699_2311_2652 112
309 3300049570 Ga0501033_0008640 Ga0501033_0008640_6247_6588 112
310 3300049570 Ga0501033_0011945 Ga0501033_0011945_6190_6531 112
311 3300049570 Ga0501033_0129765 Ga0501033_0129765_459_800 112
312 3300049571 Ga0501034_0000257 Ga0501034_0000257_10565_10903 112
313 3300049571 Ga0501034_0000523 Ga0501034_0000523_46078_46419 112
314 3300049571 Ga0501034_0001758 Ga0501034_0001758_25008_25346 112
315 3300049571 Ga0501034_0014003 Ga0501034_0014003_2870_3208 112
316 3300049571 Ga0501034_0055774 Ga0501034_0055774_2278_2616 112
317 3300049571 Ga0501034_0059574 Ga0501034_0059574_612_953 112
318 3300049572 Ga0501036_0201115 Ga0501036_0201115_705_1046 112
319 3300049572 Ga0501036_0751777 Ga0501036_0751777_63_404 112
320 3300049573 Ga0501037_0104304 Ga0501037_0104304_1238_1579 112
321 3300049574 Ga0501038_0052380 Ga0501038_0052380_2092_2433 112
322 3300049575 Ga0501039_0144341 Ga0501039_0144341_864_1205 112
323 3300049578 Ga0501042_0870470 Ga0501042_0870470_276_614 112
324 3300049579 Ga0501043_0009847 Ga0501043_0009847_5216_5557 112
325 3300049579 Ga0501043_0650777 Ga0501043_0650777_58_399 112
326 3300049579 Ga0501043_1193395 Ga0501043_1193395_137_475 112
327 3300049580 Ga0501046_0767076 Ga0501046_0767076_265_606 112
328 3300049581 Ga0501047_0101019 Ga0501047_0101019_1304_1645 112
329 3300049583 Ga0501067_0006233 Ga0501067_0006233_3747_4085 112
330 3300049583 Ga0501067_0201597 Ga0501067_0201597_758_1096 112
331 3300049583 Ga0501067_0533619 Ga0501067_0533619_245_586 112
332 3300049583 Ga0501067_0745484 Ga0501067_0745484_118_459 112
333 3300049584 Ga0501068_0000191 Ga0501068_0000191_995_1369 112
334 3300049584 Ga0501068_0002466 Ga0501068_0002466_6511_6852 112
335 3300049584 Ga0501068_0131873 Ga0501068_0131873_671_1012 112
336 3300049584 Ga0501068_0160821 Ga0501068_0160821_595_936 112
337 3300049585 Ga0501069_0014151 Ga0501069_0014151_61_402 112
338 3300049585 Ga0501069_0095910 Ga0501069_0095910_343_681 112
339 3300049586 Ga0501070_0007432 Ga0501070_0007432_5290_5631 112
340 3300049586 Ga0501070_0043057 Ga0501070_0043057_3129_3467 112
341 3300049586 Ga0501070_0311185 Ga0501070_0311185_678_1016 112
342 3300049586 Ga0501070_0537208 Ga0501070_0537208_129_467 112
343 3300049586 Ga0501070_1040872 Ga0501070_1040872_204_542 112
344 3300049587 Ga0501071_0592774 Ga0501071_0592774_233_571 112
345 3300049587 Ga0501071_1299095 Ga0501071_1299095_167_505 112
346 3300049588 Ga0501072_0002518 Ga0501072_0002518_10629_10967 112
347 3300049588 Ga0501072_0038772 Ga0501072_0038772_2976_3317 112
348 3300049588 Ga0501072_0501773 Ga0501072_0501773_109_450 112
349 3300049589 Ga0501073_0000071 Ga0501073_0000071_9065_9406 112
350 3300049589 Ga0501073_0019137 Ga0501073_0019137_144_518 112
351 3300049590 Ga0501074_0000174 Ga0501074_0000174_7281_7655 112
352 3300049590 Ga0501074_0007811 Ga0501074_0007811_4425_4766 112
353 3300049590 Ga0501074_0041157 Ga0501074_0041157_989_1330 112
354 3300049590 Ga0501074_1303468 Ga0501074_1303468_100_441 112
355 3300049742 Ga0501080_0007867 Ga0501080_0007867_370_711 112
356 3300049742 Ga0501080_0046898 Ga0501080_0046898_1138_1512 112
357 3300049742 Ga0501080_0249924 Ga0501080_0249924_595_936 112
358 3300049742 Ga0501080_0875429 Ga0501080_0875429_124_462 112
359 3300049742 Ga0501080_0991962 Ga0501080_0991962_93_536 112
360 3300049744 Ga0501083_0027796 Ga0501083_0027796_1029_1367 112
361 3300049822 Ga0501035_1365763 Ga0501035_1365763_110_451 112
362 3300049823 Ga0501044_0001601 Ga0501044_0001601_9117_9458 112
363 3300049823 Ga0501044_0026709 Ga0501044_0026709_1315_1656 112
364 3300050489 nmdc:mga03683_65165_c2 nmdc:mga03683_65165_c2_549_890 112
365 3300050491 nmdc:mga00v17_567965_c1 nmdc:mga00v17_567965_c1_340_681 112
366 3300050492 nmdc:mga0yw44_10710_c1 nmdc:mga0yw44_10710_c1_896_1237 112
367 3300050492 nmdc:mga0yw44_137615_c1 nmdc:mga0yw44_137615_c1_264_602 112
368 3300050492 nmdc:mga0yw44_167795_c1 nmdc:mga0yw44_167795_c1_1048_1389 112
369 3300050492 nmdc:mga0yw44_1929_c1 nmdc:mga0yw44_1929_c1_1362_1703 112
370 3300050492 nmdc:mga0yw44_221552_c1 nmdc:mga0yw44_221552_c1_659_1000 112
371 3300050492 nmdc:mga0yw44_432079_c1 nmdc:mga0yw44_432079_c1_509_850 112
372 3300050492 nmdc:mga0yw44_702293_c1 nmdc:mga0yw44_702293_c1_81_422 112
373 3300050492 nmdc:mga0yw44_9835_c1 nmdc:mga0yw44_9835_c1_4473_4814 112
374 3300050494 nmdc:mga06z11_171144_c1 nmdc:mga06z11_171144_c1_329_670 112
375 3300050494 nmdc:mga06z11_534698_c1 nmdc:mga06z11_534698_c1_63_404 112
376 3300050496 nmdc:mga07m45_820183_c1 nmdc:mga07m45_820183_c1_176_517 112
377 3300050507 nmdc:mga05p37_1911_c1 nmdc:mga05p37_1911_c1_12498_12836 112
378 3300050507 nmdc:mga05p37_65846_c1 nmdc:mga05p37_65846_c1_2739_3077 112
379 3300050508 nmdc:mga09592_202596_c1 nmdc:mga09592_202596_c1_36_374 112
380 3300050508 nmdc:mga09592_5931_c1 nmdc:mga09592_5931_c1_915_1253 112
381 3300050509 nmdc:mga0qj67_1575_c1 nmdc:mga0qj67_1575_c1_7013_7351 112
382 3300050509 nmdc:mga0qj67_520222_c1 nmdc:mga0qj67_520222_c1_337_678 112
383 3300050509 nmdc:mga0qj67_652133_c1 nmdc:mga0qj67_652133_c1_173_514 112
384 3300050509 nmdc:mga0qj67_8501_c1 nmdc:mga0qj67_8501_c1_5110_5448 112
385 3300050510 nmdc:mga06r32_1148480_c1 nmdc:mga06r32_1148480_c1_261_602 112
386 3300050510 nmdc:mga06r32_1365_c1 nmdc:mga06r32_1365_c1_6035_6373 112
387 3300050510 nmdc:mga06r32_48806_c1 nmdc:mga06r32_48806_c1_2787_3125 112
388 3300050511 nmdc:mga08y16_411952_c1 nmdc:mga08y16_411952_c1_578_916 112
389 3300050511 nmdc:mga08y16_84531_c1 nmdc:mga08y16_84531_c1_150_491 112
390 3300050515 nmdc:mga0a205_57874_c2 nmdc:mga0a205_57874_c2_1216_1554 112
391 3300053078 Ga0495612_0299045 Ga0495612_0299045_77_418 112
392 3300053094 Ga0500566_0000154 Ga0500566_0000154_17361_17702 112
393 3300053139 Ga0500568_0062982 Ga0500568_0062982_71_412 112
394 3300053153 Ga0500616_0000200 Ga0500616_0000200_86560_86901 112
395 3300053153 Ga0500616_0176630 Ga0500616_0176630_254_592 112
396 3300059645 Ga0587076_158886 Ga0587076_158886_64_405 112

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00543

P-II

Nitrogen regulatory protein P-II

1

93

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4co4-assembly1.cif.gz_A structure of pii signaling protein glnz from azospirillum brasilense in complex with adenosine triphosphate 0.9971 1 108
6yc7-assembly1.cif.gz_F structure of adenylylated c. glutamicum glnk 0.9963 1 112
1hwu-assembly3.cif.gz_C structure of pii protein from herbaspirillum seropedicae 0.994 1 112
5l9n-assembly1.cif.gz_A structure of uridylylated glnb from escherichia coli bound to atp 0.99 1 108
6yc7-assembly1.cif.gz_C structure of adenylylated c. glutamicum glnk 0.988 1 112
ID Description Score Start End Superfamily
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9655 1 111 3.30.70.120
2o66C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.958 2 111 3.30.70.120
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9558 1 111 3.30.70.120
4oznB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.955 2 112 3.30.70.120
4usiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9215 2 108 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A181C720-F1-model_v4 deleted 0.9836 2 112
AF-K4LDM2-F1-model_v4 Nitrogen regulatory protein P-II 0.9834 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A7J2HAF6-F1-model_v4 deleted 0.9826 8 108
AF-A0A6L7PY16-F1-model_v4 P-II family nitrogen regulator 0.9813 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A1V4ZZD5-F1-model_v4 Putative nitrogen regulatory PII-like protein 0.9803 2 108 GO:0005524
GO:0005829
GO:0006808
GO:0030234

Feature Viewer

pLDDT pTM Quality
89.85 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map