F433462

General Info

Members Datasets Scaffolds Average Seq Length
396 234 394 129

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100756279|Ga0068863_1007562791
Length 146
Sequence MGEVNSLRLRLDCRKIDGEIHMVSAATMFGSNDIEKAKAFYDAVLATIGVTPLMEHGSGGRIYGTAAGPLISIVRPYDGRAATAGNGSMATLMCDTRDQVNAIHAKVLALGGRDEGAPGLRGPDGGQVYAAYFRDLDGNKFCVVHF

Samples

Sample ID Description Type Environment
1 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
2 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
73 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
90 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
91 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
145 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
162 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
163 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
164 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
165 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
169 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
170 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
171 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
192 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
193 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
194 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
195 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
196 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
199 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
200 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
201 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
202 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
203 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
204 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
205 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
206 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
207 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
208 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
209 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
210 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
211 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
212 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
213 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
214 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
215 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
216 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
217 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
218 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
219 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
220 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
221 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
222 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
223 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
224 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
225 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
226 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
227 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
228 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
229 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
230 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
231 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
232 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
233 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
234 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.62
Nodule 0.25
Rhizoplane 2.27
Rhizosphere 82.07
Stem 0
Stem Tuber 0
Unclassified 3.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1030056 3300001976 Bacteria 716
2 JGI24739J22299_10001826 3300001989 Bacteria 8114
3 JGI24034J26672_10012666 3300002239 Bacteria 1273
4 Ga0065704_10006364 3300005289 Bacteria 3934
5 Ga0065707_10255943 3300005295 Bacteria 1111
6 Ga0070658_10558828 3300005327 Bacteria 990
7 Ga0070676_10031195 3300005328 Bacteria 3044
8 Ga0070676_10525571 3300005328 Bacteria 843
9 Ga0070683_100535059 3300005329 Bacteria 1120
10 Ga0070683_101088011 3300005329 Bacteria 768
11 Ga0070690_100024831 3300005330 Bacteria 3689
12 Ga0070670_100015148 3300005331 Bacteria 6617
13 Ga0070670_100148942 3300005331 Bacteria 2025
14 Ga0070677_10082499 3300005333 Bacteria 1379
15 Ga0068869_100000003 3300005334 Bacteria 136262
16 Ga0070666_10131825 3300005335 Bacteria 1737
17 Ga0070666_10286538 3300005335 Bacteria 1171
18 Ga0070666_10790892 3300005335 Unclassified 698
19 Ga0070682_100170525 3300005337 Bacteria 1512
20 Ga0068868_100002086 3300005338 Bacteria 13763
21 Ga0068868_100358356 3300005338 Bacteria 1251
22 Ga0070660_100002010 3300005339 Bacteria 14015
23 Ga0070660_100055996 3300005339 Bacteria 3050
24 Ga0070689_100274339 3300005340 Bacteria 1397
25 Ga0070661_100025896 3300005344 Bacteria 4216
26 Ga0070661_100132897 3300005344 Bacteria 1870
27 Ga0070661_100848326 3300005344 Bacteria 752
28 Ga0070692_10025400 3300005345 Bacteria 2919
29 Ga0070668_100047631 3300005347 Bacteria 3296
30 Ga0070669_100000138 3300005353 Bacteria 65433
31 Ga0070669_100030098 3300005353 Bacteria 3916
32 Ga0070675_100038125 3300005354 Bacteria 3916
33 Ga0070675_101104217 3300005354 Bacteria 729
34 Ga0070671_100016357 3300005355 Bacteria 5998
35 Ga0070671_100102533 3300005355 Bacteria 2401
36 Ga0070674_100215435 3300005356 Bacteria 1491
37 Ga0070673_100000154 3300005364 Bacteria 33033
38 Ga0070688_100534433 3300005365 Bacteria 889
39 Ga0070688_100869079 3300005365 Unclassified 709
40 Ga0070659_100000503 3300005366 Bacteria 28787
41 Ga0070659_100124444 3300005366 Bacteria 2091
42 Ga0070667_100085018 3300005367 Bacteria 2713
43 Ga0070667_100215360 3300005367 Bacteria 1708
44 Ga0070667_100379368 3300005367 Bacteria 1284
45 Ga0070667_100511796 3300005367 Bacteria 1101
46 Ga0070701_10698752 3300005438 Bacteria 682
47 Ga0070663_100161569 3300005455 Bacteria 1724
48 Ga0070663_100840541 3300005455 Bacteria 789
49 Ga0070663_100899568 3300005455 Bacteria 764
50 Ga0070663_101691830 3300005455 Bacteria 565
51 Ga0070662_100000265 3300005457 Bacteria 30618
52 Ga0070662_100583007 3300005457 Bacteria 939
53 Ga0068867_100000115 3300005459 Bacteria 50713
54 Ga0068867_100049091 3300005459 Bacteria 3106
55 Ga0070679_100654931 3300005530 Bacteria 993
56 Ga0070684_101864049 3300005535 Unclassified 567
57 Ga0068853_100058088 3300005539 Bacteria 3339
58 Ga0068853_100125489 3300005539 Bacteria 2292
59 Ga0068853_100205546 3300005539 Bacteria 1793
60 Ga0068853_102181906 3300005539 Bacteria 537
61 Ga0070672_100000760 3300005543 Bacteria 19191
62 Ga0070686_101140808 3300005544 Bacteria 645
63 Ga0070693_100138500 3300005547 Bacteria 1529
64 Ga0070665_100001050 3300005548 Bacteria 34606
65 Ga0070665_100027447 3300005548 Bacteria 5735
66 Ga0070665_100040678 3300005548 Bacteria 4672
67 Ga0070665_100301365 3300005548 Bacteria 1605
68 Ga0068855_100008859 3300005563 Bacteria 12163
69 Ga0068855_100019311 3300005563 Bacteria 8189
70 Ga0068855_100047596 3300005563 Bacteria 5066
71 Ga0068855_100078726 3300005563 Bacteria 3824
72 Ga0068855_100374812 3300005563 Bacteria 1563
73 Ga0068855_100874528 3300005563 Bacteria 951
74 Ga0070664_100050152 3300005564 Bacteria 3532
75 Ga0070664_100350959 3300005564 Bacteria 1342
76 Ga0070664_101311910 3300005564 Bacteria 684
77 Ga0068857_100002200 3300005577 Bacteria 15882
78 Ga0068857_102099104 3300005577 Unclassified 554
79 Ga0068854_100003259 3300005578 Bacteria 10107
80 Ga0068854_100301869 3300005578 Bacteria 1296
81 Ga0068854_100646345 3300005578 Bacteria 908
82 Ga0068856_101883166 3300005614 Unclassified 609
83 Ga0068852_100013428 3300005616 Bacteria 6268
84 Ga0068852_100059979 3300005616 Bacteria 3301
85 Ga0068852_100464127 3300005616 Bacteria 1256
86 Ga0068852_100704825 3300005616 Bacteria 1020
87 Ga0068859_100002977 3300005617 Bacteria 17179
88 Ga0068859_100030798 3300005617 Bacteria 5384
89 Ga0068864_100000047 3300005618 Bacteria 150798
90 Ga0068864_100000180 3300005618 Bacteria 58252
91 Ga0068861_100177056 3300005719 Bacteria 1772
92 Ga0068851_10003923 3300005834 Bacteria 6660
93 Ga0068851_10100296 3300005834 Bacteria 1536
94 Ga0068851_10777112 3300005834 Bacteria 594
95 Ga0068863_100000157 3300005841 Bacteria 72136
96 Ga0068863_100000484 3300005841 Bacteria 40697
97 Ga0068863_100006683 3300005841 Bacteria 11320
98 Ga0068863_100083561 3300005841 Bacteria 3026
99 Ga0068863_100756279 3300005841 Bacteria 968
100 Ga0068863_102459254 3300005841 Bacteria 530
101 Ga0068858_100000147 3300005842 Bacteria 74022
102 Ga0068858_100006323 3300005842 Bacteria 11537
103 Ga0068860_100001640 3300005843 Bacteria 23979
104 Ga0068860_100013119 3300005843 Bacteria 8132
105 Ga0068862_100000023 3300005844 Bacteria 203389
106 Ga0068862_100329877 3300005844 Bacteria 1411
107 Ga0068862_100492599 3300005844 Bacteria 1162
108 Ga0097621_101905769 3300006237 Bacteria 567
109 Ga0068871_100175390 3300006358 Bacteria 1840
110 Ga0075434_100578883 3300006871 Bacteria 1142
111 Ga0068865_100005905 3300006881 Bacteria 7448
112 Ga0097620_100002977 3300006931 Bacteria 17179
113 Ga0097620_100030798 3300006931 Bacteria 5384
114 Ga0079104_1011789 3300006946 Bacteria 2788
115 Ga0105250_10323869 3300009092 Bacteria 670
116 Ga0105240_10056574 3300009093 Bacteria 4908
117 Ga0105240_10069188 3300009093 Bacteria 4370
118 Ga0105240_10077116 3300009093 Bacteria 4107
119 Ga0105240_10205980 3300009093 Bacteria 2302
120 Ga0105240_10238319 3300009093 Bacteria 2110
121 Ga0105240_10320993 3300009093 Bacteria 1765
122 Ga0105245_10008904 3300009098 Bacteria 8762
123 Ga0105247_10002615 3300009101 Bacteria 12154
124 Ga0105247_10079452 3300009101 Bacteria 2064
125 Ga0105243_10379656 3300009148 Bacteria 1307
126 Ga0105241_10259336 3300009174 Bacteria 1477
127 Ga0105248_10001118 3300009177 Bacteria 29838
128 Ga0105248_10016106 3300009177 Bacteria 8228
129 Ga0105248_10617531 3300009177 Bacteria 1223
130 Ga0105237_10186618 3300009545 Bacteria 2073
131 Ga0105237_10331234 3300009545 Unclassified 1527
132 Ga0105238_10057952 3300009551 Bacteria 3883
133 Ga0105238_10367786 3300009551 Bacteria 1428
134 Ga0105238_10428457 3300009551 Bacteria 1318
135 Ga0105238_10461747 3300009551 Bacteria 1268
136 Ga0105238_10557221 3300009551 Bacteria 1151
137 Ga0105238_10752196 3300009551 Bacteria 989
138 Ga0105249_10000004 3300009553 Bacteria 368014
139 Ga0105249_10684005 3300009553 Bacteria 1085
140 Ga0105148_100813 3300009978 Bacteria 2309
141 Ga0105147_101962 3300009982 Bacteria 1682
142 Ga0105239_10057535 3300010375 Bacteria 4265
143 Ga0105239_10131535 3300010375 Bacteria 2784
144 Ga0105246_10011551 3300011119 Bacteria 5482
145 Ga0105246_10040038 3300011119 Bacteria 3161
146 Ga0157373_10026292 3300013100 Bacteria 4206
147 Ga0157371_10052796 3300013102 Bacteria 2886
148 Ga0157370_11266682 3300013104 Bacteria 665
149 Ga0157374_10230344 3300013296 Bacteria 1820
150 Ga0157374_11258366 3300013296 Bacteria 762
151 Ga0157378_10004936 3300013297 Bacteria 11693
152 Ga0163162_10139922 3300013306 Bacteria 2533
153 Ga0157372_10294265 3300013307 Bacteria 1888
154 Ga0157375_11084546 3300013308 Bacteria 937
155 Ga0163163_10012677 3300014325 Bacteria 7688
156 Ga0163163_11070254 3300014325 Bacteria 869
157 Ga0157380_10242881 3300014326 Bacteria 1625
158 Ga0157380_10361041 3300014326 Bacteria 1363
159 Ga0182008_10010346 3300014497 Bacteria 4993
160 Ga0157377_10049374 3300014745 Bacteria 2365
161 Ga0157379_10062851 3300014968 Bacteria 3320
162 Ga0182006_1010321 3300015261 Bacteria 4156
163 Ga0213872_10129485 3300021361 Bacteria 1112
164 Ga0207425_1010239 3300025245 Bacteria 2291
165 Ga0207697_10000033 3300025315 Bacteria 50935
166 Ga0207656_10017096 3300025321 Bacteria 2836
167 Ga0207656_10048661 3300025321 Bacteria 1826
168 Ga0207656_10065531 3300025321 Bacteria 1604
169 Ga0207682_10031231 3300025893 Bacteria 2137
170 Ga0207710_10020057 3300025900 Bacteria 2855
171 Ga0207688_10000019 3300025901 Bacteria 51361
172 Ga0207680_10132963 3300025903 Bacteria 1641
173 Ga0207680_10220694 3300025903 Bacteria 1300
174 Ga0207645_10008714 3300025907 Bacteria 7063
175 Ga0207705_10006518 3300025909 Bacteria 8647
176 Ga0207705_10039498 3300025909 Bacteria 3383
177 Ga0207705_10263360 3300025909 Bacteria 1317
178 Ga0207654_10250706 3300025911 Bacteria 1186
179 Ga0207695_10119561 3300025913 Unclassified 2604
180 Ga0207695_10191972 3300025913 Bacteria 1960
181 Ga0207695_10194540 3300025913 Bacteria 1944
182 Ga0207695_10201737 3300025913 Bacteria 1903
183 Ga0207695_10427082 3300025913 Bacteria 1209
184 Ga0207695_10788969 3300025913 Bacteria 830
185 Ga0207671_10266085 3300025914 Bacteria 1350
186 Ga0207671_10435347 3300025914 Bacteria 1044
187 Ga0207657_10001774 3300025919 Bacteria 23295
188 Ga0207657_10107264 3300025919 Bacteria 2310
189 Ga0207657_10697173 3300025919 Bacteria 789
190 Ga0207657_11359327 3300025919 Unclassified 535
191 Ga0207649_10018636 3300025920 Bacteria 3952
192 Ga0207649_10150551 3300025920 Bacteria 1602
193 Ga0207649_10727802 3300025920 Bacteria 771
194 Ga0207652_10483100 3300025921 Bacteria 1116
195 Ga0207681_10000355 3300025923 Bacteria 32681
196 Ga0207681_10270216 3300025923 Bacteria 1334
197 Ga0207694_10016352 3300025924 Bacteria 5602
198 Ga0207694_10046041 3300025924 Bacteria 3371
199 Ga0207694_10325912 3300025924 Bacteria 1268
200 Ga0207694_10377917 3300025924 Bacteria 1176
201 Ga0207694_10399282 3300025924 Bacteria 1143
202 Ga0207650_10001253 3300025925 Bacteria 18436
203 Ga0207659_10041177 3300025926 Bacteria 3234
204 Ga0207659_11348219 3300025926 Bacteria 612
205 Ga0207687_10005633 3300025927 Bacteria 8283
206 Ga0207644_10361096 3300025931 Bacteria 1181
207 Ga0207690_10003633 3300025932 Bacteria 9185
208 Ga0207690_10206453 3300025932 Bacteria 1495
209 Ga0207706_10000020 3300025933 Bacteria 162063
210 Ga0207706_10346601 3300025933 Bacteria 1292
211 Ga0207706_11676180 3300025933 Bacteria 513
212 Ga0207709_10191220 3300025935 Bacteria 1454
213 Ga0207669_10176530 3300025937 Bacteria 1526
214 Ga0207704_10020002 3300025938 Bacteria 3531
215 Ga0207691_10000047 3300025940 Bacteria 99519
216 Ga0207711_10001597 3300025941 Bacteria 20953
217 Ga0207711_10021011 3300025941 Bacteria 5451
218 Ga0207711_10908716 3300025941 Bacteria 818
219 Ga0207689_10000002 3300025942 Bacteria 198437
220 Ga0207679_10030162 3300025945 Bacteria 3784
221 Ga0207679_10281252 3300025945 Bacteria 1427
222 Ga0207679_10782795 3300025945 Bacteria 869
223 Ga0207667_10026591 3300025949 Bacteria 6317
224 Ga0207667_10128366 3300025949 Bacteria 2612
225 Ga0207667_10373938 3300025949 Bacteria 1452
226 Ga0207667_11039711 3300025949 Bacteria 805
227 Ga0207651_10043297 3300025960 Bacteria 3003
228 Ga0207712_10000008 3300025961 Bacteria 527957
229 Ga0207712_10480246 3300025961 Bacteria 1059
230 Ga0207668_11163543 3300025972 Bacteria 692
231 Ga0207640_10000415 3300025981 Bacteria 26811
232 Ga0207640_10059521 3300025981 Bacteria 2521
233 Ga0207658_10026875 3300025986 Bacteria 4039
234 Ga0207658_11114661 3300025986 Bacteria 721
235 Ga0207677_10007136 3300026023 Bacteria 6153
236 Ga0207677_10221077 3300026023 Bacteria 1519
237 Ga0207703_10000050 3300026035 Bacteria 145849
238 Ga0207703_10002845 3300026035 Bacteria 14764
239 Ga0207639_10052932 3300026041 Bacteria 3095
240 Ga0207639_10087132 3300026041 Bacteria 2488
241 Ga0207678_10009092 3300026067 Bacteria 8748
242 Ga0207678_10294271 3300026067 Bacteria 1395
243 Ga0207678_10315069 3300026067 Bacteria 1345
244 Ga0207678_10335248 3300026067 Bacteria 1303
245 Ga0207702_10423383 3300026078 Bacteria 1288
246 Ga0207641_10000118 3300026088 Bacteria 117721
247 Ga0207641_10009157 3300026088 Bacteria 8175
248 Ga0207641_10131082 3300026088 Bacteria 2251
249 Ga0207641_10193097 3300026088 Bacteria 1873
250 Ga0207648_10002330 3300026089 Bacteria 20498
251 Ga0207648_10102254 3300026089 Bacteria 2511
252 Ga0207676_10000196 3300026095 Bacteria 52852
253 Ga0207676_10002243 3300026095 Bacteria 13887
254 Ga0207674_10006226 3300026116 Bacteria 14066
255 Ga0207675_100205562 3300026118 Bacteria 1892
256 Ga0207698_10010198 3300026142 Bacteria 6022
257 Ga0207698_10117586 3300026142 Bacteria 2243
258 Ga0207698_11084561 3300026142 Bacteria 813
259 Ga0268266_10003402 3300028379 Bacteria 15926
260 Ga0268266_10019659 3300028379 Bacteria 5755
261 Ga0268266_10220696 3300028379 Bacteria 1742
262 Ga0268266_10354983 3300028379 Bacteria 1378
263 Ga0268265_10000035 3300028380 Bacteria 207267
264 Ga0268265_10547111 3300028380 Bacteria 1098
265 Ga0268265_10699033 3300028380 Viruses 979
266 Ga0268264_10002586 3300028381 Bacteria 15829
267 Ga0268264_10024145 3300028381 Bacteria 4962
268 Ga0268264_11003561 3300028381 Bacteria 841
269 Ga0316177_1017325 3300030731 Bacteria 7016
270 Ga0307408_100747318 3300031548 Bacteria 883
271 Ga0307408_101906986 3300031548 Bacteria 570
272 Ga0373923_0510371 3300035111 Bacteria 587
273 Ga0373954_0070476 3300035118 Bacteria 1661
274 Ga0373956_0013852 3300035119 Bacteria 3360
275 Ga0373955_0069424 3300035172 Bacteria 1966
276 Ga0373927_0268511 3300035695 Bacteria 1122
277 Ga0373927_0382092 3300035695 Bacteria 929
278 Ga0373933_1025297 3300035724 Bacteria 543
279 Ga0373937_0001785 3300036401 Bacteria 18065
280 Ga0373925_0271252 3300037068 Bacteria 1365
281 Ga0395899_0145597 3300037312 Bacteria 1683
282 Ga0395899_0237001 3300037312 Unclassified 1257
283 Ga0395900_0229231 3300037418 Bacteria 1869
284 Ga0395900_0881991 3300037418 Bacteria 819
285 Ga0395905_0374467 3300037471 Bacteria 1317
286 Ga0395905_0840495 3300037471 Bacteria 821
287 Ga0436364_1390568 3300037853 Bacteria 759
288 Ga0395901_0301646 3300038443 Bacteria 1661
289 Ga0436360_0361845 3300039438 Bacteria 648
290 Ga0436361_0449810 3300039447 Bacteria 1494
291 Ga0436361_0805335 3300039447 Bacteria 774
292 Ga0436362_0560129 3300039453 Bacteria 742
293 Ga0495629_0016572 3300046459 Bacteria 5290
294 Ga0495594_0768009 3300046499 Bacteria 544
295 Ga0495583_0057149 3300046506 Bacteria 1756
296 Ga0495583_0059235 3300046506 Bacteria 1717
297 Ga0495606_0376452 3300046507 Bacteria 746
298 Ga0495610_0334544 3300046512 Bacteria 574
299 Ga0495620_0312794 3300046515 Bacteria 597
300 Ga0495632_0272305 3300046519 Bacteria 755
301 Ga0495643_0136268 3300046522 Bacteria 1228
302 Ga0495643_0206028 3300046522 Bacteria 941
303 Ga0495648_0000094 3300046524 Bacteria 110608
304 Ga0495654_0282424 3300046530 Bacteria 682
305 Ga0495609_0010585 3300046538 Bacteria 4419
306 Ga0495609_0382251 3300046538 Bacteria 565
307 Ga0495597_0004401 3300046542 Bacteria 7757
308 Ga0495597_0010197 3300046542 Bacteria 4602
309 Ga0495622_0000390 3300046557 Bacteria 29815
310 Ga0495622_0004352 3300046557 Bacteria 6591
311 Ga0495622_0039511 3300046557 Bacteria 2197
312 Ga0495656_0086754 3300046615 Bacteria 1424
313 Ga0495668_0001608 3300046616 Bacteria 21175
314 Ga0495668_0060151 3300046616 Bacteria 2096
315 Ga0495625_0494570 3300046660 Bacteria 749
316 Ga0495669_0008917 3300046684 Bacteria 4225
317 Ga0495669_0214131 3300046684 Bacteria 923
318 Ga0495624_0196162 3300046690 Bacteria 1227
319 Ga0495672_0000299 3300047320 Bacteria 67952
320 Ga0495687_042115 3300047443 Bacteria 1998
321 Ga0496100_0619888 3300048903 Unclassified 841
322 Ga0496101_1629072 3300048904 Bacteria 501
323 Ga0496103_0399588 3300048906 Bacteria 883
324 Ga0496106_1042420 3300048909 Bacteria 642
325 Ga0496108_0027985 3300048911 Bacteria 4662
326 Ga0496109_0055269 3300048912 Bacteria 3621
327 Ga0496110_0045380 3300048913 Bacteria 3841
328 Ga0496111_0033062 3300048914 Bacteria 3689
329 Ga0496113_0063764 3300048916 Bacteria 2785
330 Ga0496116_0023324 3300048919 Bacteria 4610
331 Ga0496116_0364425 3300048919 Bacteria 655
332 Ga0496117_0009733 3300048920 Bacteria 8870
333 Ga0496117_0357089 3300048920 Bacteria 752
334 Ga0496118_0005379 3300048921 Bacteria 14584
335 Ga0496118_0035869 3300048921 Bacteria 4018
336 Ga0496119_0018268 3300048922 Bacteria 5235
337 Ga0496121_0000067 3300048924 Bacteria 261543
338 Ga0496121_0000488 3300048924 Bacteria 76655
339 Ga0496122_0134645 3300048925 Bacteria 1561
340 Ga0496123_0162828 3300048926 Bacteria 1187
341 Ga0496124_0056067 3300048927 Bacteria 3326
342 Ga0496125_0037235 3300048928 Bacteria 4232
343 Ga0496126_0051187 3300048929 Bacteria 3761
344 Ga0495678_002392 3300049459 Bacteria 12826
345 Ga0495678_170476 3300049459 Bacteria 689
346 Ga0495682_0058727 3300049460 Bacteria 1391
347 Ga0501249_001218 3300049679 Bacteria 5407
348 Ga0501225_0007647 3300049705 Bacteria 3129
349 Ga0501204_011669 3300049850 Bacteria 1046
350 Ga0500635_0000227 3300053080 Bacteria 24968
351 Ga0500578_0729695 3300053086 Bacteria 530
352 Ga0500643_128345 3300053087 Bacteria 682
353 Ga0500647_0024709 3300053091 Bacteria 2827
354 Ga0500647_0184599 3300053091 Bacteria 955
355 Ga0500583_0154325 3300053092 Bacteria 1143
356 Ga0500651_0061427 3300053093 Bacteria 2347
357 Ga0500651_0144872 3300053093 Bacteria 1429
358 Ga0500566_0111456 3300053094 Bacteria 1487
359 Ga0500566_0528749 3300053094 Bacteria 503
360 Ga0500641_0076896 3300053096 Bacteria 1412
361 Ga0500554_238297 3300053102 Bacteria 602
362 Ga0500555_137443 3300053103 Bacteria 603
363 Ga0500569_017030 3300053109 Bacteria 1851
364 Ga0500595_000880 3300053119 Bacteria 17116
365 Ga0500595_003623 3300053119 Bacteria 7158
366 Ga0500595_005962 3300053119 Bacteria 5246
367 Ga0500607_155277 3300053121 Bacteria 1054
368 Ga0500608_001083 3300053122 Bacteria 9703
369 Ga0500614_022295 3300053123 Bacteria 1477
370 Ga0500614_054311 3300053123 Bacteria 1061
371 Ga0500618_012723 3300053125 Bacteria 2195
372 Ga0500642_0016972 3300053130 Bacteria 2779
373 Ga0500642_0019673 3300053130 Bacteria 2639
374 Ga0500642_0083829 3300053130 Bacteria 1467
375 Ga0500655_000158 3300053133 Bacteria 16768
376 Ga0500559_0012646 3300053136 Bacteria 3584
377 Ga0500559_0046573 3300053136 Bacteria 1902
378 Ga0500564_116637 3300053138 Bacteria 1167
379 Ga0500586_222306 3300053145 Bacteria 608
380 Ga0500590_097409 3300053148 Bacteria 1417
381 Ga0500590_143605 3300053148 Bacteria 1086
382 Ga0500619_042018 3300053154 Bacteria 1448
383 Ga0500622_0003598 3300053156 Bacteria 10207
384 Ga0500624_023793 3300053157 Bacteria 1007
385 Ga0500639_164264 3300053163 Bacteria 1005
386 Ga0500639_270887 3300053163 Bacteria 663
387 Ga0500636_0172790 3300053177 Bacteria 1167
388 Ga0500636_0307156 3300053177 Bacteria 778
389 Ga0500637_0012568 3300053178 Bacteria 4416
390 Ga0500637_0072111 3300053178 Bacteria 1987
391 Ga0500570_004715 3300053724 Bacteria 7211
392 Ga0500576_151228 3300053725 Unclassified 867
393 Ga0500625_028065 3300053729 Bacteria 2670
394 Ga0500596_008663 3300053735 Bacteria 1616

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035695 Ga0373927_0382092 Ga0373927_0382092_465_800 110
2 3300035724 Ga0373933_1025297 Ga0373933_1025297_12_347 110
3 3300009093 Ga0105240_10077116 Ga0105240_100771164 111
4 3300025913 Ga0207695_10788969 Ga0207695_107889691 111
5 3300053119 Ga0500595_000880 Ga0500595_000880_658_1044 112
6 3300037471 Ga0395905_0374467 Ga0395905_0374467_720_1094 115
7 iso_pu_bacteria 2928115317 2928120220 116
8 3300005841 Ga0068863_100083561 Ga0068863_1000835612 117
9 3300009551 Ga0105238_10752196 Ga0105238_107521962 117
10 3300049459 Ga0495678_002392 Ga0495678_002392_7322_7699 117
11 iso_pu_bacteria 2582581305 2585260189 118
12 3300026088 Ga0207641_10193097 Ga0207641_101930972 119
13 3300037418 Ga0395900_0881991 Ga0395900_0881991_164_553 120
14 3300005367 Ga0070667_100511796 Ga0070667_1005117962 121
15 3300005539 Ga0068853_102181906 Ga0068853_1021819061 121
16 3300005841 Ga0068863_100756279 Ga0068863_1007562791 121
17 3300013308 Ga0157375_11084546 Ga0157375_110845462 121
18 3300035111 Ga0373923_0510371 Ga0373923_0510371_156_524 121
19 3300035118 Ga0373954_0070476 Ga0373954_0070476_759_1127 121
20 3300035119 Ga0373956_0013852 Ga0373956_0013852_225_593 121
21 3300035172 Ga0373955_0069424 Ga0373955_0069424_612_980 121
22 3300036401 Ga0373937_0001785 Ga0373937_0001785_9788_10156 121
23 3300037853 Ga0436364_1390568 Ga0436364_1390568_12_395 121
24 3300039447 Ga0436361_0805335 Ga0436361_0805335_186_566 121
25 3300039453 Ga0436362_0560129 Ga0436362_0560129_290_664 121
26 3300053091 Ga0500647_0024709 Ga0500647_0024709_2426_2806 121
27 3300001976 JGI24752J21851_1030056 JGI24752J21851_10300561 122
28 3300001989 JGI24739J22299_10001826 JGI24739J22299_100018269 122
29 3300002239 JGI24034J26672_10012666 JGI24034J26672_100126661 122
30 3300005289 Ga0065704_10006364 Ga0065704_100063642 122
31 3300005295 Ga0065707_10255943 Ga0065707_102559432 122
32 3300005327 Ga0070658_10558828 Ga0070658_105588282 122
33 3300005328 Ga0070676_10031195 Ga0070676_100311952 122
34 3300005328 Ga0070676_10525571 Ga0070676_105255712 122
35 3300005329 Ga0070683_100535059 Ga0070683_1005350591 122
36 3300005329 Ga0070683_101088011 Ga0070683_1010880111 122
37 3300005330 Ga0070690_100024831 Ga0070690_1000248312 122
38 3300005331 Ga0070670_100015148 Ga0070670_1000151483 122
39 3300005331 Ga0070670_100148942 Ga0070670_1001489421 122
40 3300005333 Ga0070677_10082499 Ga0070677_100824992 122
41 3300005334 Ga0068869_100000003 Ga0068869_10000000393 122
42 3300005335 Ga0070666_10131825 Ga0070666_101318253 122
43 3300005335 Ga0070666_10286538 Ga0070666_102865383 122
44 3300005335 Ga0070666_10790892 Ga0070666_107908921 122
45 3300005337 Ga0070682_100170525 Ga0070682_1001705252 122
46 3300005338 Ga0068868_100002086 Ga0068868_1000020862 122
47 3300005338 Ga0068868_100358356 Ga0068868_1003583563 122
48 3300005339 Ga0070660_100002010 Ga0070660_1000020107 122
49 3300005339 Ga0070660_100055996 Ga0070660_1000559963 122
50 3300005340 Ga0070689_100274339 Ga0070689_1002743392 122
51 3300005344 Ga0070661_100025896 Ga0070661_1000258961 122
52 3300005344 Ga0070661_100132897 Ga0070661_1001328972 122
53 3300005344 Ga0070661_100848326 Ga0070661_1008483262 122
54 3300005345 Ga0070692_10025400 Ga0070692_100254003 122
55 3300005347 Ga0070668_100047631 Ga0070668_1000476313 122
56 3300005353 Ga0070669_100000138 Ga0070669_1000001382 122
57 3300005353 Ga0070669_100030098 Ga0070669_1000300982 122
58 3300005354 Ga0070675_100038125 Ga0070675_1000381254 122
59 3300005354 Ga0070675_101104217 Ga0070675_1011042171 122
60 3300005355 Ga0070671_100016357 Ga0070671_1000163572 122
61 3300005355 Ga0070671_100102533 Ga0070671_1001025333 122
62 3300005356 Ga0070674_100215435 Ga0070674_1002154352 122
63 3300005364 Ga0070673_100000154 Ga0070673_10000015440 122
64 3300005365 Ga0070688_100534433 Ga0070688_1005344331 122
65 3300005365 Ga0070688_100869079 Ga0070688_1008690791 122
66 3300005366 Ga0070659_100000503 Ga0070659_10000050313 122
67 3300005366 Ga0070659_100124444 Ga0070659_1001244442 122
68 3300005367 Ga0070667_100085018 Ga0070667_1000850183 122
69 3300005367 Ga0070667_100215360 Ga0070667_1002153603 122
70 3300005367 Ga0070667_100379368 Ga0070667_1003793681 122
71 3300005438 Ga0070701_10698752 Ga0070701_106987521 122
72 3300005455 Ga0070663_100161569 Ga0070663_1001615692 122
73 3300005455 Ga0070663_100840541 Ga0070663_1008405411 122
74 3300005455 Ga0070663_100899568 Ga0070663_1008995682 122
75 3300005455 Ga0070663_101691830 Ga0070663_1016918301 122
76 3300005457 Ga0070662_100000265 Ga0070662_10000026532 122
77 3300005457 Ga0070662_100583007 Ga0070662_1005830072 122
78 3300005459 Ga0068867_100000115 Ga0068867_10000011538 122
79 3300005459 Ga0068867_100049091 Ga0068867_1000490913 122
80 3300005530 Ga0070679_100654931 Ga0070679_1006549312 122
81 3300005535 Ga0070684_101864049 Ga0070684_1018640491 122
82 3300005539 Ga0068853_100058088 Ga0068853_1000580883 122
83 3300005539 Ga0068853_100125489 Ga0068853_1001254892 122
84 3300005539 Ga0068853_100205546 Ga0068853_1002055462 122
85 3300005543 Ga0070672_100000760 Ga0070672_1000007603 122
86 3300005544 Ga0070686_101140808 Ga0070686_1011408082 122
87 3300005547 Ga0070693_100138500 Ga0070693_1001385002 122
88 3300005548 Ga0070665_100001050 Ga0070665_10000105014 122
89 3300005548 Ga0070665_100027447 Ga0070665_1000274472 122
90 3300005548 Ga0070665_100040678 Ga0070665_1000406782 122
91 3300005548 Ga0070665_100301365 Ga0070665_1003013652 122
92 3300005563 Ga0068855_100008859 Ga0068855_1000088595 122
93 3300005563 Ga0068855_100019311 Ga0068855_1000193118 122
94 3300005563 Ga0068855_100047596 Ga0068855_1000475966 122
95 3300005563 Ga0068855_100078726 Ga0068855_1000787263 122
96 3300005563 Ga0068855_100374812 Ga0068855_1003748122 122
97 3300005563 Ga0068855_100874528 Ga0068855_1008745282 122
98 3300005564 Ga0070664_100050152 Ga0070664_1000501523 122
99 3300005564 Ga0070664_100350959 Ga0070664_1003509592 122
100 3300005564 Ga0070664_101311910 Ga0070664_1013119102 122
101 3300005577 Ga0068857_100002200 Ga0068857_10000220012 122
102 3300005577 Ga0068857_102099104 Ga0068857_1020991042 122
103 3300005578 Ga0068854_100003259 Ga0068854_1000032593 122
104 3300005578 Ga0068854_100301869 Ga0068854_1003018692 122
105 3300005578 Ga0068854_100646345 Ga0068854_1006463452 122
106 3300005614 Ga0068856_101883166 Ga0068856_1018831661 122
107 3300005616 Ga0068852_100013428 Ga0068852_1000134283 122
108 3300005616 Ga0068852_100059979 Ga0068852_1000599792 122
109 3300005616 Ga0068852_100464127 Ga0068852_1004641272 122
110 3300005616 Ga0068852_100704825 Ga0068852_1007048252 122
111 3300005617 Ga0068859_100002977 Ga0068859_10000297713 122
112 3300005617 Ga0068859_100030798 Ga0068859_1000307985 122
113 3300005618 Ga0068864_100000047 Ga0068864_100000047105 122
114 3300005618 Ga0068864_100000180 Ga0068864_10000018048 122
115 3300005719 Ga0068861_100177056 Ga0068861_1001770562 122
116 3300005834 Ga0068851_10003923 Ga0068851_100039234 122
117 3300005834 Ga0068851_10100296 Ga0068851_101002962 122
118 3300005834 Ga0068851_10777112 Ga0068851_107771122 122
119 3300005841 Ga0068863_100000157 Ga0068863_10000015761 122
120 3300005841 Ga0068863_100000484 Ga0068863_10000048418 122
121 3300005841 Ga0068863_100006683 Ga0068863_1000066834 122
122 3300005841 Ga0068863_102459254 Ga0068863_1024592541 122
123 3300005842 Ga0068858_100000147 Ga0068858_10000014762 122
124 3300005842 Ga0068858_100006323 Ga0068858_1000063239 122
125 3300005843 Ga0068860_100001640 Ga0068860_1000016405 122
126 3300005843 Ga0068860_100013119 Ga0068860_1000131195 122
127 3300005844 Ga0068862_100000023 Ga0068862_100000023112 122
128 3300005844 Ga0068862_100329877 Ga0068862_1003298772 122
129 3300005844 Ga0068862_100492599 Ga0068862_1004925992 122
130 3300006237 Ga0097621_101905769 Ga0097621_1019057691 122
131 3300006358 Ga0068871_100175390 Ga0068871_1001753902 122
132 3300006871 Ga0075434_100578883 Ga0075434_1005788832 122
133 3300006881 Ga0068865_100005905 Ga0068865_1000059055 122
134 3300006931 Ga0097620_100002977 Ga0097620_10000297713 122
135 3300006931 Ga0097620_100030798 Ga0097620_1000307982 122
136 3300006946 Ga0079104_1011789 Ga0079104_10117892 122
137 3300009092 Ga0105250_10323869 Ga0105250_103238691 122
138 3300009093 Ga0105240_10056574 Ga0105240_100565745 122
139 3300009093 Ga0105240_10069188 Ga0105240_100691881 122
140 3300009093 Ga0105240_10205980 Ga0105240_102059803 122
141 3300009093 Ga0105240_10238319 Ga0105240_102383191 122
142 3300009093 Ga0105240_10320993 Ga0105240_103209933 122
143 3300009098 Ga0105245_10008904 Ga0105245_100089043 122
144 3300009101 Ga0105247_10002615 Ga0105247_1000261510 122
145 3300009101 Ga0105247_10079452 Ga0105247_100794522 122
146 3300009148 Ga0105243_10379656 Ga0105243_103796562 122
147 3300009174 Ga0105241_10259336 Ga0105241_102593362 122
148 3300009177 Ga0105248_10001118 Ga0105248_1000111817 122
149 3300009177 Ga0105248_10016106 Ga0105248_100161063 122
150 3300009177 Ga0105248_10617531 Ga0105248_106175313 122
151 3300009545 Ga0105237_10186618 Ga0105237_101866182 122
152 3300009545 Ga0105237_10331234 Ga0105237_103312341 122
153 3300009551 Ga0105238_10057952 Ga0105238_100579523 122
154 3300009551 Ga0105238_10367786 Ga0105238_103677862 122
155 3300009551 Ga0105238_10428457 Ga0105238_104284572 122
156 3300009551 Ga0105238_10461747 Ga0105238_104617473 122
157 3300009551 Ga0105238_10557221 Ga0105238_105572213 122
158 3300009553 Ga0105249_10000004 Ga0105249_10000004260 122
159 3300009553 Ga0105249_10684005 Ga0105249_106840052 122
160 3300009978 Ga0105148_100813 Ga0105148_1008132 122
161 3300009982 Ga0105147_101962 Ga0105147_1019622 122
162 3300010375 Ga0105239_10057535 Ga0105239_100575356 122
163 3300010375 Ga0105239_10131535 Ga0105239_101315353 122
164 3300011119 Ga0105246_10011551 Ga0105246_100115516 122
165 3300011119 Ga0105246_10040038 Ga0105246_100400384 122
166 3300013100 Ga0157373_10026292 Ga0157373_100262924 122
167 3300013102 Ga0157371_10052796 Ga0157371_100527963 122
168 3300013104 Ga0157370_11266682 Ga0157370_112666822 122
169 3300013296 Ga0157374_10230344 Ga0157374_102303443 122
170 3300013296 Ga0157374_11258366 Ga0157374_112583662 122
171 3300013297 Ga0157378_10004936 Ga0157378_1000493610 122
172 3300013306 Ga0163162_10139922 Ga0163162_101399223 122
173 3300013307 Ga0157372_10294265 Ga0157372_102942652 122
174 3300014325 Ga0163163_10012677 Ga0163163_100126773 122
175 3300014325 Ga0163163_11070254 Ga0163163_110702542 122
176 3300014326 Ga0157380_10242881 Ga0157380_102428812 122
177 3300014326 Ga0157380_10361041 Ga0157380_103610413 122
178 3300014497 Ga0182008_10010346 Ga0182008_100103462 122
179 3300014745 Ga0157377_10049374 Ga0157377_100493743 122
180 3300014968 Ga0157379_10062851 Ga0157379_100628513 122
181 3300015261 Ga0182006_1010321 Ga0182006_10103213 122
182 3300021361 Ga0213872_10129485 Ga0213872_101294852 122
183 3300025245 Ga0207425_1010239 Ga0207425_10102392 122
184 3300025315 Ga0207697_10000033 Ga0207697_1000003310 122
185 3300025321 Ga0207656_10017096 Ga0207656_100170964 122
186 3300025321 Ga0207656_10048661 Ga0207656_100486613 122
187 3300025321 Ga0207656_10065531 Ga0207656_100655311 122
188 3300025893 Ga0207682_10031231 Ga0207682_100312313 122
189 3300025900 Ga0207710_10020057 Ga0207710_100200572 122
190 3300025901 Ga0207688_10000019 Ga0207688_1000001919 122
191 3300025903 Ga0207680_10132963 Ga0207680_101329632 122
192 3300025903 Ga0207680_10220694 Ga0207680_102206942 122
193 3300025907 Ga0207645_10008714 Ga0207645_100087149 122
194 3300025909 Ga0207705_10006518 Ga0207705_100065188 122
195 3300025909 Ga0207705_10039498 Ga0207705_100394984 122
196 3300025909 Ga0207705_10263360 Ga0207705_102633602 122
197 3300025911 Ga0207654_10250706 Ga0207654_102507063 122
198 3300025913 Ga0207695_10119561 Ga0207695_101195614 122
199 3300025913 Ga0207695_10191972 Ga0207695_101919722 122
200 3300025913 Ga0207695_10194540 Ga0207695_101945402 122
201 3300025913 Ga0207695_10201737 Ga0207695_102017372 122
202 3300025913 Ga0207695_10427082 Ga0207695_104270822 122
203 3300025914 Ga0207671_10266085 Ga0207671_102660852 122
204 3300025914 Ga0207671_10435347 Ga0207671_104353472 122
205 3300025919 Ga0207657_10001774 Ga0207657_1000177417 122
206 3300025919 Ga0207657_10107264 Ga0207657_101072643 122
207 3300025919 Ga0207657_10697173 Ga0207657_106971731 122
208 3300025919 Ga0207657_11359327 Ga0207657_113593271 122
209 3300025920 Ga0207649_10018636 Ga0207649_100186363 122
210 3300025920 Ga0207649_10150551 Ga0207649_101505511 122
211 3300025920 Ga0207649_10727802 Ga0207649_107278022 122
212 3300025921 Ga0207652_10483100 Ga0207652_104831002 122
213 3300025923 Ga0207681_10000355 Ga0207681_1000035529 122
214 3300025923 Ga0207681_10270216 Ga0207681_102702162 122
215 3300025924 Ga0207694_10016352 Ga0207694_100163522 122
216 3300025924 Ga0207694_10046041 Ga0207694_100460413 122
217 3300025924 Ga0207694_10325912 Ga0207694_103259121 122
218 3300025924 Ga0207694_10377917 Ga0207694_103779172 122
219 3300025924 Ga0207694_10399282 Ga0207694_103992821 122
220 3300025925 Ga0207650_10001253 Ga0207650_100012532 122
221 3300025926 Ga0207659_10041177 Ga0207659_100411774 122
222 3300025926 Ga0207659_11348219 Ga0207659_113482191 122
223 3300025927 Ga0207687_10005633 Ga0207687_100056332 122
224 3300025931 Ga0207644_10361096 Ga0207644_103610963 122
225 3300025932 Ga0207690_10003633 Ga0207690_100036334 122
226 3300025932 Ga0207690_10206453 Ga0207690_102064533 122
227 3300025933 Ga0207706_10000020 Ga0207706_1000002064 122
228 3300025933 Ga0207706_10346601 Ga0207706_103466013 122
229 3300025933 Ga0207706_11676180 Ga0207706_116761801 122
230 3300025935 Ga0207709_10191220 Ga0207709_101912202 122
231 3300025937 Ga0207669_10176530 Ga0207669_101765303 122
232 3300025938 Ga0207704_10020002 Ga0207704_100200023 122
233 3300025940 Ga0207691_10000047 Ga0207691_1000004777 122
234 3300025941 Ga0207711_10001597 Ga0207711_1000159717 122
235 3300025941 Ga0207711_10021011 Ga0207711_100210117 122
236 3300025941 Ga0207711_10908716 Ga0207711_109087161 122
237 3300025942 Ga0207689_10000002 Ga0207689_1000000277 122
238 3300025945 Ga0207679_10030162 Ga0207679_100301623 122
239 3300025945 Ga0207679_10281252 Ga0207679_102812522 122
240 3300025945 Ga0207679_10782795 Ga0207679_107827952 122
241 3300025949 Ga0207667_10026591 Ga0207667_100265914 122
242 3300025949 Ga0207667_10128366 Ga0207667_101283662 122
243 3300025949 Ga0207667_10373938 Ga0207667_103739382 122
244 3300025949 Ga0207667_11039711 Ga0207667_110397112 122
245 3300025960 Ga0207651_10043297 Ga0207651_100432973 122
246 3300025961 Ga0207712_10000008 Ga0207712_10000008391 122
247 3300025961 Ga0207712_10480246 Ga0207712_104802462 122
248 3300025972 Ga0207668_11163543 Ga0207668_111635432 122
249 3300025981 Ga0207640_10000415 Ga0207640_100004153 122
250 3300025981 Ga0207640_10059521 Ga0207640_100595212 122
251 3300025986 Ga0207658_10026875 Ga0207658_100268753 122
252 3300025986 Ga0207658_11114661 Ga0207658_111146612 122
253 3300026023 Ga0207677_10007136 Ga0207677_100071369 122
254 3300026023 Ga0207677_10221077 Ga0207677_102210772 122
255 3300026035 Ga0207703_10000050 Ga0207703_10000050129 122
256 3300026035 Ga0207703_10002845 Ga0207703_100028459 122
257 3300026041 Ga0207639_10052932 Ga0207639_100529323 122
258 3300026041 Ga0207639_10087132 Ga0207639_100871323 122
259 3300026067 Ga0207678_10009092 Ga0207678_100090925 122
260 3300026067 Ga0207678_10294271 Ga0207678_102942712 122
261 3300026067 Ga0207678_10315069 Ga0207678_103150692 122
262 3300026067 Ga0207678_10335248 Ga0207678_103352482 122
263 3300026078 Ga0207702_10423383 Ga0207702_104233832 122
264 3300026088 Ga0207641_10000118 Ga0207641_1000011816 122
265 3300026088 Ga0207641_10009157 Ga0207641_100091572 122
266 3300026088 Ga0207641_10131082 Ga0207641_101310822 122
267 3300026089 Ga0207648_10002330 Ga0207648_1000233013 122
268 3300026089 Ga0207648_10102254 Ga0207648_101022542 122
269 3300026095 Ga0207676_10000196 Ga0207676_1000019651 122
270 3300026095 Ga0207676_10002243 Ga0207676_1000224310 122
271 3300026116 Ga0207674_10006226 Ga0207674_100062267 122
272 3300026118 Ga0207675_100205562 Ga0207675_1002055623 122
273 3300026142 Ga0207698_10010198 Ga0207698_100101983 122
274 3300026142 Ga0207698_10117586 Ga0207698_101175863 122
275 3300026142 Ga0207698_11084561 Ga0207698_110845612 122
276 3300028379 Ga0268266_10003402 Ga0268266_100034024 122
277 3300028379 Ga0268266_10019659 Ga0268266_100196593 122
278 3300028379 Ga0268266_10220696 Ga0268266_102206963 122
279 3300028379 Ga0268266_10354983 Ga0268266_103549832 122
280 3300028380 Ga0268265_10000035 Ga0268265_10000035106 122
281 3300028380 Ga0268265_10547111 Ga0268265_105471112 122
282 3300028380 Ga0268265_10699033 Ga0268265_106990331 122
283 3300028381 Ga0268264_10002586 Ga0268264_100025867 122
284 3300028381 Ga0268264_10024145 Ga0268264_100241454 122
285 3300028381 Ga0268264_11003561 Ga0268264_110035612 122
286 3300030731 Ga0316177_1017325 Ga0316177_10173253 122
287 3300031548 Ga0307408_100747318 Ga0307408_1007473182 122
288 3300031548 Ga0307408_101906986 Ga0307408_1019069861 122
289 3300035695 Ga0373927_0268511 Ga0373927_0268511_582_950 122
290 3300037068 Ga0373925_0271252 Ga0373925_0271252_473_841 122
291 3300037312 Ga0395899_0145597 Ga0395899_0145597_620_1042 122
292 3300037312 Ga0395899_0237001 Ga0395899_0237001_831_1220 122
293 3300037418 Ga0395900_0229231 Ga0395900_0229231_802_1224 122
294 3300037471 Ga0395905_0840495 Ga0395905_0840495_69_467 122
295 3300038443 Ga0395901_0301646 Ga0395901_0301646_172_555 122
296 3300039438 Ga0436360_0361845 Ga0436360_0361845_115_501 122
297 3300039447 Ga0436361_0449810 Ga0436361_0449810_824_1210 122
298 3300046459 Ga0495629_0016572 Ga0495629_0016572_213_650 122
299 3300046499 Ga0495594_0768009 Ga0495594_0768009_35_403 122
300 3300046506 Ga0495583_0057149 Ga0495583_0057149_348_716 122
301 3300046506 Ga0495583_0059235 Ga0495583_0059235_1191_1628 122
302 3300046507 Ga0495606_0376452 Ga0495606_0376452_192_629 122
303 3300046512 Ga0495610_0334544 Ga0495610_0334544_38_475 122
304 3300046515 Ga0495620_0312794 Ga0495620_0312794_150_518 122
305 3300046519 Ga0495632_0272305 Ga0495632_0272305_167_604 122
306 3300046522 Ga0495643_0136268 Ga0495643_0136268_780_1148 122
307 3300046522 Ga0495643_0206028 Ga0495643_0206028_174_542 122
308 3300046524 Ga0495648_0000094 Ga0495648_0000094_55822_56193 122
309 3300046530 Ga0495654_0282424 Ga0495654_0282424_108_545 122
310 3300046538 Ga0495609_0010585 Ga0495609_0010585_1166_1537 122
311 3300046538 Ga0495609_0382251 Ga0495609_0382251_53_490 122
312 3300046542 Ga0495597_0004401 Ga0495597_0004401_743_1180 122
313 3300046542 Ga0495597_0010197 Ga0495597_0010197_3796_4164 122
314 3300046557 Ga0495622_0000390 Ga0495622_0000390_18966_19337 122
315 3300046557 Ga0495622_0004352 Ga0495622_0004352_2499_2870 122
316 3300046557 Ga0495622_0039511 Ga0495622_0039511_32_469 122
317 3300046615 Ga0495656_0086754 Ga0495656_0086754_609_980 122
318 3300046616 Ga0495668_0001608 Ga0495668_0001608_6963_7355 122
319 3300046616 Ga0495668_0060151 Ga0495668_0060151_830_1267 122
320 3300046660 Ga0495625_0494570 Ga0495625_0494570_270_638 122
321 3300046684 Ga0495669_0008917 Ga0495669_0008917_2766_3134 122
322 3300046684 Ga0495669_0214131 Ga0495669_0214131_265_633 122
323 3300046690 Ga0495624_0196162 Ga0495624_0196162_157_594 122
324 3300047320 Ga0495672_0000299 Ga0495672_0000299_46052_46423 122
325 3300047443 Ga0495687_042115 Ga0495687_042115_782_1219 122
326 3300048903 Ga0496100_0619888 Ga0496100_0619888_267_635 122
327 3300048904 Ga0496101_1629072 Ga0496101_1629072_36_404 122
328 3300048906 Ga0496103_0399588 Ga0496103_0399588_284_652 122
329 3300048909 Ga0496106_1042420 Ga0496106_1042420_193_561 122
330 3300048911 Ga0496108_0027985 Ga0496108_0027985_1903_2271 122
331 3300048912 Ga0496109_0055269 Ga0496109_0055269_786_1154 122
332 3300048913 Ga0496110_0045380 Ga0496110_0045380_2620_2988 122
333 3300048914 Ga0496111_0033062 Ga0496111_0033062_1831_2199 122
334 3300048916 Ga0496113_0063764 Ga0496113_0063764_1252_1620 122
335 3300048919 Ga0496116_0023324 Ga0496116_0023324_4205_4573 122
336 3300048919 Ga0496116_0364425 Ga0496116_0364425_258_626 122
337 3300048920 Ga0496117_0009733 Ga0496117_0009733_6257_6625 122
338 3300048920 Ga0496117_0357089 Ga0496117_0357089_359_730 122
339 3300048921 Ga0496118_0005379 Ga0496118_0005379_6946_7314 122
340 3300048921 Ga0496118_0035869 Ga0496118_0035869_1553_1924 122
341 3300048922 Ga0496119_0018268 Ga0496119_0018268_3424_3792 122
342 3300048924 Ga0496121_0000067 Ga0496121_0000067_137840_138208 122
343 3300048924 Ga0496121_0000488 Ga0496121_0000488_59689_60060 122
344 3300048925 Ga0496122_0134645 Ga0496122_0134645_420_788 122
345 3300048926 Ga0496123_0162828 Ga0496123_0162828_718_1086 122
346 3300048927 Ga0496124_0056067 Ga0496124_0056067_2078_2446 122
347 3300048928 Ga0496125_0037235 Ga0496125_0037235_2657_3025 122
348 3300048929 Ga0496126_0051187 Ga0496126_0051187_2933_3304 122
349 3300049459 Ga0495678_170476 Ga0495678_170476_273_641 122
350 3300049460 Ga0495682_0058727 Ga0495682_0058727_587_1024 122
351 3300049679 Ga0501249_001218 Ga0501249_001218_35_406 122
352 3300049705 Ga0501225_0007647 Ga0501225_0007647_128_526 122
353 3300049850 Ga0501204_011669 Ga0501204_011669_501_872 122
354 3300053080 Ga0500635_0000227 Ga0500635_0000227_22077_22445 122
355 3300053086 Ga0500578_0729695 Ga0500578_0729695_94_462 122
356 3300053087 Ga0500643_128345 Ga0500643_128345_254_622 122
357 3300053091 Ga0500647_0184599 Ga0500647_0184599_515_883 122
358 3300053092 Ga0500583_0154325 Ga0500583_0154325_691_1128 122
359 3300053093 Ga0500651_0061427 Ga0500651_0061427_442_879 122
360 3300053093 Ga0500651_0144872 Ga0500651_0144872_665_1033 122
361 3300053094 Ga0500566_0111456 Ga0500566_0111456_143_580 122
362 3300053094 Ga0500566_0528749 Ga0500566_0528749_53_421 122
363 3300053096 Ga0500641_0076896 Ga0500641_0076896_548_916 122
364 3300053102 Ga0500554_238297 Ga0500554_238297_120_488 122
365 3300053103 Ga0500555_137443 Ga0500555_137443_144_512 122
366 3300053109 Ga0500569_017030 Ga0500569_017030_690_1127 122
367 3300053119 Ga0500595_003623 Ga0500595_003623_1596_2033 122
368 3300053119 Ga0500595_005962 Ga0500595_005962_4076_4468 122
369 3300053121 Ga0500607_155277 Ga0500607_155277_10_378 122
370 3300053122 Ga0500608_001083 Ga0500608_001083_1465_1833 122
371 3300053123 Ga0500614_022295 Ga0500614_022295_670_1107 122
372 3300053123 Ga0500614_054311 Ga0500614_054311_526_894 122
373 3300053125 Ga0500618_012723 Ga0500618_012723_1752_2120 122
374 3300053130 Ga0500642_0016972 Ga0500642_0016972_622_990 122
375 3300053130 Ga0500642_0019673 Ga0500642_0019673_254_622 122
376 3300053130 Ga0500642_0083829 Ga0500642_0083829_1052_1420 122
377 3300053133 Ga0500655_000158 Ga0500655_000158_552_920 122
378 3300053136 Ga0500559_0012646 Ga0500559_0012646_2050_2487 122
379 3300053136 Ga0500559_0046573 Ga0500559_0046573_943_1311 122
380 3300053138 Ga0500564_116637 Ga0500564_116637_671_1108 122
381 3300053145 Ga0500586_222306 Ga0500586_222306_115_552 122
382 3300053148 Ga0500590_097409 Ga0500590_097409_229_666 122
383 3300053148 Ga0500590_143605 Ga0500590_143605_695_1063 122
384 3300053154 Ga0500619_042018 Ga0500619_042018_742_1179 122
385 3300053156 Ga0500622_0003598 Ga0500622_0003598_1673_2041 122
386 3300053157 Ga0500624_023793 Ga0500624_023793_416_784 122
387 3300053163 Ga0500639_164264 Ga0500639_164264_439_807 122
388 3300053163 Ga0500639_270887 Ga0500639_270887_29_397 122
389 3300053177 Ga0500636_0172790 Ga0500636_0172790_415_852 122
390 3300053177 Ga0500636_0307156 Ga0500636_0307156_224_592 122
391 3300053178 Ga0500637_0012568 Ga0500637_0012568_1569_1937 122
392 3300053178 Ga0500637_0072111 Ga0500637_0072111_820_1257 122
393 3300053724 Ga0500570_004715 Ga0500570_004715_3324_3692 122
394 3300053725 Ga0500576_151228 Ga0500576_151228_302_691 122
395 3300053729 Ga0500625_028065 Ga0500625_028065_259_696 122
396 3300053735 Ga0500596_008663 Ga0500596_008663_198_635 122

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

23

143

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qb5-assembly1.cif.gz_C crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.9146 2 119
4qb5-assembly1.cif.gz_A crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.899 2 119
4qb5-assembly2.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8937 2 119
4qb5-assembly1.cif.gz_C crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.872 2 119
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.8695 1 119
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9151 66 119 3.30.720.110
4qb5A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8937 1 119 3.10.180.10
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8783 66 122 3.30.720.110
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8695 1 119 3.10.180.10
4qb5A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8655 1 119 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A258CSE3-F1-model_v4 VOC domain-containing protein 0.9941 1 122 GO:0005886
GO:0015079
GO:0015293
AF-A0A258CSE3-F1-model_v4 VOC domain-containing protein 0.986 1 122 GO:0005886
GO:0015079
GO:0015293
AF-A0A4S1FN10-F1-model_v4 VOC family protein 0.9761 65 120
AF-A0A6B2LV26-F1-model_v4 VOC domain-containing protein 0.9727 65 120
AF-A0A259IWH6-F1-model_v4 Glyoxalase 0.9689 65 120

Feature Viewer

pLDDT pTM Quality
94.69 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map