F433456

General Info

Members Datasets Scaffolds Average Seq Length
396 227 792 427

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100025999|Ga0068855_1000259998
Length 482
Sequence MNFVEELRWRGMLHDIMPGTEELLNKGMVSGYIGFDPTADSLHVGSLAQIMTLIHFQRAGHKPFALVGGATGMVGDPSGKSAERNLLSEDVLRHNLQGIQQQLEKFLDFDCGANSAQMVNNYDWFKNYTFLNFIRDVGKHITVNYMMAKDSVKNRISGDTGMSFTEFTYQLVQGYDFYYLWKHNNCALQMGGSDQWGNIVTGTELIRRKDAGEAFALTTQLIKKSDGTKFGKTEGGNIWLDKNRTPVFEFYQFWFNTSDEDAKTYIRIFTLLDEKTIMGLEEEQDKTPGLRPLQKALAKDITTRVHGEKEYELVIKNIEFSQNKNFQWLDLEGLKEEEFLQIFANSNKGFVVDKIFNKEATNADNASEETIINKFFIQENVVRGENNLFSNLVDFLYEITYPTEPGVSKKLFESKGEIRRLIANGGIYINKQKASVDDKVDSYHKMFDKYIFLQKGKKDSTLISITSNPWEELKRIQQLLNN

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
68 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
69 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
108 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
109 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
110 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
121 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
129 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
130 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
138 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
139 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
140 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
143 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
144 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
145 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
151 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
152 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
153 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
154 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
157 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
160 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
161 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
162 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
163 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
164 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
165 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
166 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
167 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
170 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
173 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
174 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
175 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
176 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
177 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
178 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
179 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
180 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
181 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
182 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
183 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
184 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
185 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
186 2738541283 Pedobacter sp. OK701 Isolate Unclassified
187 2738541284 Pedobacter sp. YR016 Isolate Unclassified
188 2738541302 Pedobacter sp. CF074 Isolate Unclassified
189 2738543023 Pedobacter sp. OK628 Isolate Unclassified
190 2739367651 Pedobacter sp. OK291 Isolate Unclassified
191 2739367656 Pedobacter sp. CF523 Isolate Unclassified
192 2739367663 Pedobacter sp. YR510 Isolate Unclassified
193 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
194 2818991437 Pedobacter terrae 518 Isolate Unclassified
195 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
196 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
197 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
198 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
199 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
200 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
201 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
202 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
203 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
204 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
205 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
206 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
207 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
208 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
209 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
210 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
211 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
212 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
213 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
214 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
215 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
216 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
217 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
218 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
219 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
220 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
221 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
222 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
223 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
224 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
225 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
226 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
227 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.38
Metatranscriptomes 0
Isolates 11.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.13
Nodule 0
Rhizoplane 0.25
Rhizosphere 75
Stem 0
Stem Tuber 0
Unclassified 0.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100025999 3300005563 Bacteria 7003
2 JGI24739J22299_10004953 3300001989 Bacteria 5070
3 JGI24739J22299_10016854 3300001989 Bacteria 2642
4 JGI24739J22299_10019223 3300001989 Bacteria 2448
5 JGI24737J22298_10003280 3300001990 Bacteria 5734
6 JGI24737J22298_10003858 3300001990 Bacteria 5270
7 JGI24735J21928_10000008 3300002067 Bacteria 319819
8 JGI25162J39368_1000059 3300002737 Bacteria 138925
9 JGI25162J39368_1000823 3300002737 Bacteria 20446
10 JGI25162J39368_1000899 3300002737 Bacteria 19364
11 JGI25150J39212_1000001 3300002774 Bacteria 1318726
12 JGI25151J46595_10000001 3300003187 Bacteria 887211
13 JGI25165J46597_1000739 3300003214 Bacteria 25461
14 JGI25153J46596_10000001 3300003215 Bacteria 748985
15 rootH1_10005789 3300003316 Bacteria 44276
16 rootH1_10005789 3300003323 Bacteria 2718
17 rootH1_10009733 3300003316 Bacteria 10737
18 rootH2_10008353 3300003320 Bacteria 41961
19 rootH2_10037436 3300003320 Bacteria 5523
20 rootH2_10056133 3300003320 Bacteria 5627
21 rootL2_10203625 3300003322 Bacteria 3416
22 rootH1_10006386 3300003316 Bacteria 2019
23 rootH1_10006386 3300003323 Bacteria 30831
24 rootH1_10012013 3300003323 Bacteria 12284
25 rootH1_10029533 3300003323 Bacteria 26337
26 rootH1_10043086 3300003323 Bacteria 7157
27 rootH1_10043692 3300003323 Bacteria 17024
28 rootH1_10183235 3300003323 Bacteria 2447
29 rootH1_10198768 3300003323 Bacteria 2148
30 Ga0055542_1003720 3300003762 Bacteria 3987
31 Ga0055530_10002202 3300003791 Bacteria 12899
32 Ga0055531_10000027 3300003794 Bacteria 160284
33 Ga0065165_1000185 3300005262 Bacteria 108984
34 Ga0065165_1001091 3300005262 Bacteria 32302
35 Ga0065165_1013511 3300005262 Bacteria 3240
36 Ga0065714_10005204 3300005288 Bacteria 4077
37 Ga0065714_10064484 3300005288 Bacteria 52741
38 Ga0065714_10091650 3300005288 Bacteria 1903
39 Ga0065704_10114808 3300005289 Bacteria 1884
40 Ga0070658_10000045 3300005327 Bacteria 130728
41 Ga0070658_10127012 3300005327 Bacteria 2123
42 Ga0070676_10000819 3300005328 Bacteria 15368
43 Ga0070680_100007736 3300005336 Bacteria 8191
44 Ga0068868_100044671 3300005338 Bacteria 3464
45 Ga0070660_100028899 3300005339 Bacteria 4152
46 Ga0070659_100000188 3300005366 Bacteria 47486
47 Ga0070678_100001431 3300005456 Bacteria 12721
48 Ga0070662_100000838 3300005457 Bacteria 18922
49 Ga0070681_10000745 3300005458 Bacteria 27011
50 Ga0068867_100001069 3300005459 Bacteria 18702
51 Ga0070679_100008263 3300005530 Bacteria 9791
52 Ga0070679_100044258 3300005530 Bacteria 4435
53 Ga0068853_100024278 3300005539 Bacteria 5081
54 Ga0068853_100058949 3300005539 Bacteria 3315
55 Ga0068853_100059873 3300005539 Bacteria 3290
56 Ga0070665_100000034 3300005548 Bacteria 324289
57 Ga0068855_100000049 3300005563 Bacteria 145321
58 Ga0068855_100011192 3300005563 Bacteria 10834
59 Ga0068855_100035707 3300005563 Bacteria 5921
60 Ga0068857_100027218 3300005577 Bacteria 5043
61 Ga0068857_100070048 3300005577 Bacteria 3123
62 Ga0068856_100000056 3300005614 Bacteria 102483
63 Ga0068856_100020764 3300005614 Bacteria 6382
64 Ga0068852_100002106 3300005616 Bacteria 13608
65 Ga0075366_10000457 3300006195 Bacteria 19019
66 Ga0075366_10006916 3300006195 Bacteria 6245
67 Ga0097621_100000182 3300006237 Bacteria 39957
68 Ga0068871_100002531 3300006358 Bacteria 12472
69 Ga0068865_100000178 3300006881 Bacteria 35174
70 Ga0105244_10012178 3300009036 Bacteria 5103
71 Ga0105240_10000200 3300009093 Bacteria 121941
72 Ga0105240_10036278 3300009093 Bacteria 6344
73 Ga0105240_10046849 3300009093 Bacteria 5475
74 Ga0105240_10118832 3300009093 Bacteria 3185
75 Ga0105240_10120121 3300009093 Bacteria 3165
76 Ga0105240_10193664 3300009093 Bacteria 2389
77 Ga0105243_10000036 3300009148 Bacteria 176192
78 Ga0105241_10001938 3300009174 Bacteria 15656
79 Ga0105241_10114538 3300009174 Bacteria 2163
80 Ga0105242_10040413 3300009176 Bacteria 3759
81 Ga0105237_10000239 3300009545 Bacteria 78319
82 Ga0105237_10001125 3300009545 Bacteria 35877
83 Ga0105237_10001530 3300009545 Bacteria 30283
84 Ga0105237_10007163 3300009545 Bacteria 12252
85 Ga0105237_10008693 3300009545 Bacteria 10971
86 Ga0105237_10157694 3300009545 Bacteria 2267
87 Ga0105237_10157695 3300009545 Bacteria 2267
88 Ga0105237_10172424 3300009545 Bacteria 2163
89 Ga0105238_10034113 3300009551 Bacteria 5179
90 Ga0105238_10062673 3300009551 Bacteria 3718
91 Ga0105239_10000001 3300010375 Bacteria 617353
92 Ga0105239_10000059 3300010375 Bacteria 155685
93 Ga0105239_10001792 3300010375 Bacteria 28226
94 Ga0105239_10003333 3300010375 Bacteria 19771
95 Ga0105239_10052735 3300010375 Bacteria 4460
96 Ga0105239_10138231 3300010375 Bacteria 2713
97 Ga0157373_10000332 3300013100 Bacteria 38271
98 Ga0157373_10008003 3300013100 Bacteria 7860
99 Ga0157373_10013923 3300013100 Bacteria 5899
100 Ga0157373_10015820 3300013100 Bacteria 5508
101 Ga0157373_10026382 3300013100 Bacteria 4196
102 Ga0157371_10000805 3300013102 Bacteria 35999
103 Ga0157371_10000849 3300013102 Bacteria 34894
104 Ga0157371_10000922 3300013102 Bacteria 32992
105 Ga0157371_10002216 3300013102 Bacteria 18801
106 Ga0157371_10004228 3300013102 Bacteria 12627
107 Ga0157371_10007176 3300013102 Bacteria 9052
108 Ga0157371_10020371 3300013102 Bacteria 4881
109 Ga0157370_10000531 3300013104 Bacteria 47724
110 Ga0157370_10000693 3300013104 Bacteria 42077
111 Ga0157370_10006252 3300013104 Bacteria 13184
112 Ga0157370_10034880 3300013104 Bacteria 4895
113 Ga0157370_10045132 3300013104 Bacteria 4230
114 Ga0157369_10000040 3300013105 Bacteria 183469
115 Ga0157369_10000664 3300013105 Bacteria 44521
116 Ga0157369_10041872 3300013105 Bacteria 4998
117 Ga0157369_10103597 3300013105 Bacteria 3031
118 Ga0157369_10119354 3300013105 Bacteria 2799
119 Ga0157369_10129563 3300013105 Bacteria 2674
120 Ga0157374_10001036 3300013296 Bacteria 24103
121 Ga0157374_10001740 3300013296 Bacteria 18260
122 Ga0157378_10011692 3300013297 Bacteria 7682
123 Ga0157378_10023939 3300013297 Bacteria 5370
124 Ga0157378_10104135 3300013297 Bacteria 2594
125 Ga0163162_10000116 3300013306 Bacteria 70911
126 Ga0163162_10000558 3300013306 Bacteria 34481
127 Ga0163162_10007180 3300013306 Bacteria 10816
128 Ga0157372_10000109 3300013307 Bacteria 86749
129 Ga0157372_10001137 3300013307 Bacteria 28927
130 Ga0157372_10008123 3300013307 Bacteria 11158
131 Ga0157372_10010904 3300013307 Bacteria 9676
132 Ga0157372_10041583 3300013307 Bacteria 5083
133 Ga0157372_10092502 3300013307 Bacteria 3440
134 Ga0157372_10105667 3300013307 Bacteria 3220
135 Ga0157375_10015825 3300013308 Bacteria 6759
136 Ga0157375_10046883 3300013308 Bacteria 4217
137 Ga0157375_10101484 3300013308 Bacteria 2960
138 Ga0163163_10262426 3300014325 Bacteria 1778
139 Ga0182008_10000006 3300014497 Bacteria 378521
140 Ga0182008_10000272 3300014497 Bacteria 40515
141 Ga0157377_10031026 3300014745 Bacteria 2902
142 Ga0182006_1000568 3300015261 Bacteria 27454
143 Ga0182006_1002594 3300015261 Bacteria 9773
144 Ga0182007_10000033 3300015262 Bacteria 139808
145 Ga0183373_1001 3300015682 Bacteria 1410374
146 Ga0163161_10000085 3300017792 Bacteria 93534
147 Ga0163161_10000249 3300017792 Bacteria 47891
148 Ga0163161_10001695 3300017792 Bacteria 16178
149 Ga0163161_10004998 3300017792 Bacteria 9227
150 Ga0163161_10022486 3300017792 Bacteria 4441
151 Ga0209436_103217 3300025208 Bacteria 4442
152 Ga0209437_100010 3300025233 Bacteria 838447
153 Ga0209437_100169 3300025233 Bacteria 142584
154 Ga0209258_100041 3300025242 Bacteria 381381
155 Ga0207425_1000002 3300025245 Bacteria 1362590
156 Ga0209026_1000646 3300025250 Bacteria 21440
157 Ga0209148_1000090 3300025254 Bacteria 250982
158 Ga0209129_1000002 3300025258 Bacteria 1359086
159 Ga0209233_1000017 3300025261 Bacteria 898076
160 Ga0209233_1003862 3300025261 Bacteria 5210
161 Ga0209233_1005653 3300025261 Bacteria 4129
162 Ga0209455_1001199 3300025272 Bacteria 12381
163 Ga0209130_1001027 3300025284 Bacteria 21399
164 Ga0209676_1000008 3300025292 Bacteria 991778
165 Ga0209676_1004411 3300025292 Bacteria 7855
166 Ga0209025_1000004 3300025294 Bacteria 1361782
167 Ga0209758_1000006 3300025297 Bacteria 1359562
168 Ga0209050_1000055 3300025298 Bacteria 339254
169 Ga0207426_1000177 3300025302 Bacteria 159426
170 Ga0209257_1000001 3300025304 Bacteria 2274655
171 Ga0207647_10000128 3300025904 Bacteria 59284
172 Ga0207647_10000238 3300025904 Bacteria 45001
173 Ga0207645_10000169 3300025907 Bacteria 51953
174 Ga0207705_10000080 3300025909 Bacteria 119562
175 Ga0207654_10018195 3300025911 Bacteria 3684
176 Ga0207707_10024568 3300025912 Bacteria 5274
177 Ga0207695_10000055 3300025913 Bacteria 382776
178 Ga0207695_10029712 3300025913 Bacteria 6031
179 Ga0207695_10040951 3300025913 Bacteria 4961
180 Ga0207695_10061361 3300025913 Bacteria 3885
181 Ga0207671_10002729 3300025914 Bacteria 18463
182 Ga0207671_10003117 3300025914 Bacteria 16850
183 Ga0207671_10011083 3300025914 Bacteria 7374
184 Ga0207671_10024689 3300025914 Bacteria 4515
185 Ga0207671_10048644 3300025914 Bacteria 3138
186 Ga0207660_10027265 3300025917 Bacteria 3896
187 Ga0207652_10064068 3300025921 Bacteria 3180
188 Ga0207694_10184209 3300025924 Bacteria 1694
189 Ga0207690_10001303 3300025932 Bacteria 15695
190 Ga0207706_10000679 3300025933 Bacteria 35737
191 Ga0207686_10055277 3300025934 Bacteria 2490
192 Ga0207709_10000007 3300025935 Bacteria 752025
193 Ga0207704_10000114 3300025938 Bacteria 44748
194 Ga0207667_10000015 3300025949 Bacteria 417534
195 Ga0207667_10003651 3300025949 Bacteria 18976
196 Ga0207667_10007607 3300025949 Bacteria 12985
197 Ga0207667_10061762 3300025949 Bacteria 3919
198 Ga0207677_10036571 3300026023 Bacteria 3202
199 Ga0207639_10010338 3300026041 Bacteria 6462
200 Ga0207639_10018597 3300026041 Bacteria 4941
201 Ga0207702_10000082 3300026078 Bacteria 107098
202 Ga0207641_10267915 3300026088 Bacteria 1602
203 Ga0207648_10000123 3300026089 Bacteria 76156
204 Ga0207683_10010104 3300026121 Bacteria 8054
205 Ga0207698_10001021 3300026142 Bacteria 16285
206 Ga0268266_10000111 3300028379 Bacteria 169743
207 Ga0307517_10010325 3300028786 Bacteria 13082
208 Ga0307515_10002940 3300028794 Bacteria 36133
209 Ga0307515_10014904 3300028794 Bacteria 14367
210 Ga0307515_10148324 3300028794 Bacteria 2469
211 Ga0265338_10193044 3300028800 Bacteria 1542
212 Ga0316177_1197492 3300030731 Bacteria 24690
213 Ga0316176_1003080 3300030732 Bacteria 7277
214 Ga0316183_1096868 3300030742 Bacteria 33618
215 Ga0316181_1179416 3300030744 Bacteria 6586
216 Ga0265327_10001298 3300031251 Bacteria 32727
217 Ga0265316_10071521 3300031344 Bacteria 2674
218 Ga0307509_10144359 3300031507 Bacteria 2309
219 Ga0307408_100000445 3300031548 Bacteria 36377
220 Ga0307408_100001255 3300031548 Bacteria 19034
221 Ga0307408_100004038 3300031548 Bacteria 10008
222 Ga0307408_100104615 3300031548 Bacteria 2163
223 Ga0265314_10090738 3300031711 Bacteria 1990
224 Ga0307405_10000003 3300031731 Bacteria 569064
225 Ga0307407_10000010 3300031903 Bacteria 186970
226 Ga0307416_100000014 3300032002 Bacteria 249053
227 Ga0307414_10000228 3300032004 Bacteria 36801
228 Ga0307414_10003196 3300032004 Bacteria 8710
229 Ga0307414_10016737 3300032004 Bacteria 4467
230 Ga0307414_10020160 3300032004 Bacteria 4150
231 Ga0307414_10025453 3300032004 Bacteria 3792
232 Ga0307414_10028591 3300032004 Bacteria 3618
233 Ga0307414_10132654 3300032004 Bacteria 1936
234 Ga0307507_10000036 3300033179 Bacteria 187512
235 Ga0307510_10000733 3300033180 Bacteria 33678
236 Ga0373927_0007737 3300035695 Bacteria 7272
237 Ga0395899_0000001 3300037312 Bacteria 1750322
238 Ga0395899_0000289 3300037312 Bacteria 64799
239 Ga0395899_0003279 3300037312 Bacteria 12831
240 Ga0395899_0063611 3300037312 Unclassified 2714
241 Ga0395900_0000095 3300037418 Bacteria 164383
242 Ga0395900_0000370 3300037418 Bacteria 64745
243 Ga0395900_0027547 3300037418 Bacteria 5822
244 Ga0395900_0172231 3300037418 Bacteria 2203
245 Ga0395898_0075145 3300037466 Bacteria 3264
246 Ga0395905_0000001 3300037471 Bacteria 2037079
247 Ga0395905_0000147 3300037471 Bacteria 116389
248 Ga0395905_0000529 3300037471 Bacteria 52320
249 Ga0395905_0005279 3300037471 Bacteria 13210
250 Ga0395901_0000580 3300038443 Bacteria 42442
251 Ga0436361_0269064 3300039447 Bacteria 23413
252 Ga0451577_0000240 3300042876 Bacteria 108418
253 Ga0451577_0001803 3300042876 Bacteria 27398
254 Ga0451577_0037338 3300042876 Unclassified 4373
255 Ga0451577_0126387 3300042876 Unclassified 2291
256 Ga0451577_0156275 3300042876 Bacteria 2053
257 Ga0453683_0011984 3300044673 Bacteria 5695
258 Ga0453683_0109564 3300044673 Bacteria 1736
259 Ga0453684_0001944 3300044712 Bacteria 53295
260 Ga0453684_0003053 3300044712 Bacteria 38867
261 Ga0453684_0003254 3300044712 Bacteria 37126
262 Ga0453684_0009287 3300044712 Bacteria 17259
263 Ga0453684_0012824 3300044712 Bacteria 13741
264 Ga0453684_0080573 3300044712 Bacteria 4065
265 Ga0453684_0097076 3300044712 Bacteria 3618
266 Ga0453684_0113022 3300044712 Bacteria 3295
267 Ga0451576_0000002 3300045051 Bacteria 1670975
268 Ga0451576_0019463 3300045051 Bacteria 7408
269 Ga0451576_0049460 3300045051 Bacteria 4411
270 Ga0451576_0286419 3300045051 Bacteria 1722
271 Ga0466958_0039001 3300045836 Bacteria 2852
272 Ga0495627_021165 3300046453 Bacteria 2159
273 Ga0495650_0000127 3300046471 Bacteria 177276
274 Ga0495585_0000294 3300046492 Bacteria 50289
275 Ga0495585_0000947 3300046492 Bacteria 24468
276 Ga0495583_0031922 3300046506 Bacteria 2547
277 Ga0495583_0060011 3300046506 Bacteria 1702
278 Ga0495606_0000035 3300046507 Bacteria 243820
279 Ga0495606_0007374 3300046507 Bacteria 9870
280 Ga0495606_0015879 3300046507 Bacteria 5778
281 Ga0495610_0000051 3300046512 Bacteria 143715
282 Ga0495610_0000113 3300046512 Bacteria 94595
283 Ga0495610_0001720 3300046512 Bacteria 19174
284 Ga0495610_0031878 3300046512 Bacteria 2744
285 Ga0495616_0007240 3300046513 Bacteria 6645
286 Ga0495616_0029122 3300046513 Bacteria 2918
287 Ga0495628_0139330 3300046516 Bacteria 1852
288 Ga0495644_0011103 3300046523 Bacteria 3472
289 Ga0495648_0097883 3300046524 Bacteria 1626
290 Ga0495609_0009625 3300046538 Bacteria 4669
291 Ga0495609_0046734 3300046538 Bacteria 1938
292 Ga0495633_0000027 3300046558 Bacteria 204613
293 Ga0495633_0000175 3300046558 Bacteria 83653
294 Ga0495633_0006699 3300046558 Bacteria 6783
295 Ga0495633_0025960 3300046558 Bacteria 2879
296 Ga0495668_0000112 3300046616 Bacteria 128501
297 Ga0495625_0000144 3300046660 Bacteria 109247
298 Ga0495625_0000785 3300046660 Bacteria 44141
299 Ga0495625_0001065 3300046660 Bacteria 35829
300 Ga0495625_0018343 3300046660 Bacteria 5465
301 Ga0495625_0023222 3300046660 Bacteria 4740
302 Ga0495625_0074570 3300046660 Bacteria 2376
303 Ga0495661_0008288 3300046665 Bacteria 7201
304 Ga0495661_0014848 3300046665 Bacteria 5210
305 Ga0495661_0020508 3300046665 Bacteria 4313
306 Ga0495661_0068105 3300046665 Bacteria 2089
307 Ga0495658_0032436 3300046683 Bacteria 2852
308 Ga0495649_0000385 3300046694 Bacteria 38373
309 Ga0495660_0015708 3300046810 Bacteria 4372
310 Ga0495683_0029686 3300047323 Bacteria 2794
311 Ga0495687_000264 3300047443 Bacteria 70552
312 Ga0495687_001084 3300047443 Bacteria 26743
313 Ga0495685_021514 3300047447 Bacteria 2219
314 Ga0495686_0002549 3300047472 Bacteria 17008
315 Ga0495686_0008395 3300047472 Bacteria 7579
316 Ga0495686_0029236 3300047472 Bacteria 3586
317 Ga0495686_0071673 3300047472 Bacteria 2132
318 Ga0495614_0043963 3300048089 Bacteria 1916
319 Ga0496117_0012024 3300048920 Bacteria 7686
320 Ga0496122_0000404 3300048925 Bacteria 91618
321 Ga0496122_0007053 3300048925 Bacteria 12632
322 Ga0496126_0008948 3300048929 Bacteria 10722
323 Ga0496126_0170569 3300048929 Bacteria 1854
324 Ga0495678_009955 3300049459 Bacteria 4656
325 Ga0501300_000598 3300049523 Bacteria 5404
326 Ga0501199_000556 3300049650 Bacteria 3317
327 Ga0501223_008745 3300049663 Bacteria 2062
328 Ga0501238_004666 3300049671 Bacteria 1719
329 Ga0501247_001457 3300049677 Bacteria 2287
330 Ga0501257_000916 3300049686 Bacteria 5974
331 Ga0501259_001642 3300049688 Bacteria 3723
332 Ga0501080_0282512 3300049742 Bacteria 1509
333 Ga0501241_002874 3300049758 Bacteria 3300
334 Ga0501264_000136 3300049761 Bacteria 11583
335 nmdc:mga0k408_10577_c1 3300050493 Bacteria 4995
336 nmdc:mga0k408_1074_c1 3300050493 Bacteria 15034
337 nmdc:mga0k408_1340_c1 3300050493 Bacteria 13307
338 Ga0500635_0000314 3300053080 Bacteria 16905
339 Ga0500644_0000182 3300053088 Bacteria 40141
340 Ga0500583_0002176 3300053092 Bacteria 5822
341 Ga0500608_009780 3300053122 Bacteria 4088
342 Ga0500577_0000633 3300053142 Bacteria 9007
343 Ga0500616_0000004 3300053153 Bacteria 1002714
344 Ga0500616_0008115 3300053153 Bacteria 6566
345 Ga0500616_0015819 3300053153 Bacteria 4307
346 Ga0500616_0028434 3300053153 Bacteria 3081
347 Ga0500622_0001039 3300053156 Bacteria 23193
348 Ga0500622_0003214 3300053156 Bacteria 11110
349 Ga0500624_000368 3300053157 Bacteria 14523
350 Ga0500633_0003002 3300053160 Bacteria 3600
351 Ga0500661_001816 3300055283 Bacteria 4029
352 2522552764 2522125168 Bacteria 7376607
353 2586209599 2585427687 Bacteria 5544917
354 2599480196 2599185184 Bacteria 6430550
355 2722730519 2721755487 Bacteria 6357185
356 2738756972 2738541283 Bacteria 7222293
357 2738760281 2738541284 Bacteria 5199923
358 2738852106 2738541302 Bacteria 5944758
359 2739302403 2738543023 Bacteria 6767879
360 2739589719 2739367651 Bacteria 6359826
361 2739616504 2739367656 Bacteria 5152243
362 2739647144 2739367663 Bacteria 5040914
363 2776612331 2775506987 Bacteria 5373360
364 2819546646 2818991437 Bacteria 5805520
365 2819681939 2818991460 Bacteria 7595395
366 2842725338 2842722452 Bacteria 6263924
367 2842906910 2842903701 Bacteria 6986368
368 2842912614 2842909656 Bacteria 6185908
369 2849281874 2849281842 Bacteria 6065644
370 2852624639 2852623160 Bacteria 4376875
371 2852631445 2852627209 Bacteria 5896285
372 2857629624 2857627736 Bacteria 5625397
373 2884635289 2884634485 Bacteria 3928637
374 2884936477 2884933994 Bacteria 4535041
375 2887377166 2887375801 Bacteria 5334027
376 2890739253 2890737413 Bacteria 4269751
377 2895503108 2895498888 Bacteria 5283788
378 2896321239 2896317667 Bacteria 4606601
379 2896345502 2896344016 Bacteria 3811746
380 2898716700 2898713307 Bacteria 4110805
381 2902052476 2902048731 Bacteria 4976191
382 2904446785 2904445276 Bacteria 5310396
383 2904785489 2904780799 Bacteria 5840761
384 2919182036 2919177583 Bacteria 5641607
385 2919189553 2919186247 Bacteria 6244071
386 2919438435 2919437846 Bacteria 6199444
387 2919693221 2919692658 Bacteria 5943958
388 2928083642 2928078545 Bacteria 6534839
389 2928151099 2928147474 Bacteria 6512076
390 2929178504 2929177148 Bacteria 7883697
391 2932084399 2932082852 Bacteria 6563563
392 2939667779 2939664404 Bacteria 6364494
393 2945980904 2945977869 Bacteria 7777518
394 2946002257 2945997725 Bacteria 6404843
395 2954019156 2954016120 Bacteria 6446024
396 2977236381 2977232053 Bacteria 5485925
397 3003233742 3003233435 Bacteria 4458031
398 Ga0068855_100025999
399 JGI24739J22299_10004953
400 JGI24739J22299_10016854
401 JGI24739J22299_10019223
402 JGI24737J22298_10003280
403 JGI24737J22298_10003858
404 JGI24735J21928_10000008
405 JGI25162J39368_1000059
406 JGI25162J39368_1000823
407 JGI25162J39368_1000899
408 JGI25150J39212_1000001
409 JGI25151J46595_10000001
410 JGI25165J46597_1000739
411 JGI25153J46596_10000001
412 rootH1_10005789
413 rootH1_10009733
414 rootH2_10008353
415 rootH2_10037436
416 rootH2_10056133
417 rootL2_10203625
418 rootH1_10006386
419 rootH1_10012013
420 rootH1_10029533
421 rootH1_10043086
422 rootH1_10043692
423 rootH1_10183235
424 rootH1_10198768
425 Ga0055542_1003720
426 Ga0055530_10002202
427 Ga0055531_10000027
428 Ga0065165_1000185
429 Ga0065165_1001091
430 Ga0065165_1013511
431 Ga0065714_10005204
432 Ga0065714_10064484
433 Ga0065714_10091650
434 Ga0065704_10114808
435 Ga0070658_10000045
436 Ga0070658_10127012
437 Ga0070676_10000819
438 Ga0070680_100007736
439 Ga0068868_100044671
440 Ga0070660_100028899
441 Ga0070659_100000188
442 Ga0070678_100001431
443 Ga0070662_100000838
444 Ga0070681_10000745
445 Ga0068867_100001069
446 Ga0070679_100008263
447 Ga0070679_100044258
448 Ga0068853_100024278
449 Ga0068853_100058949
450 Ga0068853_100059873
451 Ga0070665_100000034
452 Ga0068855_100000049
453 Ga0068855_100011192
454 Ga0068855_100035707
455 Ga0068857_100027218
456 Ga0068857_100070048
457 Ga0068856_100000056
458 Ga0068856_100020764
459 Ga0068852_100002106
460 Ga0075366_10000457
461 Ga0075366_10006916
462 Ga0097621_100000182
463 Ga0068871_100002531
464 Ga0068865_100000178
465 Ga0105244_10012178
466 Ga0105240_10000200
467 Ga0105240_10036278
468 Ga0105240_10046849
469 Ga0105240_10118832
470 Ga0105240_10120121
471 Ga0105240_10193664
472 Ga0105243_10000036
473 Ga0105241_10001938
474 Ga0105241_10114538
475 Ga0105242_10040413
476 Ga0105237_10000239
477 Ga0105237_10001125
478 Ga0105237_10001530
479 Ga0105237_10007163
480 Ga0105237_10008693
481 Ga0105237_10157694
482 Ga0105237_10157695
483 Ga0105237_10172424
484 Ga0105238_10034113
485 Ga0105238_10062673
486 Ga0105239_10000001
487 Ga0105239_10000059
488 Ga0105239_10001792
489 Ga0105239_10003333
490 Ga0105239_10052735
491 Ga0105239_10138231
492 Ga0157373_10000332
493 Ga0157373_10008003
494 Ga0157373_10013923
495 Ga0157373_10015820
496 Ga0157373_10026382
497 Ga0157371_10000805
498 Ga0157371_10000849
499 Ga0157371_10000922
500 Ga0157371_10002216
501 Ga0157371_10004228
502 Ga0157371_10007176
503 Ga0157371_10020371
504 Ga0157370_10000531
505 Ga0157370_10000693
506 Ga0157370_10006252
507 Ga0157370_10034880
508 Ga0157370_10045132
509 Ga0157369_10000040
510 Ga0157369_10000664
511 Ga0157369_10041872
512 Ga0157369_10103597
513 Ga0157369_10119354
514 Ga0157369_10129563
515 Ga0157374_10001036
516 Ga0157374_10001740
517 Ga0157378_10011692
518 Ga0157378_10023939
519 Ga0157378_10104135
520 Ga0163162_10000116
521 Ga0163162_10000558
522 Ga0163162_10007180
523 Ga0157372_10000109
524 Ga0157372_10001137
525 Ga0157372_10008123
526 Ga0157372_10010904
527 Ga0157372_10041583
528 Ga0157372_10092502
529 Ga0157372_10105667
530 Ga0157375_10015825
531 Ga0157375_10046883
532 Ga0157375_10101484
533 Ga0163163_10262426
534 Ga0182008_10000006
535 Ga0182008_10000272
536 Ga0157377_10031026
537 Ga0182006_1000568
538 Ga0182006_1002594
539 Ga0182007_10000033
540 Ga0183373_1001
541 Ga0163161_10000085
542 Ga0163161_10000249
543 Ga0163161_10001695
544 Ga0163161_10004998
545 Ga0163161_10022486
546 Ga0209436_103217
547 Ga0209437_100010
548 Ga0209437_100169
549 Ga0209258_100041
550 Ga0207425_1000002
551 Ga0209026_1000646
552 Ga0209148_1000090
553 Ga0209129_1000002
554 Ga0209233_1000017
555 Ga0209233_1003862
556 Ga0209233_1005653
557 Ga0209455_1001199
558 Ga0209130_1001027
559 Ga0209676_1000008
560 Ga0209676_1004411
561 Ga0209025_1000004
562 Ga0209758_1000006
563 Ga0209050_1000055
564 Ga0207426_1000177
565 Ga0209257_1000001
566 Ga0207647_10000128
567 Ga0207647_10000238
568 Ga0207645_10000169
569 Ga0207705_10000080
570 Ga0207654_10018195
571 Ga0207707_10024568
572 Ga0207695_10000055
573 Ga0207695_10029712
574 Ga0207695_10040951
575 Ga0207695_10061361
576 Ga0207671_10002729
577 Ga0207671_10003117
578 Ga0207671_10011083
579 Ga0207671_10024689
580 Ga0207671_10048644
581 Ga0207660_10027265
582 Ga0207652_10064068
583 Ga0207694_10184209
584 Ga0207690_10001303
585 Ga0207706_10000679
586 Ga0207686_10055277
587 Ga0207709_10000007
588 Ga0207704_10000114
589 Ga0207667_10000015
590 Ga0207667_10003651
591 Ga0207667_10007607
592 Ga0207667_10061762
593 Ga0207677_10036571
594 Ga0207639_10010338
595 Ga0207639_10018597
596 Ga0207702_10000082
597 Ga0207641_10267915
598 Ga0207648_10000123
599 Ga0207683_10010104
600 Ga0207698_10001021
601 Ga0268266_10000111
602 Ga0307517_10010325
603 Ga0307515_10002940
604 Ga0307515_10014904
605 Ga0307515_10148324
606 Ga0265338_10193044
607 Ga0316177_1197492
608 Ga0316176_1003080
609 Ga0316183_1096868
610 Ga0316181_1179416
611 Ga0265327_10001298
612 Ga0265316_10071521
613 Ga0307509_10144359
614 Ga0307408_100000445
615 Ga0307408_100001255
616 Ga0307408_100004038
617 Ga0307408_100104615
618 Ga0265314_10090738
619 Ga0307405_10000003
620 Ga0307407_10000010
621 Ga0307416_100000014
622 Ga0307414_10000228
623 Ga0307414_10003196
624 Ga0307414_10016737
625 Ga0307414_10020160
626 Ga0307414_10025453
627 Ga0307414_10028591
628 Ga0307414_10132654
629 Ga0307507_10000036
630 Ga0307510_10000733
631 Ga0373927_0007737
632 Ga0395899_0000001
633 Ga0395899_0000289
634 Ga0395899_0003279
635 Ga0395899_0063611
636 Ga0395900_0000095
637 Ga0395900_0000370
638 Ga0395900_0027547
639 Ga0395900_0172231
640 Ga0395898_0075145
641 Ga0395905_0000001
642 Ga0395905_0000147
643 Ga0395905_0000529
644 Ga0395905_0005279
645 Ga0395901_0000580
646 Ga0436361_0269064
647 Ga0451577_0000240
648 Ga0451577_0001803
649 Ga0451577_0037338
650 Ga0451577_0126387
651 Ga0451577_0156275
652 Ga0453683_0011984
653 Ga0453683_0109564
654 Ga0453684_0001944
655 Ga0453684_0003053
656 Ga0453684_0003254
657 Ga0453684_0009287
658 Ga0453684_0012824
659 Ga0453684_0080573
660 Ga0453684_0097076
661 Ga0453684_0113022
662 Ga0451576_0000002
663 Ga0451576_0019463
664 Ga0451576_0049460
665 Ga0451576_0286419
666 Ga0466958_0039001
667 Ga0495627_021165
668 Ga0495650_0000127
669 Ga0495585_0000294
670 Ga0495585_0000947
671 Ga0495583_0031922
672 Ga0495583_0060011
673 Ga0495606_0000035
674 Ga0495606_0007374
675 Ga0495606_0015879
676 Ga0495610_0000051
677 Ga0495610_0000113
678 Ga0495610_0001720
679 Ga0495610_0031878
680 Ga0495616_0007240
681 Ga0495616_0029122
682 Ga0495628_0139330
683 Ga0495644_0011103
684 Ga0495648_0097883
685 Ga0495609_0009625
686 Ga0495609_0046734
687 Ga0495633_0000027
688 Ga0495633_0000175
689 Ga0495633_0006699
690 Ga0495633_0025960
691 Ga0495668_0000112
692 Ga0495625_0000144
693 Ga0495625_0000785
694 Ga0495625_0001065
695 Ga0495625_0018343
696 Ga0495625_0023222
697 Ga0495625_0074570
698 Ga0495661_0008288
699 Ga0495661_0014848
700 Ga0495661_0020508
701 Ga0495661_0068105
702 Ga0495658_0032436
703 Ga0495649_0000385
704 Ga0495660_0015708
705 Ga0495683_0029686
706 Ga0495687_000264
707 Ga0495687_001084
708 Ga0495685_021514
709 Ga0495686_0002549
710 Ga0495686_0008395
711 Ga0495686_0029236
712 Ga0495686_0071673
713 Ga0495614_0043963
714 Ga0496117_0012024
715 Ga0496122_0000404
716 Ga0496122_0007053
717 Ga0496126_0008948
718 Ga0496126_0170569
719 Ga0495678_009955
720 Ga0501300_000598
721 Ga0501199_000556
722 Ga0501223_008745
723 Ga0501238_004666
724 Ga0501247_001457
725 Ga0501257_000916
726 Ga0501259_001642
727 Ga0501080_0282512
728 Ga0501241_002874
729 Ga0501264_000136
730 nmdc:mga0k408_10577_c1
731 nmdc:mga0k408_1074_c1
732 nmdc:mga0k408_1340_c1
733 Ga0500635_0000314
734 Ga0500644_0000182
735 Ga0500583_0002176
736 Ga0500608_009780
737 Ga0500577_0000633
738 Ga0500616_0000004
739 Ga0500616_0008115
740 Ga0500616_0015819
741 Ga0500616_0028434
742 Ga0500622_0001039
743 Ga0500622_0003214
744 Ga0500624_000368
745 Ga0500633_0003002
746 Ga0500661_001816
747 2522552764
748 2586209599
749 2599480196
750 2722730519
751 2738756972
752 2738760281
753 2738852106
754 2739302403
755 2739589719
756 2739616504
757 2739647144
758 2776612331
759 2819546646
760 2819681939
761 2842725338
762 2842906910
763 2842912614
764 2849281874
765 2852624639
766 2852631445
767 2857629624
768 2884635289
769 2884936477
770 2887377166
771 2890739253
772 2895503108
773 2896321239
774 2896345502
775 2898716700
776 2902052476
777 2904446785
778 2904785489
779 2919182036
780 2919189553
781 2919438435
782 2919693221
783 2928083642
784 2928151099
785 2929178504
786 2932084399
787 2939667779
788 2945980904
789 2946002257
790 2954019156
791 2977236381
792 3003233742

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00579

tRNA-synt_1b

tRNA synthetases class I (W and Y)

24

319

0.97

PF22421

SYY_C-terminal

Tyrosine--tRNA ligase SYY-like C-terminal domain

404

463

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wq3-assembly1.cif.gz_A escherichia coli tyrosyl-trna synthetase mutant complexed with 3-iodo-l-tyrosine 0.9061 2 300
1tya-assembly1.cif.gz_E-2 structural analysis of a series of mutants of tyrosyl-trna synthetase: enhancement of catalysis by hydrophobic interactions 0.9039 1 303
1tyd-assembly1.cif.gz_E-2 structure of tyrosyl-trna synthetase refined at 2.3 angstroms resolution. interaction of the enzyme with the tyrosyl adenylate intermediate 0.9033 1 303
1tyb-assembly1.cif.gz_E-2 structural analysis of a series of mutants of tyrosyl-trna synthetase: enhancement of catalysis by hydrophobic interactions 0.903 1 303
2ts1-assembly1.cif.gz_A structure of tyrosyl-t/rna synthetase refined at 2.3 angstroms resolution. interaction of the enzyme with the tyrosyl adenylate intermediate 0.903 1 303
ID Description Score Start End Superfamily
4ts1B02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9821 207 295 1.10.240.10
2pidA02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9693 223 304 1.10.240.10
3zxiB02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9664 223 304 1.10.240.10
2pidB02 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9655 223 304 1.10.240.10
af_O74890_238_344_1.10.240.10 Mainly Alpha;Orthogonal Bundle;Tyrosyl-Transfer RNA Synthetase;Tyrosyl-Transfer RNA Synthetase 0.9625 207 306 1.10.240.10
ID Description Score Start End GO Terms
AF-A0A269XEI3-F1-model_v4 Tyrosine--tRNA ligase 0.9866 207 299 GO:0004831
GO:0005524
GO:0005829
GO:0006418
AF-A0A5D0IME9-F1-model_v4 Tyrosine--tRNA ligase (EC 6.1.1.1) 0.98 165 285 GO:0004831
GO:0005524
GO:0005829
GO:0006437
AF-A0A358DH60-F1-model_v4 Tyrosine--tRNA ligase 0.9738 331 411 GO:0003723
GO:0016874
AF-A0A376YA39-F1-model_v4 Tyrosine--tRNA ligase (EC 6.1.1.1) 0.9733 158 268 GO:0004831
GO:0005524
GO:0005829
GO:0006437
AF-A0A5D0IME9-F1-model_v4 Tyrosine--tRNA ligase (EC 6.1.1.1) 0.9721 165 285 GO:0004831
GO:0005524
GO:0005829
GO:0006437

Map