F433417

General Info

Members Datasets Scaffolds Average Seq Length
396 229 792 158

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100966439|Ga0070669_1009664391
Length 162
Sequence MNTRNLSYVVALGGVAMALMLQSGPSLAAQVPAAQSASRAERTVWYFYRVKWGHQDEFLDLFRKNHYPVLKEEVKTGRMTSVRTFVPTYHGDGRADWTFAVALTYRDAAAMTGPSNDAEIVRRLYPDQATFVKEEQRRFEILDAHWDVPLNELDLETRTPPK

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
92 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
141 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
145 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
146 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
147 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
148 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
149 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
150 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
151 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
154 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
159 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
160 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
161 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
162 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
163 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
164 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
169 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
170 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
171 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
189 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
190 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
210 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.22
Metatranscriptomes 2.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.04
Rhizosphere 95.45
Stem 0
Stem Tuber 0
Unclassified 20.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100966439 3300005353 Unclassified 730
2 SwRhRL3b_contig_592280 2162886006 Unclassified 932
3 MRS1b_contig_6163580 2162886011 Unclassified 1106
4 Ga0065714_10122823 3300005288 Bacteria 1328
5 Ga0065712_10073441 3300005290 Bacteria 4388
6 Ga0065715_10095861 3300005293 Bacteria 3993
7 Ga0065715_10127652 3300005293 Bacteria 2082
8 Ga0065715_10254954 3300005293 Unclassified 1155
9 Ga0065707_10128397 3300005295 Bacteria 1956
10 Ga0065707_10142844 3300005295 Unclassified 1750
11 Ga0070683_100328278 3300005329 Bacteria 1456
12 Ga0070670_100198014 3300005331 Bacteria 1745
13 Ga0070666_10028461 3300005335 Bacteria 3667
14 Ga0070682_100008130 3300005337 Bacteria 5916
15 Ga0070682_100221378 3300005337 Bacteria 1347
16 Ga0068868_100002026 3300005338 Bacteria 13925
17 Ga0070689_100552625 3300005340 Archaea 992
18 Ga0070687_100825085 3300005343 Unclassified 659
19 Ga0070661_100001466 3300005344 Bacteria 16389
20 Ga0070668_100005814 3300005347 Bacteria 9149
21 Ga0070669_100010562 3300005353 Bacteria 6556
22 Ga0070671_100138316 3300005355 Bacteria 2054
23 Ga0070673_101848553 3300005364 Bacteria 572
24 Ga0070688_100072750 3300005365 Bacteria 2203
25 Ga0070667_100058333 3300005367 Bacteria 3263
26 Ga0070709_10210688 3300005434 Bacteria 1381
27 Ga0070709_10474811 3300005434 Bacteria 946
28 Ga0070714_100837889 3300005435 Unclassified 891
29 Ga0070713_100399967 3300005436 Unclassified 1283
30 Ga0070710_10012578 3300005437 Bacteria 4208
31 Ga0070710_10457613 3300005437 Unclassified 866
32 Ga0070711_100191463 3300005439 Unclassified 1572
33 Ga0070711_101210789 3300005439 Unclassified 653
34 Ga0070705_100002061 3300005440 Bacteria 10259
35 Ga0070705_100002302 3300005440 Bacteria 9649
36 Ga0070694_100069383 3300005444 Bacteria 2425
37 Ga0070708_100004098 3300005445 Bacteria 11443
38 Ga0070708_100031187 3300005445 Unclassified 4612
39 Ga0070708_100048341 3300005445 Bacteria 3760
40 Ga0070708_100054594 3300005445 Bacteria 3549
41 Ga0070708_100171092 3300005445 Bacteria 2028
42 Ga0070663_100002712 3300005455 Bacteria 10016
43 Ga0070663_100022395 3300005455 Bacteria 4225
44 Ga0070662_100015183 3300005457 Bacteria 5154
45 Ga0070662_100502759 3300005457 Unclassified 1011
46 Ga0070662_100708587 3300005457 Unclassified 852
47 Ga0070681_10498154 3300005458 Bacteria 1131
48 Ga0070685_10362105 3300005466 Unclassified 994
49 Ga0070706_100005569 3300005467 Bacteria 11989
50 Ga0070706_100322253 3300005467 Bacteria 1441
51 Ga0070706_100438080 3300005467 Unclassified 1216
52 Ga0070706_100644693 3300005467 Unclassified 983
53 Ga0070707_100004001 3300005468 Bacteria 13873
54 Ga0070707_100169029 3300005468 Bacteria 2131
55 Ga0070707_100334587 3300005468 Bacteria 1471
56 Ga0070707_100547703 3300005468 Unclassified 1119
57 Ga0070698_100019235 3300005471 Bacteria 7174
58 Ga0070698_100051328 3300005471 Bacteria 4201
59 Ga0070698_100259236 3300005471 Bacteria 1671
60 Ga0070698_100676368 3300005471 Bacteria 974
61 Ga0070698_101107672 3300005471 Bacteria 740
62 Ga0070699_100000094 3300005518 Bacteria 85329
63 Ga0070699_100001097 3300005518 Bacteria 25198
64 Ga0070699_100084324 3300005518 Bacteria 2773
65 Ga0070699_100093233 3300005518 Bacteria 2635
66 Ga0070679_100001256 3300005530 Bacteria 22367
67 Ga0070684_100005982 3300005535 Bacteria 9373
68 Ga0070697_100001294 3300005536 Bacteria 18842
69 Ga0070697_100011719 3300005536 Bacteria 6857
70 Ga0070697_100021934 3300005536 Bacteria 5066
71 Ga0070697_100065094 3300005536 Bacteria 2978
72 Ga0070697_100143483 3300005536 Bacteria 2009
73 Ga0070697_100245540 3300005536 Bacteria 1530
74 Ga0070697_100265899 3300005536 Bacteria 1469
75 Ga0070697_101409040 3300005536 Unclassified 622
76 Ga0070697_102114048 3300005536 Unclassified 504
77 Ga0070672_100036470 3300005543 Bacteria 3746
78 Ga0070672_100156604 3300005543 Bacteria 1887
79 Ga0070686_100029896 3300005544 Bacteria 3318
80 Ga0070695_100037912 3300005545 Bacteria 3039
81 Ga0070695_100093453 3300005545 Bacteria 2013
82 Ga0070695_100134028 3300005545 Bacteria 1710
83 Ga0070696_100000740 3300005546 Bacteria 20843
84 Ga0070696_100001303 3300005546 Bacteria 16265
85 Ga0070696_100374332 3300005546 Bacteria 1108
86 Ga0070693_100001006 3300005547 Bacteria 12576
87 Ga0070665_101242657 3300005548 Unclassified 755
88 Ga0070704_100006564 3300005549 Bacteria 6861
89 Ga0070704_100031440 3300005549 Bacteria 3571
90 Ga0070704_100164094 3300005549 Bacteria 1760
91 Ga0068855_100141947 3300005563 Bacteria 2736
92 Ga0068855_100875626 3300005563 Unclassified 950
93 Ga0070664_100000164 3300005564 Bacteria 45854
94 Ga0070664_100051695 3300005564 Bacteria 3479
95 Ga0070664_100054351 3300005564 Bacteria 3397
96 Ga0070664_100600515 3300005564 Unclassified 1021
97 Ga0068857_100030777 3300005577 Bacteria 4741
98 Ga0068857_100123820 3300005577 Unclassified 2329
99 Ga0068857_100167117 3300005577 Bacteria 1998
100 Ga0068856_100019487 3300005614 Bacteria 6585
101 Ga0068856_100970283 3300005614 Unclassified 868
102 Ga0068852_100019826 3300005616 Bacteria 5333
103 Ga0068852_100489442 3300005616 Bacteria 1223
104 Ga0068859_100142215 3300005617 Bacteria 2473
105 Ga0068859_100744472 3300005617 Bacteria 1069
106 Ga0068864_100189525 3300005618 Bacteria 1884
107 Ga0068864_100416620 3300005618 Bacteria 1279
108 Ga0068866_10132431 3300005718 Bacteria 1420
109 Ga0068861_100009988 3300005719 Bacteria 6573
110 Ga0068861_100038104 3300005719 Bacteria 3577
111 Ga0068861_100179721 3300005719 Bacteria 1760
112 Ga0068851_10007348 3300005834 Bacteria 5054
113 Ga0068858_100018785 3300005842 Bacteria 6466
114 Ga0068858_100085288 3300005842 Bacteria 2938
115 Ga0068860_100037930 3300005843 Bacteria 4612
116 Ga0068860_100153723 3300005843 Bacteria 2217
117 Ga0068862_100017838 3300005844 Bacteria 5910
118 Ga0068862_100061031 3300005844 Bacteria 3240
119 Ga0068862_101022718 3300005844 Unclassified 818
120 Ga0081539_10000517 3300005985 Bacteria 80413
121 Ga0070717_10037256 3300006028 Bacteria 3949
122 Ga0070717_10116378 3300006028 Bacteria 2286
123 Ga0070715_10017402 3300006163 Bacteria 2721
124 Ga0070715_10505885 3300006163 Unclassified 692
125 Ga0070716_100001859 3300006173 Bacteria 9569
126 Ga0070716_100060404 3300006173 Bacteria 2189
127 Ga0070716_100494087 3300006173 Bacteria 901
128 Ga0070716_100827512 3300006173 Bacteria 719
129 Ga0070712_100582908 3300006175 Unclassified 945
130 Ga0097621_100009628 3300006237 Bacteria 7024
131 Ga0075428_100010675 3300006844 Bacteria 10211
132 Ga0075428_100011862 3300006844 Bacteria 9694
133 Ga0075428_100865726 3300006844 Unclassified 959
134 Ga0075428_101156133 3300006844 Unclassified 816
135 Ga0075431_100007642 3300006847 Bacteria 10763
136 Ga0075434_100306499 3300006871 Bacteria 1608
137 Ga0075429_100031444 3300006880 Bacteria 4613
138 Ga0075429_101293388 3300006880 Unclassified 636
139 Ga0075436_100000696 3300006914 Bacteria 22198
140 Ga0075436_100050824 3300006914 Bacteria 2861
141 Ga0075436_100169583 3300006914 Bacteria 1541
142 Ga0097620_100142209 3300006931 Bacteria 2473
143 Ga0097620_100744353 3300006931 Bacteria 1069
144 Ga0099794_10032252 3300007265 Bacteria 2458
145 Ga0099794_10063458 3300007265 Unclassified 1798
146 Ga0099794_10068823 3300007265 Bacteria 1731
147 Ga0099794_10150040 3300007265 Bacteria 1183
148 Ga0099794_10207496 3300007265 Bacteria 1004
149 Ga0105240_10059592 3300009093 Bacteria 4763
150 Ga0111539_10004869 3300009094 Bacteria 17485
151 Ga0111539_10033510 3300009094 Bacteria 6236
152 Ga0111539_10453874 3300009094 Unclassified 1493
153 Ga0105247_10007088 3300009101 Bacteria 6884
154 Ga0114129_10084980 3300009147 Bacteria 4391
155 Ga0105243_11762250 3300009148 Unclassified 649
156 Ga0105248_10549128 3300009177 Bacteria 1303
157 Ga0105249_10004136 3300009553 Bacteria 12536
158 Ga0099796_10017588 3300010159 Bacteria 2132
159 Ga0105239_10473821 3300010375 Unclassified 1422
160 Ga0105246_10331035 3300011119 Bacteria 1241
161 Ga0157374_10073325 3300013296 Bacteria 3231
162 Ga0157374_10816438 3300013296 Unclassified 949
163 Ga0157378_10000114 3300013297 Bacteria 77298
164 Ga0163162_10134174 3300013306 Bacteria 2586
165 Ga0163162_10894038 3300013306 Unclassified 1002
166 Ga0157372_10420115 3300013307 Unclassified 1558
167 Ga0157375_10273425 3300013308 Bacteria 1852
168 Ga0163163_10132260 3300014325 Bacteria 2535
169 Ga0163163_10238553 3300014325 Bacteria 1868
170 Ga0157380_10472933 3300014326 Bacteria 1210
171 Ga0157380_11594779 3300014326 Unclassified 708
172 Ga0157379_10190773 3300014968 Bacteria 1852
173 Ga0157379_10563346 3300014968 Unclassified 1061
174 Ga0224570_102048 3300022730 Bacteria 1386
175 Ga0228598_1000850 3300024227 Bacteria 6604
176 Ga0228598_1001183 3300024227 Bacteria 5749
177 Ga0228598_1003117 3300024227 Bacteria 3591
178 Ga0207697_10239964 3300025315 Unclassified 801
179 Ga0207653_10001235 3300025885 Bacteria 8357
180 Ga0207692_10008708 3300025898 Bacteria 4212
181 Ga0207710_10209652 3300025900 Unclassified 964
182 Ga0207688_10179593 3300025901 Bacteria 1262
183 Ga0207680_10183253 3300025903 Unclassified 1417
184 Ga0207647_10636782 3300025904 Unclassified 586
185 Ga0207699_10059816 3300025906 Bacteria 2285
186 Ga0207699_10066143 3300025906 Bacteria 2193
187 Ga0207699_10193895 3300025906 Bacteria 1372
188 Ga0207645_10009069 3300025907 Bacteria 6904
189 Ga0207684_10007499 3300025910 Bacteria 9819
190 Ga0207684_10032109 3300025910 Bacteria 4465
191 Ga0207684_10036495 3300025910 Bacteria 4171
192 Ga0207684_10070077 3300025910 Bacteria 2980
193 Ga0207707_10403091 3300025912 Bacteria 1174
194 Ga0207707_10978248 3300025912 Unclassified 695
195 Ga0207693_10136826 3300025915 Bacteria 1926
196 Ga0207663_10030556 3300025916 Unclassified 3178
197 Ga0207660_10089076 3300025917 Unclassified 2284
198 Ga0207649_10026190 3300025920 Unclassified 3409
199 Ga0207652_10009451 3300025921 Bacteria 7839
200 Ga0207652_10547412 3300025921 Unclassified 1040
201 Ga0207646_10001171 3300025922 Bacteria 33235
202 Ga0207646_10001512 3300025922 Bacteria 28625
203 Ga0207646_10167871 3300025922 Bacteria 1981
204 Ga0207646_10359857 3300025922 Unclassified 1315
205 Ga0207646_10486270 3300025922 Unclassified 1113
206 Ga0207646_10494433 3300025922 Bacteria 1102
207 Ga0207646_11384008 3300025922 Unclassified 612
208 Ga0207681_10009802 3300025923 Bacteria 5860
209 Ga0207681_10026086 3300025923 Bacteria 3766
210 Ga0207681_11021741 3300025923 Bacteria 694
211 Ga0207681_11406947 3300025923 Bacteria 585
212 Ga0207650_10024769 3300025925 Unclassified 4270
213 Ga0207650_10130064 3300025925 Bacteria 1969
214 Ga0207650_10395581 3300025925 Bacteria 1143
215 Ga0207659_10190462 3300025926 Bacteria 1632
216 Ga0207687_10011597 3300025927 Bacteria 5762
217 Ga0207700_10874872 3300025928 Unclassified 804
218 Ga0207700_11485202 3300025928 Unclassified 601
219 Ga0207664_10648312 3300025929 Bacteria 949
220 Ga0207644_10238809 3300025931 Bacteria 1446
221 Ga0207706_10682333 3300025933 Unclassified 878
222 Ga0207686_10014823 3300025934 Bacteria 4350
223 Ga0207709_10032709 3300025935 Bacteria 3048
224 Ga0207670_10087390 3300025936 Bacteria 2196
225 Ga0207665_10000023 3300025939 Bacteria 104745
226 Ga0207665_10028741 3300025939 Bacteria 3675
227 Ga0207665_10176213 3300025939 Bacteria 1547
228 Ga0207691_10051911 3300025940 Bacteria 3746
229 Ga0207711_10157928 3300025941 Unclassified 2051
230 Ga0207711_10381635 3300025941 Bacteria 1308
231 Ga0207689_10025271 3300025942 Bacteria 4977
232 Ga0207661_10025004 3300025944 Bacteria 4534
233 Ga0207679_10013609 3300025945 Bacteria 5334
234 Ga0207679_10032533 3300025945 Bacteria 3662
235 Ga0207679_10996146 3300025945 Unclassified 768
236 Ga0207712_10011219 3300025961 Bacteria 5706
237 Ga0207668_10010385 3300025972 Bacteria 5625
238 Ga0207677_10002758 3300026023 Bacteria 9276
239 Ga0207677_11680447 3300026023 Bacteria 588
240 Ga0207703_10246162 3300026035 Bacteria 1609
241 Ga0207678_10051550 3300026067 Bacteria 3553
242 Ga0207702_10042012 3300026078 Bacteria 3834
243 Ga0207702_10918423 3300026078 Unclassified 868
244 Ga0207674_10068835 3300026116 Bacteria 3561
245 Ga0207674_10135736 3300026116 Bacteria 2422
246 Ga0207674_10206269 3300026116 Bacteria 1915
247 Ga0207674_10282824 3300026116 Bacteria 1607
248 Ga0207675_100020319 3300026118 Bacteria 6192
249 Ga0207675_100448362 3300026118 Bacteria 1278
250 Ga0207683_10085330 3300026121 Bacteria 2807
251 Ga0207698_10373147 3300026142 Bacteria 1355
252 Ga0209179_1006993 3300027512 Bacteria 1846
253 Ga0209588_1002316 3300027671 Bacteria 5155
254 Ga0209588_1013310 3300027671 Bacteria 2508
255 Ga0209588_1014495 3300027671 Unclassified 2414
256 Ga0209588_1081673 3300027671 Unclassified 1044
257 Ga0209588_1131321 3300027671 Bacteria 799
258 Ga0207428_10012882 3300027907 Bacteria 7331
259 Ga0207428_10037455 3300027907 Unclassified 3945
260 Ga0207428_10085748 3300027907 Bacteria 2452
261 Ga0265354_1003618 3300028016 Bacteria 1708
262 Ga0265354_1015435 3300028016 Unclassified 723
263 Ga0265356_1002366 3300028017 Bacteria 2535
264 Ga0265356_1005546 3300028017 Bacteria 1503
265 Ga0265356_1005638 3300028017 Bacteria 1486
266 Ga0268266_10074112 3300028379 Bacteria 2955
267 Ga0268264_10027886 3300028381 Bacteria 4617
268 Ga0265337_1000646 3300028556 Bacteria 18381
269 Ga0265337_1118149 3300028556 Bacteria 719
270 Ga0265326_10000464 3300028558 Bacteria 15837
271 Ga0265319_1000340 3300028563 Bacteria 34215
272 Ga0265319_1000463 3300028563 Bacteria 28782
273 Ga0265334_10000349 3300028573 Bacteria 24705
274 Ga0265334_10056509 3300028573 Bacteria 1490
275 Ga0265318_10003072 3300028577 Bacteria 8582
276 Ga0265323_10001676 3300028653 Bacteria 10597
277 Ga0265322_10000277 3300028654 Bacteria 21745
278 Ga0265336_10000109 3300028666 Bacteria 62807
279 Ga0265338_10000773 3300028800 Bacteria 54534
280 Ga0265338_10001759 3300028800 Bacteria 34223
281 Ga0265338_10134168 3300028800 Bacteria 1949
282 Ga0265338_10652021 3300028800 Bacteria 730
283 Ga0265324_10002346 3300029957 Bacteria 9783
284 Ga0265324_10003066 3300029957 Bacteria 8150
285 Ga0265762_1000673 3300030760 Bacteria 6019
286 Ga0265762_1000876 3300030760 Bacteria 5361
287 Ga0265762_1002847 3300030760 Bacteria 3093
288 Ga0265762_1041577 3300030760 Unclassified 901
289 Ga0265765_1000099 3300030879 Bacteria 4890
290 Ga0265765_1003260 3300030879 Bacteria 1619
291 Ga0265773_1008619 3300031018 Unclassified 822
292 Ga0265760_10000115 3300031090 Bacteria 20404
293 Ga0265760_10001761 3300031090 Bacteria 6366
294 Ga0265760_10006404 3300031090 Bacteria 3368
295 Ga0265760_10006907 3300031090 Bacteria 3254
296 Ga0265330_10042299 3300031235 Bacteria 2019
297 Ga0265332_10002643 3300031238 Bacteria 9002
298 Ga0265328_10058601 3300031239 Bacteria 1414
299 Ga0265320_10001583 3300031240 Bacteria 16343
300 Ga0265320_10002378 3300031240 Bacteria 13151
301 Ga0265320_10225178 3300031240 Unclassified 835
302 Ga0265329_10001087 3300031242 Bacteria 13356
303 Ga0265340_10008629 3300031247 Bacteria 5492
304 Ga0265331_10007184 3300031250 Bacteria 6471
305 Ga0265316_10011687 3300031344 Bacteria 7906
306 Ga0265316_10020696 3300031344 Bacteria 5593
307 Ga0265316_10108657 3300031344 Bacteria 2103
308 Ga0265316_10273762 3300031344 Unclassified 1235
309 Ga0265313_10000728 3300031595 Bacteria 33869
310 Ga0265314_10001709 3300031711 Bacteria 23835
311 Ga0265342_10003885 3300031712 Bacteria 12011
312 Ga0265342_10037060 3300031712 Bacteria 2976
313 Ga0265342_10335390 3300031712 Bacteria 790
314 Ga0316212_1002260 3300033547 Bacteria 2736
315 Ga0373926_0243996 3300035083 Bacteria 696
316 Ga0373926_0355969 3300035083 Bacteria 575
317 Ga0373934_0000278 3300035086 Bacteria 18457
318 Ga0373932_0234058 3300035112 Unclassified 665
319 Ga0373936_0007176 3300035113 Bacteria 4195
320 Ga0373945_0040557 3300035116 Bacteria 1681
321 Ga0373957_0004131 3300035120 Bacteria 4386
322 Ga0373943_0131569 3300035170 Bacteria 1339
323 Ga0373943_0239558 3300035170 Unclassified 1016
324 Ga0373946_0023291 3300035171 Bacteria 2418
325 Ga0373955_0001155 3300035172 Bacteria 11200
326 Ga0373955_0392193 3300035172 Unclassified 843
327 Ga0373924_0057193 3300035410 Bacteria 1626
328 Ga0373924_0061476 3300035410 Bacteria 1572
329 Ga0373935_0014247 3300035692 Bacteria 4799
330 Ga0373935_1214908 3300035692 Unclassified 562
331 Ga0373927_0000250 3300035695 Bacteria 42453
332 Ga0373927_0359048 3300035695 Unclassified 960
333 Ga0373933_0001361 3300035724 Bacteria 14408
334 Ga0373933_0180362 3300035724 Bacteria 1347
335 Ga0373947_0001109 3300035725 Bacteria 16525
336 Ga0373937_0000937 3300036401 Bacteria 24763
337 Ga0373937_0186608 3300036401 Bacteria 1948
338 Ga0373937_0429013 3300036401 Bacteria 1255
339 Ga0373925_0000395 3300037068 Bacteria 44643
340 Ga0373925_0416057 3300037068 Unclassified 1098
341 Ga0395898_0633636 3300037466 Bacteria 1012
342 Ga0395905_0755351 3300037471 Bacteria 875
343 Ga0451853_1003689 3300041512 Bacteria 608
344 Ga0451577_0068871 3300042876 Bacteria 3155
345 Ga0451577_0425370 3300042876 Bacteria 1206
346 Ga0466969_0384161 3300044656 Unclassified 637
347 Ga0466963_0425713 3300044694 Bacteria 936
348 Ga0453684_0171857 3300044712 Bacteria 2553
349 Ga0495592_0019343 3300046454 Bacteria 5181
350 Ga0495580_0224471 3300046472 Bacteria 1290
351 Ga0495608_0049214 3300046511 Bacteria 2798
352 Ga0495630_0010431 3300046517 Bacteria 6708
353 Ga0495666_0122463 3300046526 Unclassified 1217
354 Ga0495667_0054655 3300046559 Bacteria 2627
355 Ga0495635_0701976 3300046663 Unclassified 656
356 Ga0495623_0379957 3300046679 Unclassified 764
357 Ga0495646_0153363 3300046680 Bacteria 1280
358 Ga0495658_0529104 3300046683 Unclassified 755
359 Ga0495624_0412622 3300046690 Bacteria 810
360 Ga0495600_0160061 3300046809 Bacteria 1455
361 Ga0495604_0004639 3300047317 Bacteria 10893
362 Ga0495674_0013089 3300047319 Bacteria 7804
363 Ga0495676_0118837 3300047321 Bacteria 1927
364 Ga0495684_0058934 3300047471 Bacteria 2924
365 Ga0495593_0529731 3300047673 Unclassified 591
366 Ga0495602_0000372 3300048088 Bacteria 41731
367 Ga0496102_0034222 3300048905 Bacteria 4569
368 Ga0496103_0131372 3300048906 Bacteria 1599
369 Ga0496104_0005501 3300048907 Bacteria 11093
370 Ga0496104_0179604 3300048907 Bacteria 2027
371 Ga0496105_0345621 3300048908 Bacteria 1189
372 Ga0496107_0091860 3300048910 Bacteria 2219
373 Ga0496108_0033938 3300048911 Unclassified 4238
374 Ga0496109_0000118 3300048912 Bacteria 81929
375 Ga0496109_0010052 3300048912 Bacteria 8075
376 Ga0496109_0511574 3300048912 Bacteria 1133
377 Ga0496110_0002149 3300048913 Bacteria 14707
378 Ga0496111_0050196 3300048914 Bacteria 3008
379 Ga0496112_0029854 3300048915 Bacteria 5274
380 Ga0496112_0041426 3300048915 Bacteria 4507
381 Ga0496112_0118099 3300048915 Bacteria 2622
382 Ga0496113_0338279 3300048916 Bacteria 1207
383 nmdc:mga05p37_148108_c1 3300050507 Bacteria 2873
384 nmdc:mga05p37_38710_c1 3300050507 Bacteria 5850
385 nmdc:mga09592_110259_c1 3300050508 Bacteria 2361
386 nmdc:mga06r32_5508_c1 3300050510 Bacteria 11403
387 nmdc:mga08y16_11401_c1 3300050511 Bacteria 9340
388 nmdc:mga08y16_19001_c1 3300050511 Bacteria 7238
389 nmdc:mga08y16_49106_c1 3300050511 Bacteria 4416
390 nmdc:mga0n895_139454_c1 3300050512 Bacteria 2452
391 nmdc:mga0n895_70580_c1 3300050512 Unclassified 3462
392 nmdc:mga0rr50_703406_c1 3300050513 Unclassified 862
393 nmdc:mga08x19_236_c1 3300050514 Bacteria 42242
394 nmdc:mga08x19_42431_c1 3300050514 Bacteria 2900
395 nmdc:mga0a205_107076_c1 3300050515 Bacteria 2693
396 nmdc:mga0a205_24399_c1 3300050515 Bacteria 5750
397 Ga0070669_100966439
398 SwRhRL3b_contig_592280
399 MRS1b_contig_6163580
400 Ga0065714_10122823
401 Ga0065712_10073441
402 Ga0065715_10095861
403 Ga0065715_10127652
404 Ga0065715_10254954
405 Ga0065707_10128397
406 Ga0065707_10142844
407 Ga0070683_100328278
408 Ga0070670_100198014
409 Ga0070666_10028461
410 Ga0070682_100008130
411 Ga0070682_100221378
412 Ga0068868_100002026
413 Ga0070689_100552625
414 Ga0070687_100825085
415 Ga0070661_100001466
416 Ga0070668_100005814
417 Ga0070669_100010562
418 Ga0070671_100138316
419 Ga0070673_101848553
420 Ga0070688_100072750
421 Ga0070667_100058333
422 Ga0070709_10210688
423 Ga0070709_10474811
424 Ga0070714_100837889
425 Ga0070713_100399967
426 Ga0070710_10012578
427 Ga0070710_10457613
428 Ga0070711_100191463
429 Ga0070711_101210789
430 Ga0070705_100002061
431 Ga0070705_100002302
432 Ga0070694_100069383
433 Ga0070708_100004098
434 Ga0070708_100031187
435 Ga0070708_100048341
436 Ga0070708_100054594
437 Ga0070708_100171092
438 Ga0070663_100002712
439 Ga0070663_100022395
440 Ga0070662_100015183
441 Ga0070662_100502759
442 Ga0070662_100708587
443 Ga0070681_10498154
444 Ga0070685_10362105
445 Ga0070706_100005569
446 Ga0070706_100322253
447 Ga0070706_100438080
448 Ga0070706_100644693
449 Ga0070707_100004001
450 Ga0070707_100169029
451 Ga0070707_100334587
452 Ga0070707_100547703
453 Ga0070698_100019235
454 Ga0070698_100051328
455 Ga0070698_100259236
456 Ga0070698_100676368
457 Ga0070698_101107672
458 Ga0070699_100000094
459 Ga0070699_100001097
460 Ga0070699_100084324
461 Ga0070699_100093233
462 Ga0070679_100001256
463 Ga0070684_100005982
464 Ga0070697_100001294
465 Ga0070697_100011719
466 Ga0070697_100021934
467 Ga0070697_100065094
468 Ga0070697_100143483
469 Ga0070697_100245540
470 Ga0070697_100265899
471 Ga0070697_101409040
472 Ga0070697_102114048
473 Ga0070672_100036470
474 Ga0070672_100156604
475 Ga0070686_100029896
476 Ga0070695_100037912
477 Ga0070695_100093453
478 Ga0070695_100134028
479 Ga0070696_100000740
480 Ga0070696_100001303
481 Ga0070696_100374332
482 Ga0070693_100001006
483 Ga0070665_101242657
484 Ga0070704_100006564
485 Ga0070704_100031440
486 Ga0070704_100164094
487 Ga0068855_100141947
488 Ga0068855_100875626
489 Ga0070664_100000164
490 Ga0070664_100051695
491 Ga0070664_100054351
492 Ga0070664_100600515
493 Ga0068857_100030777
494 Ga0068857_100123820
495 Ga0068857_100167117
496 Ga0068856_100019487
497 Ga0068856_100970283
498 Ga0068852_100019826
499 Ga0068852_100489442
500 Ga0068859_100142215
501 Ga0068859_100744472
502 Ga0068864_100189525
503 Ga0068864_100416620
504 Ga0068866_10132431
505 Ga0068861_100009988
506 Ga0068861_100038104
507 Ga0068861_100179721
508 Ga0068851_10007348
509 Ga0068858_100018785
510 Ga0068858_100085288
511 Ga0068860_100037930
512 Ga0068860_100153723
513 Ga0068862_100017838
514 Ga0068862_100061031
515 Ga0068862_101022718
516 Ga0081539_10000517
517 Ga0070717_10037256
518 Ga0070717_10116378
519 Ga0070715_10017402
520 Ga0070715_10505885
521 Ga0070716_100001859
522 Ga0070716_100060404
523 Ga0070716_100494087
524 Ga0070716_100827512
525 Ga0070712_100582908
526 Ga0097621_100009628
527 Ga0075428_100010675
528 Ga0075428_100011862
529 Ga0075428_100865726
530 Ga0075428_101156133
531 Ga0075431_100007642
532 Ga0075434_100306499
533 Ga0075429_100031444
534 Ga0075429_101293388
535 Ga0075436_100000696
536 Ga0075436_100050824
537 Ga0075436_100169583
538 Ga0097620_100142209
539 Ga0097620_100744353
540 Ga0099794_10032252
541 Ga0099794_10063458
542 Ga0099794_10068823
543 Ga0099794_10150040
544 Ga0099794_10207496
545 Ga0105240_10059592
546 Ga0111539_10004869
547 Ga0111539_10033510
548 Ga0111539_10453874
549 Ga0105247_10007088
550 Ga0114129_10084980
551 Ga0105243_11762250
552 Ga0105248_10549128
553 Ga0105249_10004136
554 Ga0099796_10017588
555 Ga0105239_10473821
556 Ga0105246_10331035
557 Ga0157374_10073325
558 Ga0157374_10816438
559 Ga0157378_10000114
560 Ga0163162_10134174
561 Ga0163162_10894038
562 Ga0157372_10420115
563 Ga0157375_10273425
564 Ga0163163_10132260
565 Ga0163163_10238553
566 Ga0157380_10472933
567 Ga0157380_11594779
568 Ga0157379_10190773
569 Ga0157379_10563346
570 Ga0224570_102048
571 Ga0228598_1000850
572 Ga0228598_1001183
573 Ga0228598_1003117
574 Ga0207697_10239964
575 Ga0207653_10001235
576 Ga0207692_10008708
577 Ga0207710_10209652
578 Ga0207688_10179593
579 Ga0207680_10183253
580 Ga0207647_10636782
581 Ga0207699_10059816
582 Ga0207699_10066143
583 Ga0207699_10193895
584 Ga0207645_10009069
585 Ga0207684_10007499
586 Ga0207684_10032109
587 Ga0207684_10036495
588 Ga0207684_10070077
589 Ga0207707_10403091
590 Ga0207707_10978248
591 Ga0207693_10136826
592 Ga0207663_10030556
593 Ga0207660_10089076
594 Ga0207649_10026190
595 Ga0207652_10009451
596 Ga0207652_10547412
597 Ga0207646_10001171
598 Ga0207646_10001512
599 Ga0207646_10167871
600 Ga0207646_10359857
601 Ga0207646_10486270
602 Ga0207646_10494433
603 Ga0207646_11384008
604 Ga0207681_10009802
605 Ga0207681_10026086
606 Ga0207681_11021741
607 Ga0207681_11406947
608 Ga0207650_10024769
609 Ga0207650_10130064
610 Ga0207650_10395581
611 Ga0207659_10190462
612 Ga0207687_10011597
613 Ga0207700_10874872
614 Ga0207700_11485202
615 Ga0207664_10648312
616 Ga0207644_10238809
617 Ga0207706_10682333
618 Ga0207686_10014823
619 Ga0207709_10032709
620 Ga0207670_10087390
621 Ga0207665_10000023
622 Ga0207665_10028741
623 Ga0207665_10176213
624 Ga0207691_10051911
625 Ga0207711_10157928
626 Ga0207711_10381635
627 Ga0207689_10025271
628 Ga0207661_10025004
629 Ga0207679_10013609
630 Ga0207679_10032533
631 Ga0207679_10996146
632 Ga0207712_10011219
633 Ga0207668_10010385
634 Ga0207677_10002758
635 Ga0207677_11680447
636 Ga0207703_10246162
637 Ga0207678_10051550
638 Ga0207702_10042012
639 Ga0207702_10918423
640 Ga0207674_10068835
641 Ga0207674_10135736
642 Ga0207674_10206269
643 Ga0207674_10282824
644 Ga0207675_100020319
645 Ga0207675_100448362
646 Ga0207683_10085330
647 Ga0207698_10373147
648 Ga0209179_1006993
649 Ga0209588_1002316
650 Ga0209588_1013310
651 Ga0209588_1014495
652 Ga0209588_1081673
653 Ga0209588_1131321
654 Ga0207428_10012882
655 Ga0207428_10037455
656 Ga0207428_10085748
657 Ga0265354_1003618
658 Ga0265354_1015435
659 Ga0265356_1002366
660 Ga0265356_1005546
661 Ga0265356_1005638
662 Ga0268266_10074112
663 Ga0268264_10027886
664 Ga0265337_1000646
665 Ga0265337_1118149
666 Ga0265326_10000464
667 Ga0265319_1000340
668 Ga0265319_1000463
669 Ga0265334_10000349
670 Ga0265334_10056509
671 Ga0265318_10003072
672 Ga0265323_10001676
673 Ga0265322_10000277
674 Ga0265336_10000109
675 Ga0265338_10000773
676 Ga0265338_10001759
677 Ga0265338_10134168
678 Ga0265338_10652021
679 Ga0265324_10002346
680 Ga0265324_10003066
681 Ga0265762_1000673
682 Ga0265762_1000876
683 Ga0265762_1002847
684 Ga0265762_1041577
685 Ga0265765_1000099
686 Ga0265765_1003260
687 Ga0265773_1008619
688 Ga0265760_10000115
689 Ga0265760_10001761
690 Ga0265760_10006404
691 Ga0265760_10006907
692 Ga0265330_10042299
693 Ga0265332_10002643
694 Ga0265328_10058601
695 Ga0265320_10001583
696 Ga0265320_10002378
697 Ga0265320_10225178
698 Ga0265329_10001087
699 Ga0265340_10008629
700 Ga0265331_10007184
701 Ga0265316_10011687
702 Ga0265316_10020696
703 Ga0265316_10108657
704 Ga0265316_10273762
705 Ga0265313_10000728
706 Ga0265314_10001709
707 Ga0265342_10003885
708 Ga0265342_10037060
709 Ga0265342_10335390
710 Ga0316212_1002260
711 Ga0373926_0243996
712 Ga0373926_0355969
713 Ga0373934_0000278
714 Ga0373932_0234058
715 Ga0373936_0007176
716 Ga0373945_0040557
717 Ga0373957_0004131
718 Ga0373943_0131569
719 Ga0373943_0239558
720 Ga0373946_0023291
721 Ga0373955_0001155
722 Ga0373955_0392193
723 Ga0373924_0057193
724 Ga0373924_0061476
725 Ga0373935_0014247
726 Ga0373935_1214908
727 Ga0373927_0000250
728 Ga0373927_0359048
729 Ga0373933_0001361
730 Ga0373933_0180362
731 Ga0373947_0001109
732 Ga0373937_0000937
733 Ga0373937_0186608
734 Ga0373937_0429013
735 Ga0373925_0000395
736 Ga0373925_0416057
737 Ga0395898_0633636
738 Ga0395905_0755351
739 Ga0451853_1003689
740 Ga0451577_0068871
741 Ga0451577_0425370
742 Ga0466969_0384161
743 Ga0466963_0425713
744 Ga0453684_0171857
745 Ga0495592_0019343
746 Ga0495580_0224471
747 Ga0495608_0049214
748 Ga0495630_0010431
749 Ga0495666_0122463
750 Ga0495667_0054655
751 Ga0495635_0701976
752 Ga0495623_0379957
753 Ga0495646_0153363
754 Ga0495658_0529104
755 Ga0495624_0412622
756 Ga0495600_0160061
757 Ga0495604_0004639
758 Ga0495674_0013089
759 Ga0495676_0118837
760 Ga0495684_0058934
761 Ga0495593_0529731
762 Ga0495602_0000372
763 Ga0496102_0034222
764 Ga0496103_0131372
765 Ga0496104_0005501
766 Ga0496104_0179604
767 Ga0496105_0345621
768 Ga0496107_0091860
769 Ga0496108_0033938
770 Ga0496109_0000118
771 Ga0496109_0010052
772 Ga0496109_0511574
773 Ga0496110_0002149
774 Ga0496111_0050196
775 Ga0496112_0029854
776 Ga0496112_0041426
777 Ga0496112_0118099
778 Ga0496113_0338279
779 nmdc:mga05p37_148108_c1
780 nmdc:mga05p37_38710_c1
781 nmdc:mga09592_110259_c1
782 nmdc:mga06r32_5508_c1
783 nmdc:mga08y16_11401_c1
784 nmdc:mga08y16_19001_c1
785 nmdc:mga08y16_49106_c1
786 nmdc:mga0n895_139454_c1
787 nmdc:mga0n895_70580_c1
788 nmdc:mga0rr50_703406_c1
789 nmdc:mga08x19_236_c1
790 nmdc:mga08x19_42431_c1
791 nmdc:mga0a205_107076_c1
792 nmdc:mga0a205_24399_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4d4f-assembly1.cif.gz_F mutant p250a of bacterial chalcone isomerase from eubacterium ramulus 0.777 37 106
3f44-assembly1.cif.gz_A crystal structure of putative monooxygenase (yp_193413.1) from lactobacillus acidophilus ncfm at 1.55 a resolution 0.7097 35 147
2ftr-assembly1.cif.gz_B crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 a resolution 0.709 38 149
1si9-assembly1.cif.gz_A boiling stable protein isolated from populus tremula 0.7065 34 146
1q53-assembly1.cif.gz_B solution structure of hypothetical arabidopsis thaliana protein at3g17210. center for eukaryotic structural genomics target 13081 0.7055 34 151
ID Description Score Start End Superfamily
af_Q55CR9_1_97_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.714 35 149 3.30.70.100
1q53B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7055 34 151 3.30.70.100
af_Q55CR9_1_97_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6956 35 149 3.30.70.100
af_Q67XD6_173_269_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6946 40 150 3.30.70.100
3qmqB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.686 36 150 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A1F2TD55-F1-model_v4 EthD domain-containing protein 0.9387 37 151
AF-A0A2W0BFE5-F1-model_v4 EthD domain-containing protein 0.9377 34 149
AF-A0A522P6S2-F1-model_v4 Uncharacterized protein 0.9351 35 151
AF-A0A2V8ZYP0-F1-model_v4 EthD domain-containing protein 0.9334 31 153
AF-A0A7V8WC39-F1-model_v4 EthD domain-containing protein 0.9331 35 153

Map