F433336

General Info

Members Datasets Scaffolds Average Seq Length
395 249 790 199

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0012985|Ga0501032_0012985_4354_5025
Length 223
Sequence MSSVKFNSYNEDAPSLPLSEEGAGGRRPTIAIIKYNAGNIRSVLYALERLGYTAVVTDDPDEIRATDKVIFPGVGEANSAMKYLKERQLDKLIVSLTQPVLGICLGMQLMCDYSEENNTPCLGIFNETVKKFVAENNNFKIPQIGWNTIYDLQTALFKNVKENSYCYFVHGYYASRGEHTISTTNYIQPYSSGLHKNNFYGVQFHPEKSASTGELILKNFLTL

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
91 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
92 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
141 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
142 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
143 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
144 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
145 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
148 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
153 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
159 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
164 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
165 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
170 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
176 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
218 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
225 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
226 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
227 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
228 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
229 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
230 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
231 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
232 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
233 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
234 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
235 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
236 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
237 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
238 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
239 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
240 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
243 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
244 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
245 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
246 2914759650 Rhizosphaericola mali Isolate Rhizosphere
247 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
248 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
249 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.72
Metatranscriptomes 0.25
Isolates 2.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.15
Nodule 0
Rhizoplane 1.77
Rhizosphere 78.48
Stem 0
Stem Tuber 0
Unclassified 7.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0012985 3300049569 Bacteria 5931
2 JGI24740J21852_10058705 3300001979 Bacteria 1069
3 JGI24739J22299_10001962 3300001989 Bacteria 7876
4 JGI24739J22299_10037467 3300001989 Bacteria 1634
5 JGI24737J22298_10115886 3300001990 Bacteria 792
6 JGI25154J39366_1000040 3300002738 Bacteria 147410
7 JGI25157J39369_1006606 3300002741 Bacteria 1746
8 JGI25153J46596_10003586 3300003215 Bacteria 8623
9 JGI25153J46596_10022508 3300003215 Bacteria 2321
10 rootH2_10019144 3300003320 Bacteria 8706
11 rootH2_10119381 3300003320 Bacteria 2957
12 rootL2_10043559 3300003322 Bacteria 4472
13 rootL2_10098609 3300003322 Bacteria 2449
14 rootL2_10121802 3300003322 Bacteria 2604
15 rootL2_10142371 3300003322 Bacteria 2432
16 rootH1_10057366 3300003323 Bacteria 4409
17 rootH1_10092915 3300003323 Bacteria 1280
18 JGI25160J50197_1003836 3300003354 Bacteria 6603
19 Ga0055535_1004391 3300003761 Bacteria 3441
20 Ga0055542_1002855 3300003762 Bacteria 5146
21 Ga0055526_1017086 3300003771 Bacteria 2796
22 Ga0055526_1019095 3300003771 Bacteria 2515
23 Ga0055528_1001650 3300003790 Bacteria 13115
24 Ga0055530_10000387 3300003791 Bacteria 39558
25 Ga0055531_10000131 3300003794 Bacteria 85257
26 Ga0055531_10044025 3300003794 Bacteria 1256
27 Ga0055543_1022335 3300004625 Bacteria 1149
28 Ga0065165_1000102 3300005262 Bacteria 140917
29 Ga0065165_1012054 3300005262 Bacteria 3550
30 Ga0065704_10366376 3300005289 Bacteria 791
31 Ga0065712_10078473 3300005290 Bacteria 3329
32 Ga0065712_10319169 3300005290 Bacteria 831
33 Ga0065707_10178007 3300005295 Bacteria 1437
34 Ga0070658_10072589 3300005327 Bacteria 2821
35 Ga0070683_100405352 3300005329 Bacteria 1300
36 Ga0070690_100182809 3300005330 Bacteria 1449
37 Ga0070670_100033933 3300005331 Bacteria 4393
38 Ga0070670_100152134 3300005331 Bacteria 2003
39 Ga0070670_100327823 3300005331 Bacteria 1342
40 Ga0068869_100073112 3300005334 Bacteria 2542
41 Ga0068869_100506385 3300005334 Bacteria 1009
42 Ga0070680_100002139 3300005336 Bacteria 14605
43 Ga0070682_100003820 3300005337 Bacteria 8368
44 Ga0068868_100023232 3300005338 Bacteria 4691
45 Ga0068868_100111038 3300005338 Bacteria 2228
46 Ga0070660_100357606 3300005339 Bacteria 1203
47 Ga0070660_100882679 3300005339 Bacteria 754
48 Ga0070689_100020120 3300005340 Bacteria 4948
49 Ga0070689_100020256 3300005340 Bacteria 4933
50 Ga0070691_10003425 3300005341 Bacteria 7127
51 Ga0070669_100077385 3300005353 Bacteria 2471
52 Ga0070669_100259481 3300005353 Bacteria 1386
53 Ga0070669_100346815 3300005353 Bacteria 1204
54 Ga0070675_100065867 3300005354 Bacteria 2996
55 Ga0070675_100112580 3300005354 Bacteria 2304
56 Ga0070675_101151428 3300005354 Unclassified 714
57 Ga0070671_100004803 3300005355 Bacteria 10743
58 Ga0070671_100396734 3300005355 Bacteria 1180
59 Ga0070674_100988004 3300005356 Bacteria 738
60 Ga0070688_100001700 3300005365 Bacteria 10987
61 Ga0070688_100012936 3300005365 Bacteria 4691
62 Ga0070659_100415078 3300005366 Bacteria 1138
63 Ga0070667_100020321 3300005367 Bacteria 5512
64 Ga0070700_100186029 3300005441 Bacteria 1449
65 Ga0070663_100125151 3300005455 Bacteria 1947
66 Ga0070681_10080396 3300005458 Bacteria 3215
67 Ga0070685_10013492 3300005466 Bacteria 4310
68 Ga0070698_100003420 3300005471 Bacteria 17437
69 Ga0070698_100003956 3300005471 Bacteria 16296
70 Ga0070679_100016595 3300005530 Bacteria 7110
71 Ga0070684_100089885 3300005535 Bacteria 2730
72 Ga0068853_100057348 3300005539 Bacteria 3361
73 Ga0068853_100165071 3300005539 Unclassified 2001
74 Ga0070693_100009189 3300005547 Bacteria 4910
75 Ga0068855_100101266 3300005563 Bacteria 3316
76 Ga0068855_100179167 3300005563 Bacteria 2397
77 Ga0068855_100996671 3300005563 Bacteria 880
78 Ga0070664_100012802 3300005564 Bacteria 6824
79 Ga0070664_100173466 3300005564 Bacteria 1914
80 Ga0068857_100019040 3300005577 Bacteria 6024
81 Ga0068857_100134513 3300005577 Bacteria 2232
82 Ga0068857_100207047 3300005577 Bacteria 1789
83 Ga0068857_100328630 3300005577 Bacteria 1413
84 Ga0068857_100763350 3300005577 Bacteria 921
85 Ga0068859_100160451 3300005617 Bacteria 2327
86 Ga0068859_100164449 3300005617 Bacteria 2298
87 Ga0068859_100492183 3300005617 Bacteria 1321
88 Ga0068864_100016359 3300005618 Bacteria 6174
89 Ga0068864_100113698 3300005618 Bacteria 2413
90 Ga0068864_100123178 3300005618 Bacteria 2321
91 Ga0068864_100750684 3300005618 Bacteria 956
92 Ga0068866_10046333 3300005718 Bacteria 2186
93 Ga0068861_100017109 3300005719 Bacteria 5140
94 Ga0068863_100000412 3300005841 Bacteria 43521
95 Ga0068863_100144687 3300005841 Unclassified 2273
96 Ga0068863_100158539 3300005841 Bacteria 2167
97 Ga0068863_100231505 3300005841 Bacteria 1782
98 Ga0068863_100379320 3300005841 Unclassified 1380
99 Ga0068863_100530218 3300005841 Unclassified 1161
100 Ga0068858_100119979 3300005842 Bacteria 2458
101 Ga0068860_100301404 3300005843 Bacteria 1570
102 Ga0068862_100490710 3300005844 Bacteria 1164
103 Ga0075366_10172124 3300006195 Bacteria 1314
104 Ga0097621_100003432 3300006237 Bacteria 10914
105 Ga0097621_100188305 3300006237 Bacteria 1786
106 Ga0075370_10237562 3300006353 Bacteria 1079
107 Ga0068871_100000027 3300006358 Bacteria 78588
108 Ga0075429_100982562 3300006880 Bacteria 738
109 Ga0097620_100160447 3300006931 Bacteria 2327
110 Ga0097620_100164445 3300006931 Bacteria 2298
111 Ga0097620_100492189 3300006931 Bacteria 1321
112 Ga0111539_10625410 3300009094 Bacteria 1254
113 Ga0105247_10003977 3300009101 Bacteria 9513
114 Ga0105241_10000881 3300009174 Bacteria 22671
115 Ga0105241_10088986 3300009174 Unclassified 2432
116 Ga0105242_10605607 3300009176 Bacteria 1059
117 Ga0105242_11049643 3300009176 Bacteria 826
118 Ga0105248_10015617 3300009177 Bacteria 8370
119 Ga0105249_10037570 3300009553 Bacteria 4395
120 Ga0105239_10240133 3300010375 Bacteria 2033
121 Ga0105239_10414000 3300010375 Bacteria 1526
122 Ga0105239_10789318 3300010375 Bacteria 1088
123 Ga0105246_10272486 3300011119 Bacteria 1354
124 Ga0105246_10346027 3300011119 Bacteria 1217
125 Ga0157373_10394559 3300013100 Bacteria 991
126 Ga0157370_10006823 3300013104 Bacteria 12514
127 Ga0157370_10236700 3300013104 Bacteria 1690
128 Ga0157374_10004285 3300013296 Bacteria 11997
129 Ga0157378_10049342 3300013297 Bacteria 3744
130 Ga0157378_10463732 3300013297 Bacteria 1259
131 Ga0163162_10005326 3300013306 Bacteria 12412
132 Ga0163162_10022730 3300013306 Bacteria 6183
133 Ga0157375_10000229 3300013308 Bacteria 52257
134 Ga0157375_10149140 3300013308 Bacteria 2472
135 Ga0157375_10468795 3300013308 Bacteria 1425
136 Ga0157375_10963172 3300013308 Bacteria 994
137 Ga0163163_10000538 3300014325 Bacteria 33542
138 Ga0163163_10024468 3300014325 Bacteria 5748
139 Ga0163163_10196032 3300014325 Bacteria 2068
140 Ga0157380_11277447 3300014326 Bacteria 780
141 Ga0157377_10003461 3300014745 Bacteria 7154
142 Ga0157379_10001640 3300014968 Bacteria 18479
143 Ga0157379_10042217 3300014968 Bacteria 4071
144 Ga0157379_10283371 3300014968 Bacteria 1508
145 Ga0157376_10014178 3300014969 Bacteria 5972
146 Ga0157376_10347591 3300014969 Bacteria 1418
147 Ga0157376_10868945 3300014969 Bacteria 918
148 Ga0157376_11323049 3300014969 Bacteria 751
149 Ga0182005_1000263 3300015265 Bacteria 33328
150 Ga0163161_10242136 3300017792 Bacteria 1403
151 Ga0213876_10002105 3300021384 Bacteria 11776
152 Ga0209258_100151 3300025242 Bacteria 160444
153 Ga0209646_1000002 3300025246 Bacteria 1425781
154 Ga0209646_1010802 3300025246 Bacteria 1423
155 Ga0209026_1000434 3300025250 Bacteria 34861
156 Ga0209148_1000154 3300025254 Bacteria 145214
157 Ga0209673_1000208 3300025273 Bacteria 117755
158 Ga0209564_1004681 3300025295 Bacteria 8211
159 Ga0209564_1008371 3300025295 Bacteria 5113
160 Ga0209564_1038219 3300025295 Bacteria 1339
161 Ga0209758_1006777 3300025297 Bacteria 8046
162 Ga0209758_1010527 3300025297 Bacteria 5516
163 Ga0209050_1000134 3300025298 Bacteria 184417
164 Ga0207426_1000497 3300025302 Bacteria 58506
165 Ga0207426_1001981 3300025302 Bacteria 14539
166 Ga0207426_1007508 3300025302 Bacteria 4550
167 Ga0209051_1039269 3300025303 Bacteria 1712
168 Ga0209257_1000001 3300025304 Bacteria 2274655
169 Ga0209257_1001605 3300025304 Bacteria 25882
170 Ga0207697_10182977 3300025315 Bacteria 919
171 Ga0207710_10008558 3300025900 Bacteria 4313
172 Ga0207643_10023368 3300025908 Bacteria 3408
173 Ga0207654_10003491 3300025911 Bacteria 7952
174 Ga0207654_10063187 3300025911 Bacteria 2172
175 Ga0207707_10000051 3300025912 Bacteria 117204
176 Ga0207707_10225495 3300025912 Bacteria 1631
177 Ga0207660_10005186 3300025917 Bacteria 8471
178 Ga0207662_10016297 3300025918 Bacteria 4192
179 Ga0207657_10282452 3300025919 Bacteria 1317
180 Ga0207652_10000384 3300025921 Bacteria 46082
181 Ga0207681_10037670 3300025923 Bacteria 3198
182 Ga0207681_10080679 3300025923 Bacteria 2295
183 Ga0207681_10301704 3300025923 Bacteria 1267
184 Ga0207650_10042343 3300025925 Bacteria 3341
185 Ga0207650_10156234 3300025925 Bacteria 1804
186 Ga0207659_10008155 3300025926 Bacteria 6484
187 Ga0207659_10048018 3300025926 Bacteria 3022
188 Ga0207659_10355237 3300025926 Bacteria 1217
189 Ga0207659_11015269 3300025926 Unclassified 714
190 Ga0207644_10002938 3300025931 Bacteria 10975
191 Ga0207690_10123317 3300025932 Bacteria 1885
192 Ga0207706_10112384 3300025933 Bacteria 2397
193 Ga0207706_10152448 3300025933 Bacteria 2033
194 Ga0207686_10000546 3300025934 Bacteria 24296
195 Ga0207686_10317082 3300025934 Bacteria 1163
196 Ga0207670_10005099 3300025936 Bacteria 7171
197 Ga0207670_10140662 3300025936 Bacteria 1780
198 Ga0207670_10748379 3300025936 Bacteria 812
199 Ga0207704_10864737 3300025938 Unclassified 759
200 Ga0207691_10027226 3300025940 Bacteria 5363
201 Ga0207691_10136756 3300025940 Bacteria 2161
202 Ga0207711_10029958 3300025941 Bacteria 4591
203 Ga0207689_10034391 3300025942 Bacteria 4210
204 Ga0207689_10040071 3300025942 Bacteria 3878
205 Ga0207689_10122681 3300025942 Bacteria 2137
206 Ga0207661_10125129 3300025944 Bacteria 2194
207 Ga0207679_10008889 3300025945 Bacteria 6411
208 Ga0207679_10112575 3300025945 Bacteria 2151
209 Ga0207667_10057778 3300025949 Bacteria 4071
210 Ga0207667_10151096 3300025949 Bacteria 2390
211 Ga0207651_10177186 3300025960 Bacteria 1687
212 Ga0207651_10513763 3300025960 Bacteria 1037
213 Ga0207712_10007103 3300025961 Bacteria 7062
214 Ga0207712_10015320 3300025961 Bacteria 4942
215 Ga0207658_10111461 3300025986 Bacteria 2164
216 Ga0207658_10123757 3300025986 Unclassified 2066
217 Ga0207677_10020201 3300026023 Bacteria 4039
218 Ga0207703_10113831 3300026035 Bacteria 2313
219 Ga0207703_10675008 3300026035 Bacteria 981
220 Ga0207639_10260741 3300026041 Unclassified 1516
221 Ga0207678_10115704 3300026067 Bacteria 2288
222 Ga0207641_10000253 3300026088 Bacteria 67848
223 Ga0207641_10039405 3300026088 Bacteria 3952
224 Ga0207641_10127298 3300026088 Unclassified 2282
225 Ga0207641_10196855 3300026088 Bacteria 1855
226 Ga0207641_10199764 3300026088 Bacteria 1843
227 Ga0207641_10203857 3300026088 Bacteria 1825
228 Ga0207676_10047657 3300026095 Bacteria 3322
229 Ga0207676_10117968 3300026095 Bacteria 2233
230 Ga0207676_10283058 3300026095 Bacteria 1506
231 Ga0207676_10405383 3300026095 Bacteria 1275
232 Ga0207676_10612591 3300026095 Bacteria 1047
233 Ga0207674_10013131 3300026116 Bacteria 9219
234 Ga0207674_10110348 3300026116 Bacteria 2726
235 Ga0207674_10430863 3300026116 Bacteria 1274
236 Ga0207674_11003070 3300026116 Bacteria 804
237 Ga0207675_100021657 3300026118 Bacteria 5983
238 Ga0207683_10129370 3300026121 Bacteria 2270
239 Ga0207683_10728500 3300026121 Unclassified 920
240 Ga0207698_10211906 3300026142 Bacteria 1744
241 Ga0207698_10762241 3300026142 Bacteria 967
242 Ga0268265_10014622 3300028380 Bacteria 5351
243 Ga0268264_10054823 3300028381 Bacteria 3330
244 Ga0268264_10203327 3300028381 Bacteria 1813
245 Ga0265338_10000563 3300028800 Bacteria 65172
246 Ga0265338_10251023 3300028800 Bacteria 1305
247 Ga0307509_10048417 3300031507 Bacteria 4565
248 Ga0307509_10112766 3300031507 Bacteria 2718
249 Ga0307509_10127319 3300031507 Bacteria 2510
250 Ga0316575_10015313 3300031665 Bacteria 2890
251 Ga0316576_10002604 3300031727 Bacteria 10310
252 Ga0316578_10027635 3300031728 Bacteria 3207
253 Ga0307516_10001558 3300031730 Bacteria 31533
254 Ga0316577_10015407 3300031733 Bacteria 4206
255 Ga0307414_10659854 3300032004 Bacteria 944
256 Ga0316583_10079503 3300032133 Bacteria 1146
257 Ga0316593_10017080 3300032168 Bacteria 2209
258 Ga0373936_0105798 3300035113 Unclassified 1191
259 Ga0373956_0116767 3300035119 Bacteria 1245
260 Ga0373955_0123971 3300035172 Bacteria 1504
261 Ga0316574_0001341 3300035398 Bacteria 11561
262 Ga0373924_0023339 3300035410 Bacteria 2426
263 Ga0373935_0404559 3300035692 Unclassified 981
264 Ga0373927_0005849 3300035695 Bacteria 8433
265 Ga0373933_0162921 3300035724 Bacteria 1417
266 Ga0373933_0237511 3300035724 Unclassified 1172
267 Ga0373937_0058217 3300036401 Bacteria 3550
268 Ga0373937_0418085 3300036401 Bacteria 1272
269 Ga0373937_0600683 3300036401 Unclassified 1045
270 Ga0316582_0005286 3300036647 Bacteria 6628
271 Ga0316584_0064699 3300036712 Bacteria 2738
272 Ga0373925_0319161 3300037068 Bacteria 1257
273 Ga0316581_0010349 3300037588 Bacteria 2583
274 Ga0436365_1079918 3300039437 Bacteria 37760
275 Ga0451833_1081455 3300041491 Bacteria 1182
276 Ga0451835_0711964 3300041492 Unclassified 861
277 Ga0466972_0000002 3300044658 Bacteria 408005
278 Ga0453683_0257694 3300044673 Bacteria 1112
279 Ga0453684_0007006 3300044712 Bacteria 21067
280 Ga0453684_0089192 3300044712 Bacteria 3815
281 Ga0453684_0182056 3300044712 Bacteria 2466
282 Ga0466971_0207120 3300044719 Bacteria 927
283 Ga0466968_0356610 3300044735 Unclassified 711
284 Ga0466970_0004752 3300044765 Bacteria 6709
285 Ga0466970_0246315 3300044765 Bacteria 1001
286 Ga0466957_0009105 3300044842 Bacteria 5660
287 Ga0466960_0756036 3300044901 Bacteria 586
288 Ga0466959_0051300 3300045049 Bacteria 3026
289 Ga0451576_0000003 3300045051 Bacteria 1550573
290 Ga0451576_0442828 3300045051 Bacteria 1364
291 Ga0495627_006073 3300046453 Bacteria 4774
292 Ga0495592_0274358 3300046454 Bacteria 1105
293 Ga0495651_0522083 3300046462 Bacteria 758
294 Ga0495580_0162857 3300046472 Bacteria 1543
295 Ga0495582_0069026 3300046473 Bacteria 1954
296 Ga0495618_0081520 3300046514 Bacteria 2066
297 Ga0495630_0012164 3300046517 Bacteria 6242
298 Ga0495630_0034413 3300046517 Bacteria 3783
299 Ga0495630_0311242 3300046517 Unclassified 1204
300 Ga0495621_0095393 3300046539 Bacteria 1126
301 Ga0495633_0000080 3300046558 Bacteria 127703
302 Ga0495667_0051538 3300046559 Bacteria 2715
303 Ga0495634_0037362 3300046642 Bacteria 3318
304 Ga0495634_0191613 3300046642 Unclassified 1275
305 Ga0495657_0108131 3300046675 Bacteria 1765
306 Ga0495623_0267362 3300046679 Bacteria 956
307 Ga0495658_0022611 3300046683 Bacteria 3326
308 Ga0495613_0204198 3300046689 Bacteria 1392
309 Ga0495613_0898180 3300046689 Bacteria 573
310 Ga0495600_0255833 3300046809 Bacteria 1113
311 Ga0495674_0092143 3300047319 Bacteria 2588
312 Ga0495674_0422572 3300047319 Bacteria 1074
313 Ga0495676_0228236 3300047321 Unclassified 1280
314 Ga0495684_0088579 3300047471 Bacteria 2346
315 Ga0495684_0136214 3300047471 Bacteria 1843
316 Ga0496100_0681390 3300048903 Bacteria 802
317 Ga0496101_0036034 3300048904 Unclassified 3502
318 Ga0496101_0139517 3300048904 Bacteria 1847
319 Ga0496106_0287108 3300048909 Unclassified 1319
320 Ga0496109_0301412 3300048912 Bacteria 1511
321 Ga0496111_0314542 3300048914 Bacteria 1160
322 Ga0496115_0659671 3300048918 Bacteria 826
323 Ga0496121_0000020 3300048924 Bacteria 498732
324 Ga0496126_0297981 3300048929 Bacteria 1331
325 Ga0501031_0010841 3300049568 Bacteria 5935
326 Ga0501032_0129408 3300049569 Unclassified 1666
327 Ga0501033_0497267 3300049570 Bacteria 844
328 Ga0501034_0016530 3300049571 Bacteria 7567
329 Ga0501034_0079046 3300049571 Bacteria 3292
330 Ga0501034_0542433 3300049571 Bacteria 1073
331 Ga0501036_0105236 3300049572 Bacteria 2386
332 Ga0501037_0007826 3300049573 Bacteria 7827
333 Ga0501037_0048715 3300049573 Bacteria 3103
334 Ga0501037_0241811 3300049573 Bacteria 1265
335 Ga0501038_0068041 3300049574 Bacteria 3028
336 Ga0501038_0085974 3300049574 Bacteria 2643
337 Ga0501038_0205162 3300049574 Bacteria 1580
338 Ga0501039_0178515 3300049575 Bacteria 1670
339 Ga0501043_0015257 3300049579 Bacteria 6018
340 Ga0501043_0024314 3300049579 Bacteria 4754
341 Ga0501043_0156308 3300049579 Bacteria 1783
342 Ga0501046_0331346 3300049580 Bacteria 1108
343 Ga0501047_0009183 3300049581 Bacteria 9336
344 Ga0501047_0019499 3300049581 Bacteria 6506
345 Ga0501047_0032204 3300049581 Bacteria 5060
346 Ga0501047_0253082 3300049581 Bacteria 1610
347 Ga0501047_0378537 3300049581 Unclassified 1250
348 Ga0501067_0092602 3300049583 Unclassified 1678
349 Ga0501069_0051434 3300049585 Bacteria 2292
350 Ga0501073_0018001 3300049589 Bacteria 5108
351 Ga0501073_0019693 3300049589 Bacteria 4870
352 Ga0501074_0036497 3300049590 Bacteria 3560
353 Ga0501080_0059232 3300049742 Bacteria 3564
354 Ga0501080_0111823 3300049742 Bacteria 2532
355 Ga0501080_0409280 3300049742 Bacteria 1219
356 Ga0501083_0122803 3300049744 Bacteria 1703
357 Ga0501241_000031 3300049758 Bacteria 52001
358 Ga0501035_0031410 3300049822 Bacteria 4837
359 Ga0501035_0317809 3300049822 Bacteria 1309
360 Ga0501044_0016307 3300049823 Bacteria 7981
361 Ga0501044_0268639 3300049823 Bacteria 1642
362 Ga0501044_0507121 3300049823 Bacteria 1107
363 Ga0501044_0595182 3300049823 Bacteria 999
364 nmdc:mga07m45_321575_c1 3300050496 Bacteria 899
365 nmdc:mga08y16_388595_c1 3300050511 Bacteria 1429
366 nmdc:mga08y16_845883_c1 3300050511 Bacteria 904
367 Ga0495612_0304848 3300053078 Unclassified 715
368 Ga0495619_0320034 3300053085 Bacteria 1074
369 Ga0495619_0334563 3300053085 Unclassified 1048
370 Ga0500644_0000283 3300053088 Bacteria 28078
371 Ga0500646_0110512 3300053090 Bacteria 873
372 Ga0500583_0013712 3300053092 Bacteria 3145
373 Ga0500651_0051640 3300053093 Bacteria 2579
374 Ga0500569_000329 3300053109 Bacteria 7609
375 Ga0500607_010729 3300053121 Bacteria 5440
376 Ga0500652_049126 3300053131 Bacteria 1718
377 Ga0500658_0006675 3300053134 Bacteria 4275
378 Ga0500559_0017834 3300053136 Bacteria 3002
379 Ga0500577_0013261 3300053142 Bacteria 2513
380 Ga0500616_0060815 3300053153 Bacteria 1957
381 Ga0500622_0000777 3300053156 Bacteria 27709
382 Ga0500633_0021961 3300053160 Bacteria 1948
383 Ga0500636_0018231 3300053177 Bacteria 4151
384 Ga0500645_097608 3300053730 Bacteria 830
385 Ga0500661_007760 3300055283 Bacteria 1979
386 Ga0501082_0081275 3300060353 Bacteria 2796
387 Ga0501082_0416432 3300060353 Bacteria 1173
388 2819573634 2818991442 Bacteria 8318214
389 2821136968 2821136567 Bacteria 8080116
390 2884795623 2884791551 Bacteria 8511252
391 2904468290 2904467357 Bacteria 8057758
392 2914760605 2914759650 Bacteria 4701441
393 2929241249 2929239360 Bacteria 7745570
394 2929923245 2929921140 Bacteria 8649150
395 8003152119 8003151029 Bacteria 8187759
396 Ga0501032_0012985
397 JGI24740J21852_10058705
398 JGI24739J22299_10001962
399 JGI24739J22299_10037467
400 JGI24737J22298_10115886
401 JGI25154J39366_1000040
402 JGI25157J39369_1006606
403 JGI25153J46596_10003586
404 JGI25153J46596_10022508
405 rootH2_10019144
406 rootH2_10119381
407 rootL2_10043559
408 rootL2_10098609
409 rootL2_10121802
410 rootL2_10142371
411 rootH1_10057366
412 rootH1_10092915
413 JGI25160J50197_1003836
414 Ga0055535_1004391
415 Ga0055542_1002855
416 Ga0055526_1017086
417 Ga0055526_1019095
418 Ga0055528_1001650
419 Ga0055530_10000387
420 Ga0055531_10000131
421 Ga0055531_10044025
422 Ga0055543_1022335
423 Ga0065165_1000102
424 Ga0065165_1012054
425 Ga0065704_10366376
426 Ga0065712_10078473
427 Ga0065712_10319169
428 Ga0065707_10178007
429 Ga0070658_10072589
430 Ga0070683_100405352
431 Ga0070690_100182809
432 Ga0070670_100033933
433 Ga0070670_100152134
434 Ga0070670_100327823
435 Ga0068869_100073112
436 Ga0068869_100506385
437 Ga0070680_100002139
438 Ga0070682_100003820
439 Ga0068868_100023232
440 Ga0068868_100111038
441 Ga0070660_100357606
442 Ga0070660_100882679
443 Ga0070689_100020120
444 Ga0070689_100020256
445 Ga0070691_10003425
446 Ga0070669_100077385
447 Ga0070669_100259481
448 Ga0070669_100346815
449 Ga0070675_100065867
450 Ga0070675_100112580
451 Ga0070675_101151428
452 Ga0070671_100004803
453 Ga0070671_100396734
454 Ga0070674_100988004
455 Ga0070688_100001700
456 Ga0070688_100012936
457 Ga0070659_100415078
458 Ga0070667_100020321
459 Ga0070700_100186029
460 Ga0070663_100125151
461 Ga0070681_10080396
462 Ga0070685_10013492
463 Ga0070698_100003420
464 Ga0070698_100003956
465 Ga0070679_100016595
466 Ga0070684_100089885
467 Ga0068853_100057348
468 Ga0068853_100165071
469 Ga0070693_100009189
470 Ga0068855_100101266
471 Ga0068855_100179167
472 Ga0068855_100996671
473 Ga0070664_100012802
474 Ga0070664_100173466
475 Ga0068857_100019040
476 Ga0068857_100134513
477 Ga0068857_100207047
478 Ga0068857_100328630
479 Ga0068857_100763350
480 Ga0068859_100160451
481 Ga0068859_100164449
482 Ga0068859_100492183
483 Ga0068864_100016359
484 Ga0068864_100113698
485 Ga0068864_100123178
486 Ga0068864_100750684
487 Ga0068866_10046333
488 Ga0068861_100017109
489 Ga0068863_100000412
490 Ga0068863_100144687
491 Ga0068863_100158539
492 Ga0068863_100231505
493 Ga0068863_100379320
494 Ga0068863_100530218
495 Ga0068858_100119979
496 Ga0068860_100301404
497 Ga0068862_100490710
498 Ga0075366_10172124
499 Ga0097621_100003432
500 Ga0097621_100188305
501 Ga0075370_10237562
502 Ga0068871_100000027
503 Ga0075429_100982562
504 Ga0097620_100160447
505 Ga0097620_100164445
506 Ga0097620_100492189
507 Ga0111539_10625410
508 Ga0105247_10003977
509 Ga0105241_10000881
510 Ga0105241_10088986
511 Ga0105242_10605607
512 Ga0105242_11049643
513 Ga0105248_10015617
514 Ga0105249_10037570
515 Ga0105239_10240133
516 Ga0105239_10414000
517 Ga0105239_10789318
518 Ga0105246_10272486
519 Ga0105246_10346027
520 Ga0157373_10394559
521 Ga0157370_10006823
522 Ga0157370_10236700
523 Ga0157374_10004285
524 Ga0157378_10049342
525 Ga0157378_10463732
526 Ga0163162_10005326
527 Ga0163162_10022730
528 Ga0157375_10000229
529 Ga0157375_10149140
530 Ga0157375_10468795
531 Ga0157375_10963172
532 Ga0163163_10000538
533 Ga0163163_10024468
534 Ga0163163_10196032
535 Ga0157380_11277447
536 Ga0157377_10003461
537 Ga0157379_10001640
538 Ga0157379_10042217
539 Ga0157379_10283371
540 Ga0157376_10014178
541 Ga0157376_10347591
542 Ga0157376_10868945
543 Ga0157376_11323049
544 Ga0182005_1000263
545 Ga0163161_10242136
546 Ga0213876_10002105
547 Ga0209258_100151
548 Ga0209646_1000002
549 Ga0209646_1010802
550 Ga0209026_1000434
551 Ga0209148_1000154
552 Ga0209673_1000208
553 Ga0209564_1004681
554 Ga0209564_1008371
555 Ga0209564_1038219
556 Ga0209758_1006777
557 Ga0209758_1010527
558 Ga0209050_1000134
559 Ga0207426_1000497
560 Ga0207426_1001981
561 Ga0207426_1007508
562 Ga0209051_1039269
563 Ga0209257_1000001
564 Ga0209257_1001605
565 Ga0207697_10182977
566 Ga0207710_10008558
567 Ga0207643_10023368
568 Ga0207654_10003491
569 Ga0207654_10063187
570 Ga0207707_10000051
571 Ga0207707_10225495
572 Ga0207660_10005186
573 Ga0207662_10016297
574 Ga0207657_10282452
575 Ga0207652_10000384
576 Ga0207681_10037670
577 Ga0207681_10080679
578 Ga0207681_10301704
579 Ga0207650_10042343
580 Ga0207650_10156234
581 Ga0207659_10008155
582 Ga0207659_10048018
583 Ga0207659_10355237
584 Ga0207659_11015269
585 Ga0207644_10002938
586 Ga0207690_10123317
587 Ga0207706_10112384
588 Ga0207706_10152448
589 Ga0207686_10000546
590 Ga0207686_10317082
591 Ga0207670_10005099
592 Ga0207670_10140662
593 Ga0207670_10748379
594 Ga0207704_10864737
595 Ga0207691_10027226
596 Ga0207691_10136756
597 Ga0207711_10029958
598 Ga0207689_10034391
599 Ga0207689_10040071
600 Ga0207689_10122681
601 Ga0207661_10125129
602 Ga0207679_10008889
603 Ga0207679_10112575
604 Ga0207667_10057778
605 Ga0207667_10151096
606 Ga0207651_10177186
607 Ga0207651_10513763
608 Ga0207712_10007103
609 Ga0207712_10015320
610 Ga0207658_10111461
611 Ga0207658_10123757
612 Ga0207677_10020201
613 Ga0207703_10113831
614 Ga0207703_10675008
615 Ga0207639_10260741
616 Ga0207678_10115704
617 Ga0207641_10000253
618 Ga0207641_10039405
619 Ga0207641_10127298
620 Ga0207641_10196855
621 Ga0207641_10199764
622 Ga0207641_10203857
623 Ga0207676_10047657
624 Ga0207676_10117968
625 Ga0207676_10283058
626 Ga0207676_10405383
627 Ga0207676_10612591
628 Ga0207674_10013131
629 Ga0207674_10110348
630 Ga0207674_10430863
631 Ga0207674_11003070
632 Ga0207675_100021657
633 Ga0207683_10129370
634 Ga0207683_10728500
635 Ga0207698_10211906
636 Ga0207698_10762241
637 Ga0268265_10014622
638 Ga0268264_10054823
639 Ga0268264_10203327
640 Ga0265338_10000563
641 Ga0265338_10251023
642 Ga0307509_10048417
643 Ga0307509_10112766
644 Ga0307509_10127319
645 Ga0316575_10015313
646 Ga0316576_10002604
647 Ga0316578_10027635
648 Ga0307516_10001558
649 Ga0316577_10015407
650 Ga0307414_10659854
651 Ga0316583_10079503
652 Ga0316593_10017080
653 Ga0373936_0105798
654 Ga0373956_0116767
655 Ga0373955_0123971
656 Ga0316574_0001341
657 Ga0373924_0023339
658 Ga0373935_0404559
659 Ga0373927_0005849
660 Ga0373933_0162921
661 Ga0373933_0237511
662 Ga0373937_0058217
663 Ga0373937_0418085
664 Ga0373937_0600683
665 Ga0316582_0005286
666 Ga0316584_0064699
667 Ga0373925_0319161
668 Ga0316581_0010349
669 Ga0436365_1079918
670 Ga0451833_1081455
671 Ga0451835_0711964
672 Ga0466972_0000002
673 Ga0453683_0257694
674 Ga0453684_0007006
675 Ga0453684_0089192
676 Ga0453684_0182056
677 Ga0466971_0207120
678 Ga0466968_0356610
679 Ga0466970_0004752
680 Ga0466970_0246315
681 Ga0466957_0009105
682 Ga0466960_0756036
683 Ga0466959_0051300
684 Ga0451576_0000003
685 Ga0451576_0442828
686 Ga0495627_006073
687 Ga0495592_0274358
688 Ga0495651_0522083
689 Ga0495580_0162857
690 Ga0495582_0069026
691 Ga0495618_0081520
692 Ga0495630_0012164
693 Ga0495630_0034413
694 Ga0495630_0311242
695 Ga0495621_0095393
696 Ga0495633_0000080
697 Ga0495667_0051538
698 Ga0495634_0037362
699 Ga0495634_0191613
700 Ga0495657_0108131
701 Ga0495623_0267362
702 Ga0495658_0022611
703 Ga0495613_0204198
704 Ga0495613_0898180
705 Ga0495600_0255833
706 Ga0495674_0092143
707 Ga0495674_0422572
708 Ga0495676_0228236
709 Ga0495684_0088579
710 Ga0495684_0136214
711 Ga0496100_0681390
712 Ga0496101_0036034
713 Ga0496101_0139517
714 Ga0496106_0287108
715 Ga0496109_0301412
716 Ga0496111_0314542
717 Ga0496115_0659671
718 Ga0496121_0000020
719 Ga0496126_0297981
720 Ga0501031_0010841
721 Ga0501032_0129408
722 Ga0501033_0497267
723 Ga0501034_0016530
724 Ga0501034_0079046
725 Ga0501034_0542433
726 Ga0501036_0105236
727 Ga0501037_0007826
728 Ga0501037_0048715
729 Ga0501037_0241811
730 Ga0501038_0068041
731 Ga0501038_0085974
732 Ga0501038_0205162
733 Ga0501039_0178515
734 Ga0501043_0015257
735 Ga0501043_0024314
736 Ga0501043_0156308
737 Ga0501046_0331346
738 Ga0501047_0009183
739 Ga0501047_0019499
740 Ga0501047_0032204
741 Ga0501047_0253082
742 Ga0501047_0378537
743 Ga0501067_0092602
744 Ga0501069_0051434
745 Ga0501073_0018001
746 Ga0501073_0019693
747 Ga0501074_0036497
748 Ga0501080_0059232
749 Ga0501080_0111823
750 Ga0501080_0409280
751 Ga0501083_0122803
752 Ga0501241_000031
753 Ga0501035_0031410
754 Ga0501035_0317809
755 Ga0501044_0016307
756 Ga0501044_0268639
757 Ga0501044_0507121
758 Ga0501044_0595182
759 nmdc:mga07m45_321575_c1
760 nmdc:mga08y16_388595_c1
761 nmdc:mga08y16_845883_c1
762 Ga0495612_0304848
763 Ga0495619_0320034
764 Ga0495619_0334563
765 Ga0500644_0000283
766 Ga0500646_0110512
767 Ga0500583_0013712
768 Ga0500651_0051640
769 Ga0500569_000329
770 Ga0500607_010729
771 Ga0500652_049126
772 Ga0500658_0006675
773 Ga0500559_0017834
774 Ga0500577_0013261
775 Ga0500616_0060815
776 Ga0500622_0000777
777 Ga0500633_0021961
778 Ga0500636_0018231
779 Ga0500645_097608
780 Ga0500661_007760
781 Ga0501082_0081275
782 Ga0501082_0416432
783 2819573634
784 2821136968
785 2884795623
786 2904468290
787 2914760605
788 2929241249
789 2929923245
790 8003152119

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

31

223

0.78

PF01174

SNO

SNO glutamine amidotransferase family

36

221

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gud-assembly2.cif.gz_B crystal structure of amidotransferase hish from vibrio cholerae 0.9404 2 196
4gud-assembly1.cif.gz_A crystal structure of amidotransferase hish from vibrio cholerae 0.9297 1 197
4gud-assembly2.cif.gz_B crystal structure of amidotransferase hish from vibrio cholerae 0.9218 2 196
2wjz-assembly3.cif.gz_D crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity 0.8815 1 196
1ka9-assembly1.cif.gz_H imidazole glycerol phosphate synthase 0.8799 1 196
ID Description Score Start End Superfamily
4gudA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9278 1 197 3.40.50.880
af_Q9SZ30_59_284_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9251 3 195 3.40.50.880
4gudA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9232 1 197 3.40.50.880
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9214 3 197 3.40.50.880
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9122 3 197 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A522QWZ0-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH 0.9993 1 106 GO:0000105
GO:0000107
GO:0004359
GO:0006541
GO:0042823
AF-A0A6B2GEN2-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH 0.9945 115 197 GO:0000105
GO:0000107
GO:0004359
GO:0016829
AF-A0A7Y6XRS3-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 2.4.2.-) 0.9922 1 99 GO:0000105
GO:0000107
GO:0004359
GO:0006541
GO:0042823
AF-A0A522QWZ0-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH 0.9899 1 106 GO:0000105
GO:0000107
GO:0004359
GO:0006541
GO:0042823
AF-A0A4Q3RMD2-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9839 1 196 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829

Map