F433215

General Info

Members Datasets Scaffolds Average Seq Length
395 198 382 146

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10429357|Ga0157372_104293573
Length 178
Sequence LKGNIRYQLFVNLLFFILFHYPFSLDLKKSIHMRILPFLLLFAFTGTTAVWETDFTKAQQQARQEHKYMLLSFSGSDWCIPCIKLHKEVFESNDFASFAAENLVLVNADFPRLKKNNLPKEQEKKNEALADKYDKEGHFPYTVLLDEKGNVVKSWDGNPNLSPEQFISQLKTSIDARK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
4 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
5 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
6 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
7 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
8 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
9 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
10 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
11 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
186 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
192 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
196 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
197 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
198 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.46
Metatranscriptomes 0.25
Isolates 3.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.52
Nodule 0
Rhizoplane 0.25
Rhizosphere 96.2
Stem 0
Stem Tuber 0
Unclassified 2.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1805906 2162886007 Bacteria 1667
2 SwRhRL2b_contig_2636400 2162886007 Bacteria 2413
3 MRS1b_contig_519878 2162886011 Bacteria 864
4 rootH2_10161516 3300003320 Unclassified 1110
5 rootL2_10050041 3300003322 Bacteria 3552
6 rootL2_10325344 3300003322 Bacteria 1775
7 rootH1_10148967 3300003323 Bacteria 2810
8 Ga0065714_10064592 3300005288 Bacteria 30958
9 Ga0065704_10087913 3300005289 Bacteria 2983
10 Ga0065704_10095788 3300005289 Bacteria 2473
11 Ga0065704_10172064 3300005289 Bacteria 1285
12 Ga0065712_10068516 3300005290 Bacteria 10145
13 Ga0065712_10125550 3300005290 Bacteria 1610
14 Ga0065712_10174720 3300005290 Bacteria 1224
15 Ga0065712_10196008 3300005290 Bacteria 1128
16 Ga0065715_10014179 3300005293 Bacteria 2582
17 Ga0065715_10970972 3300005293 Bacteria 553
18 Ga0065707_10105951 3300005295 Bacteria 2600
19 Ga0070658_10500011 3300005327 Bacteria 1050
20 Ga0070658_10515780 3300005327 Bacteria 1033
21 Ga0070683_100160584 3300005329 Bacteria 2132
22 Ga0070683_100251795 3300005329 Bacteria 1680
23 Ga0070683_101418158 3300005329 Bacteria 668
24 Ga0070690_100486794 3300005330 Bacteria 921
25 Ga0070670_100087548 3300005331 Bacteria 2677
26 Ga0070670_100408670 3300005331 Unclassified 1199
27 Ga0070670_101824445 3300005331 Bacteria 560
28 Ga0068869_100095876 3300005334 Bacteria 2239
29 Ga0068869_100174721 3300005334 Bacteria 1680
30 Ga0068869_100869777 3300005334 Unclassified 778
31 Ga0070666_11194018 3300005335 Bacteria 567
32 Ga0068868_100014225 3300005338 Bacteria 5861
33 Ga0068868_100438878 3300005338 Bacteria 1133
34 Ga0068868_100603344 3300005338 Bacteria 973
35 Ga0068868_101664436 3300005338 Bacteria 601
36 Ga0070660_100323648 3300005339 Bacteria 1267
37 Ga0070689_100109674 3300005340 Bacteria 2193
38 Ga0070689_100174360 3300005340 Bacteria 1743
39 Ga0070687_100033363 3300005343 Unclassified 2541
40 Ga0070661_100030165 3300005344 Bacteria 3917
41 Ga0070668_100012840 3300005347 Bacteria 6235
42 Ga0070668_100339153 3300005347 Bacteria 1269
43 Ga0070668_102109678 3300005347 Unclassified 520
44 Ga0070669_100005547 3300005353 Bacteria 9112
45 Ga0070669_100104054 3300005353 Bacteria 2146
46 Ga0070669_100791295 3300005353 Bacteria 806
47 Ga0070675_100031508 3300005354 Bacteria 4286
48 Ga0070675_100058783 3300005354 Bacteria 3171
49 Ga0070675_100196443 3300005354 Bacteria 1750
50 Ga0070675_100312924 3300005354 Bacteria 1386
51 Ga0070675_100465874 3300005354 Bacteria 1135
52 Ga0070671_100413357 3300005355 Bacteria 1155
53 Ga0070671_100524321 3300005355 Bacteria 1020
54 Ga0070673_100473361 3300005364 Bacteria 1130
55 Ga0070673_100507294 3300005364 Bacteria 1092
56 Ga0070688_100018068 3300005365 Bacteria 4062
57 Ga0070688_100037647 3300005365 Bacteria 2949
58 Ga0070688_100520694 3300005365 Bacteria 900
59 Ga0070688_100535236 3300005365 Bacteria 888
60 Ga0070701_10093138 3300005438 Bacteria 1655
61 Ga0070700_100313962 3300005441 Bacteria 1149
62 Ga0070700_101890379 3300005441 Bacteria 516
63 Ga0070663_101164556 3300005455 Bacteria 676
64 Ga0070678_100898597 3300005456 Bacteria 809
65 Ga0070678_100988301 3300005456 Bacteria 773
66 Ga0070662_100021381 3300005457 Bacteria 4417
67 Ga0070662_100373228 3300005457 Bacteria 1173
68 Ga0068867_100109891 3300005459 Bacteria 2117
69 Ga0068867_100286940 3300005459 Bacteria 1352
70 Ga0068867_101395771 3300005459 Bacteria 649
71 Ga0068867_101789663 3300005459 Unclassified 577
72 Ga0070685_10001005 3300005466 Bacteria 15141
73 Ga0070685_10017006 3300005466 Bacteria 3885
74 Ga0070684_100003161 3300005535 Bacteria 12305
75 Ga0070684_100060198 3300005535 Bacteria 3320
76 Ga0070672_100051211 3300005543 Bacteria 3219
77 Ga0070672_100446929 3300005543 Bacteria 1113
78 Ga0070686_100092835 3300005544 Unclassified 2022
79 Ga0070686_100681230 3300005544 Bacteria 818
80 Ga0070665_101140835 3300005548 Bacteria 791
81 Ga0070704_101454080 3300005549 Bacteria 630
82 Ga0070704_101789684 3300005549 Bacteria 568
83 Ga0070664_100004752 3300005564 Bacteria 10894
84 Ga0070664_100178404 3300005564 Bacteria 1887
85 Ga0070664_101896830 3300005564 Bacteria 565
86 Ga0068857_100043340 3300005577 Bacteria 3992
87 Ga0068857_100093730 3300005577 Bacteria 2689
88 Ga0068857_100538467 3300005577 Bacteria 1099
89 Ga0068854_100022030 3300005578 Bacteria 4333
90 Ga0068854_100358120 3300005578 Bacteria 1196
91 Ga0068854_100531353 3300005578 Bacteria 995
92 Ga0070702_100287899 3300005615 Bacteria 1131
93 Ga0068852_100009564 3300005616 Bacteria 7200
94 Ga0068852_100931209 3300005616 Bacteria 887
95 Ga0068852_101111434 3300005616 Bacteria 811
96 Ga0068859_100026172 3300005617 Bacteria 5851
97 Ga0068859_100101399 3300005617 Bacteria 2935
98 Ga0068859_100208163 3300005617 Bacteria 2042
99 Ga0068859_100215263 3300005617 Bacteria 2008
100 Ga0068859_100285508 3300005617 Bacteria 1743
101 Ga0068859_100288780 3300005617 Unclassified 1733
102 Ga0068859_100419639 3300005617 Bacteria 1434
103 Ga0068859_100594499 3300005617 Bacteria 1200
104 Ga0068859_100631276 3300005617 Bacteria 1164
105 Ga0068859_101181098 3300005617 Bacteria 843
106 Ga0068864_100006576 3300005618 Bacteria 9517
107 Ga0068864_100142616 3300005618 Bacteria 2163
108 Ga0068864_100818999 3300005618 Bacteria 916
109 Ga0068861_100037117 3300005719 Bacteria 3622
110 Ga0068861_100129546 3300005719 Bacteria 2046
111 Ga0068851_10090336 3300005834 Bacteria 1611
112 Ga0068870_10016854 3300005840 Bacteria 3502
113 Ga0068863_100004458 3300005841 Bacteria 13803
114 Ga0068863_100154040 3300005841 Bacteria 2200
115 Ga0068863_100601336 3300005841 Bacteria 1088
116 Ga0068863_102741095 3300005841 Bacteria 501
117 Ga0068858_100829136 3300005842 Unclassified 903
118 Ga0068860_100190676 3300005843 Bacteria 1984
119 Ga0068862_100010686 3300005844 Bacteria 7582
120 Ga0068862_100533254 3300005844 Bacteria 1119
121 Ga0075366_10028017 3300006195 Bacteria 3305
122 Ga0097621_100409842 3300006237 Bacteria 1215
123 Ga0068871_100870159 3300006358 Bacteria 834
124 Ga0068865_100166156 3300006881 Bacteria 1687
125 Ga0068865_100802880 3300006881 Bacteria 812
126 Ga0068865_100858058 3300006881 Bacteria 787
127 Ga0097620_100026172 3300006931 Bacteria 5851
128 Ga0097620_100101400 3300006931 Bacteria 2935
129 Ga0097620_100208168 3300006931 Bacteria 2042
130 Ga0097620_100215241 3300006931 Bacteria 2008
131 Ga0097620_100285504 3300006931 Bacteria 1743
132 Ga0097620_100288772 3300006931 Unclassified 1733
133 Ga0097620_100419642 3300006931 Bacteria 1434
134 Ga0097620_100594426 3300006931 Bacteria 1200
135 Ga0097620_100631280 3300006931 Bacteria 1164
136 Ga0097620_101181011 3300006931 Bacteria 843
137 Ga0105250_10093842 3300009092 Bacteria 1222
138 Ga0111539_10002347 3300009094 Bacteria 25205
139 Ga0105245_11046944 3300009098 Bacteria 861
140 Ga0105247_10756654 3300009101 Bacteria 737
141 Ga0105243_10265205 3300009148 Bacteria 1539
142 Ga0105241_10206805 3300009174 Unclassified 1643
143 Ga0105241_11082383 3300009174 Unclassified 754
144 Ga0105242_10015276 3300009176 Bacteria 5962
145 Ga0105242_11378628 3300009176 Bacteria 732
146 Ga0105237_10004062 3300009545 Bacteria 17075
147 Ga0105237_12122468 3300009545 Bacteria 571
148 Ga0105249_10012772 3300009553 Bacteria 7406
149 Ga0105249_10035993 3300009553 Bacteria 4491
150 Ga0105249_10122707 3300009553 Bacteria 2471
151 Ga0105249_10476713 3300009553 Bacteria 1290
152 Ga0105249_10625090 3300009553 Bacteria 1133
153 Ga0105246_10107648 3300011119 Bacteria 2042
154 Ga0105246_12102551 3300011119 Bacteria 547
155 Ga0157373_10028311 3300013100 Bacteria 4042
156 Ga0157373_10329526 3300013100 Bacteria 1087
157 Ga0157373_10335670 3300013100 Bacteria 1077
158 Ga0157373_11300839 3300013100 Unclassified 550
159 Ga0157371_10020401 3300013102 Bacteria 4877
160 Ga0157371_10154222 3300013102 Bacteria 1639
161 Ga0157371_10169827 3300013102 Bacteria 1558
162 Ga0157371_10716348 3300013102 Unclassified 750
163 Ga0157370_10006329 3300013104 Bacteria 13080
164 Ga0157370_10007394 3300013104 Bacteria 11963
165 Ga0157370_10568527 3300013104 Bacteria 1039
166 Ga0157369_10023264 3300013105 Bacteria 6903
167 Ga0157369_10096676 3300013105 Bacteria 3150
168 Ga0157369_10316546 3300013105 Bacteria 1622
169 Ga0157374_10004889 3300013296 Bacteria 11243
170 Ga0157374_10088801 3300013296 Bacteria 2944
171 Ga0157374_10843177 3300013296 Bacteria 933
172 Ga0157378_10472492 3300013297 Bacteria 1248
173 Ga0157378_11145960 3300013297 Bacteria 816
174 Ga0163162_10018262 3300013306 Bacteria 6870
175 Ga0163162_10032210 3300013306 Bacteria 5205
176 Ga0163162_10052641 3300013306 Bacteria 4089
177 Ga0163162_10386109 3300013306 Bacteria 1533
178 Ga0163162_12264465 3300013306 Unclassified 624
179 Ga0157372_10001304 3300013307 Bacteria 26971
180 Ga0157372_10157403 3300013307 Bacteria 2625
181 Ga0157372_10319980 3300013307 Bacteria 1806
182 Ga0157372_10429357 3300013307 Bacteria 1540
183 Ga0157372_10826451 3300013307 Bacteria 1076
184 Ga0157372_10869913 3300013307 Unclassified 1046
185 Ga0157372_11236326 3300013307 Bacteria 863
186 Ga0157375_10000510 3300013308 Bacteria 34914
187 Ga0157375_10071312 3300013308 Bacteria 3487
188 Ga0157375_10170224 3300013308 Bacteria 2325
189 Ga0157375_10193942 3300013308 Bacteria 2186
190 Ga0157375_10444259 3300013308 Bacteria 1462
191 Ga0157375_11088862 3300013308 Bacteria 935
192 Ga0163163_10073560 3300014325 Bacteria 3408
193 Ga0163163_10173429 3300014325 Bacteria 2203
194 Ga0163163_10295217 3300014325 Unclassified 1673
195 Ga0163163_10677861 3300014325 Bacteria 1094
196 Ga0163163_10758535 3300014325 Bacteria 1034
197 Ga0163163_12141941 3300014325 Bacteria 619
198 Ga0157380_10136660 3300014326 Bacteria 2099
199 Ga0157380_10147692 3300014326 Bacteria 2028
200 Ga0157380_10762464 3300014326 Bacteria 980
201 Ga0157380_12451271 3300014326 Bacteria 587
202 Ga0157377_10090713 3300014745 Bacteria 1804
203 Ga0157377_10224136 3300014745 Bacteria 1205
204 Ga0157377_10262242 3300014745 Bacteria 1125
205 Ga0157379_10104818 3300014968 Bacteria 2538
206 Ga0157379_10319042 3300014968 Bacteria 1418
207 Ga0157376_10077945 3300014969 Bacteria 2836
208 Ga0157376_10163873 3300014969 Bacteria 2018
209 Ga0163161_10000975 3300017792 Bacteria 21890
210 Ga0163161_11626101 3300017792 Bacteria 570
211 Ga0206352_10675273 3300020078 Bacteria 602
212 Ga0207656_10103728 3300025321 Bacteria 1306
213 Ga0207656_10383237 3300025321 Bacteria 705
214 Ga0207696_1066228 3300025711 Bacteria 1009
215 Ga0207710_10301747 3300025900 Bacteria 809
216 Ga0207688_10319228 3300025901 Bacteria 953
217 Ga0207647_10229008 3300025904 Bacteria 1069
218 Ga0207645_10001124 3300025907 Bacteria 22129
219 Ga0207645_10228760 3300025907 Bacteria 1227
220 Ga0207645_10311993 3300025907 Unclassified 1048
221 Ga0207643_10008981 3300025908 Bacteria 5365
222 Ga0207643_10149595 3300025908 Bacteria 1399
223 Ga0207705_10695046 3300025909 Bacteria 791
224 Ga0207671_10000228 3300025914 Bacteria 84575
225 Ga0207662_10060973 3300025918 Bacteria 2264
226 Ga0207662_10300737 3300025918 Bacteria 1066
227 Ga0207657_10243965 3300025919 Bacteria 1434
228 Ga0207649_10023979 3300025920 Bacteria 3540
229 Ga0207681_10056770 3300025923 Bacteria 2672
230 Ga0207681_10218063 3300025923 Unclassified 1474
231 Ga0207681_10501836 3300025923 Bacteria 993
232 Ga0207681_11006067 3300025923 Bacteria 699
233 Ga0207650_10033375 3300025925 Bacteria 3727
234 Ga0207650_10573450 3300025925 Bacteria 947
235 Ga0207650_10915713 3300025925 Bacteria 745
236 Ga0207650_11144807 3300025925 Unclassified 662
237 Ga0207659_10050907 3300025926 Bacteria 2944
238 Ga0207659_10212777 3300025926 Bacteria 1550
239 Ga0207659_10296449 3300025926 Bacteria 1327
240 Ga0207659_10424614 3300025926 Bacteria 1115
241 Ga0207644_10342347 3300025931 Bacteria 1213
242 Ga0207644_10926224 3300025931 Bacteria 731
243 Ga0207690_10354241 3300025932 Bacteria 1161
244 Ga0207706_10107487 3300025933 Bacteria 2455
245 Ga0207686_10000655 3300025934 Bacteria 21369
246 Ga0207670_10022643 3300025936 Bacteria 3897
247 Ga0207670_10059572 3300025936 Bacteria 2597
248 Ga0207670_10074566 3300025936 Bacteria 2356
249 Ga0207670_10140453 3300025936 Bacteria 1781
250 Ga0207704_10486386 3300025938 Bacteria 992
251 Ga0207691_10017517 3300025940 Bacteria 6792
252 Ga0207691_10076112 3300025940 Bacteria 3025
253 Ga0207691_10112559 3300025940 Unclassified 2419
254 Ga0207711_10552206 3300025941 Bacteria 1074
255 Ga0207689_10004698 3300025942 Bacteria 12328
256 Ga0207689_10068922 3300025942 Bacteria 2907
257 Ga0207661_11413028 3300025944 Bacteria 638
258 Ga0207679_10013695 3300025945 Bacteria 5318
259 Ga0207679_10428857 3300025945 Bacteria 1168
260 Ga0207679_10622082 3300025945 Unclassified 975
261 Ga0207679_10763248 3300025945 Bacteria 880
262 Ga0207679_10786899 3300025945 Bacteria 867
263 Ga0207679_11143669 3300025945 Bacteria 714
264 Ga0207651_10080222 3300025960 Bacteria 2348
265 Ga0207651_10122850 3300025960 Bacteria 1972
266 Ga0207651_10298686 3300025960 Bacteria 1338
267 Ga0207651_10370041 3300025960 Bacteria 1212
268 Ga0207712_10008426 3300025961 Bacteria 6516
269 Ga0207712_10179456 3300025961 Unclassified 1662
270 Ga0207712_10821842 3300025961 Bacteria 818
271 Ga0207668_10109903 3300025972 Bacteria 2066
272 Ga0207668_10310953 3300025972 Bacteria 1304
273 Ga0207640_10103718 3300025981 Bacteria 2000
274 Ga0207640_10112504 3300025981 Bacteria 1933
275 Ga0207640_10984226 3300025981 Bacteria 741
276 Ga0207640_11379194 3300025981 Bacteria 631
277 Ga0207658_10740677 3300025986 Bacteria 890
278 Ga0207703_11286490 3300026035 Bacteria 703
279 Ga0207639_10305590 3300026041 Bacteria 1407
280 Ga0207708_10216134 3300026075 Bacteria 1534
281 Ga0207708_10484085 3300026075 Bacteria 1035
282 Ga0207708_10533995 3300026075 Bacteria 987
283 Ga0207641_10000810 3300026088 Bacteria 33309
284 Ga0207641_10075354 3300026088 Unclassified 2914
285 Ga0207641_10393946 3300026088 Bacteria 1329
286 Ga0207641_10624269 3300026088 Bacteria 1057
287 Ga0207641_10639156 3300026088 Bacteria 1044
288 Ga0207641_11059295 3300026088 Bacteria 809
289 Ga0207641_12341103 3300026088 Bacteria 533
290 Ga0207648_10329592 3300026089 Bacteria 1373
291 Ga0207648_10370004 3300026089 Bacteria 1294
292 Ga0207648_10403351 3300026089 Unclassified 1239
293 Ga0207648_10556624 3300026089 Unclassified 1054
294 Ga0207648_11116724 3300026089 Bacteria 740
295 Ga0207676_10048576 3300026095 Bacteria 3295
296 Ga0207676_10129029 3300026095 Bacteria 2146
297 Ga0207676_10259558 3300026095 Bacteria 1568
298 Ga0207676_11586765 3300026095 Bacteria 652
299 Ga0207674_10030917 3300026116 Bacteria 5628
300 Ga0207674_10037862 3300026116 Bacteria 5011
301 Ga0207674_10261667 3300026116 Bacteria 1677
302 Ga0207674_10323570 3300026116 Unclassified 1491
303 Ga0207674_10485641 3300026116 Bacteria 1194
304 Ga0207674_10577663 3300026116 Bacteria 1086
305 Ga0207674_10583579 3300026116 Bacteria 1080
306 Ga0207675_100001377 3300026118 Bacteria 24367
307 Ga0207675_100005780 3300026118 Bacteria 11828
308 Ga0207675_100059885 3300026118 Bacteria 3554
309 Ga0207683_10051591 3300026121 Bacteria 3604
310 Ga0207683_11533961 3300026121 Bacteria 615
311 Ga0207698_10490939 3300026142 Bacteria 1193
312 Ga0207698_10885955 3300026142 Bacteria 899
313 Ga0207698_11147267 3300026142 Bacteria 790
314 Ga0207698_12172764 3300026142 Bacteria 568
315 Ga0209974_10023812 3300027876 Bacteria 2026
316 Ga0207428_10073029 3300027907 Bacteria 2692
317 Ga0268266_10611441 3300028379 Bacteria 1047
318 Ga0268265_10017475 3300028380 Bacteria 4951
319 Ga0268264_10326515 3300028381 Bacteria 1453
320 Ga0268264_10697675 3300028381 Bacteria 1008
321 Ga0265338_10082247 3300028800 Bacteria 2697
322 Ga0307414_10445009 3300032004 Bacteria 1135
323 Ga0307411_10513243 3300032005 Unclassified 1016
324 Ga0373934_0057539 3300035086 Bacteria 1546
325 Ga0373955_0017654 3300035172 Bacteria 3535
326 Ga0373924_0027850 3300035410 Bacteria 2249
327 Ga0373935_0701897 3300035692 Bacteria 744
328 Ga0373933_0064323 3300035724 Bacteria 2219
329 Ga0373947_0442511 3300035725 Bacteria 880
330 Ga0373937_0072976 3300036401 Bacteria 3165
331 Ga0373937_0605484 3300036401 Bacteria 1040
332 Ga0373925_0445951 3300037068 Unclassified 1059
333 Ga0373925_0633303 3300037068 Bacteria 881
334 Ga0395905_1532429 3300037471 Unclassified 571
335 Ga0451802_0294214 3300041460 Bacteria 760
336 Ga0451577_0070098 3300042876 Bacteria 3127
337 Ga0466961_0504002 3300044693 Bacteria 731
338 Ga0453684_0149220 3300044712 Bacteria 2781
339 Ga0466959_0667981 3300045049 Bacteria 697
340 Ga0495627_000002 3300046453 Bacteria 903861
341 Ga0495592_0035601 3300046454 Bacteria 3752
342 Ga0495608_0092307 3300046511 Bacteria 1957
343 Ga0495628_0039159 3300046516 Bacteria 3792
344 Ga0495630_0004855 3300046517 Bacteria 9439
345 Ga0495630_0830436 3300046517 Bacteria 705
346 Ga0495643_0232681 3300046522 Bacteria 868
347 Ga0495652_0169766 3300046529 Unclassified 1685
348 Ga0495654_0000001 3300046530 Bacteria 1513197
349 Ga0495640_0216890 3300046533 Bacteria 1208
350 Ga0495587_0026062 3300046536 Bacteria 3568
351 Ga0495598_0078567 3300046537 Bacteria 1054
352 Ga0495609_0000058 3300046538 Bacteria 143601
353 Ga0495633_0004790 3300046558 Bacteria 8482
354 Ga0495634_0030572 3300046642 Bacteria 3719
355 Ga0495611_0146345 3300046648 Bacteria 1103
356 Ga0495625_0010370 3300046660 Bacteria 7717
357 Ga0495635_0225923 3300046663 Bacteria 1265
358 Ga0495588_0417129 3300046674 Bacteria 705
359 Ga0495657_0054036 3300046675 Bacteria 2685
360 Ga0495658_0106191 3300046683 Bacteria 1683
361 Ga0495613_0456463 3300046689 Bacteria 865
362 Ga0495604_0195141 3300047317 Bacteria 1408
363 Ga0495674_0169128 3300047319 Bacteria 1825
364 Ga0495676_0479327 3300047321 Unclassified 818
365 Ga0495680_0062929 3300047322 Bacteria 2851
366 Ga0495684_0223883 3300047471 Bacteria 1378
367 Ga0495686_0027830 3300047472 Bacteria 3686
368 Ga0496117_0239454 3300048920 Bacteria 997
369 Ga0496122_0009109 3300048925 Bacteria 10521
370 Ga0496123_0047108 3300048926 Bacteria 2917
371 Ga0496126_1037315 3300048929 Unclassified 613
372 Ga0501033_0628288 3300049570 Bacteria 735
373 Ga0501245_137605 3300049708 Bacteria 529
374 Ga0501083_0159310 3300049744 Bacteria 1477
375 Ga0501268_043914 3300049765 Bacteria 849
376 nmdc:mga07m45_395442_c1 3300050496 Bacteria 802
377 nmdc:mga09592_915407_c1 3300050508 Bacteria 736
378 Ga0495619_0118942 3300053085 Bacteria 1811
379 Ga0500650_0110225 3300053098 Bacteria 1285
380 Ga0500642_0035883 3300053130 Bacteria 2109
381 Ga0500559_0162152 3300053136 Bacteria 1051
382 Ga0500577_0113530 3300053142 Unclassified 1121

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_1037315 Ga0496126_1037315_221_595 124
2 3300049570 Ga0501033_0628288 Ga0501033_0628288_10_396 125
3 3300053136 Ga0500559_0162152 Ga0500559_0162152_619_1020 132
4 3300037471 Ga0395905_1532429 Ga0395905_1532429_34_441 133
5 2162886007 SwRhRL2b_contig_2636400 SwRhRL2b_0487.00000100 135
6 3300009098 Ga0105245_11046944 Ga0105245_110469441 135
7 3300013297 Ga0157378_11145960 Ga0157378_111459602 135
8 3300005289 Ga0065704_10095788 Ga0065704_100957881 136
9 3300014969 Ga0157376_10077945 Ga0157376_100779452 138
10 3300005459 Ga0068867_101395771 Ga0068867_1013957711 139
11 3300026089 Ga0207648_11116724 Ga0207648_111167242 139
12 3300009545 Ga0105237_10004062 Ga0105237_100040624 142
13 3300013105 Ga0157369_10316546 Ga0157369_103165463 142
14 3300020078 Ga0206352_10675273 Ga0206352_106752731 142
15 3300025914 Ga0207671_10000228 Ga0207671_1000022810 142
16 3300026116 Ga0207674_10485641 Ga0207674_104856412 142
17 3300005617 Ga0068859_100631276 Ga0068859_1006312763 143
18 3300006931 Ga0097620_100631280 Ga0097620_1006312801 143
19 3300028800 Ga0265338_10082247 Ga0265338_100822472 143
20 iso_pu_bacteria 2511231000 2511233754 143
21 iso_pu_bacteria 2511231000 2511234244 143
22 iso_pu_bacteria 2582581281 2585158236 143
23 iso_pu_bacteria 2582581281 2585159689 143
24 iso_pu_bacteria 2582581282 2585162447 143
25 iso_pu_bacteria 2582581282 2585163967 143
26 iso_pu_bacteria 2585428115 2587941976 143
27 iso_pu_bacteria 2585428187 2588234066 143
28 iso_pu_bacteria 2945924605 2945926345 143
29 iso_pu_bacteria 2945924605 2945928001 143
30 iso_pu_bacteria 2993372514 2993374352 143
31 iso_pu_bacteria 2993480792 2993481242 143
32 3300005617 Ga0068859_100419639 Ga0068859_1004196392 144
33 3300006931 Ga0097620_100419642 Ga0097620_1004196422 144
34 3300009553 Ga0105249_10476713 Ga0105249_104767132 144
35 3300013307 Ga0157372_10001304 Ga0157372_1000130431 144
36 3300049744 Ga0501083_0159310 Ga0501083_0159310_997_1431 144
37 iso_pu_bacteria 2585428095 2587866577 144
38 2162886011 MRS1b_contig_519878 MRS1b_0645.00000610 145
39 3300003320 rootH2_10161516 rootH2_101615162 145
40 3300003322 rootL2_10325344 rootL2_103253442 145
41 3300005290 Ga0065712_10068516 Ga0065712_100685162 145
42 3300005290 Ga0065712_10125550 Ga0065712_101255502 145
43 3300005290 Ga0065712_10174720 Ga0065712_101747202 145
44 3300005290 Ga0065712_10196008 Ga0065712_101960082 145
45 3300005293 Ga0065715_10014179 Ga0065715_100141793 145
46 3300005293 Ga0065715_10970972 Ga0065715_109709721 145
47 3300005327 Ga0070658_10515780 Ga0070658_105157802 145
48 3300005329 Ga0070683_100160584 Ga0070683_1001605841 145
49 3300005329 Ga0070683_101418158 Ga0070683_1014181582 145
50 3300005330 Ga0070690_100486794 Ga0070690_1004867941 145
51 3300005331 Ga0070670_100087548 Ga0070670_1000875483 145
52 3300005331 Ga0070670_100408670 Ga0070670_1004086702 145
53 3300005334 Ga0068869_100095876 Ga0068869_1000958762 145
54 3300005334 Ga0068869_100869777 Ga0068869_1008697771 145
55 3300005335 Ga0070666_11194018 Ga0070666_111940181 145
56 3300005338 Ga0068868_100014225 Ga0068868_1000142254 145
57 3300005338 Ga0068868_100603344 Ga0068868_1006033441 145
58 3300005338 Ga0068868_101664436 Ga0068868_1016644361 145
59 3300005339 Ga0070660_100323648 Ga0070660_1003236482 145
60 3300005340 Ga0070689_100109674 Ga0070689_1001096742 145
61 3300005343 Ga0070687_100033363 Ga0070687_1000333634 145
62 3300005344 Ga0070661_100030165 Ga0070661_1000301653 145
63 3300005347 Ga0070668_100339153 Ga0070668_1003391533 145
64 3300005347 Ga0070668_102109678 Ga0070668_1021096781 145
65 3300005353 Ga0070669_100104054 Ga0070669_1001040541 145
66 3300005353 Ga0070669_100791295 Ga0070669_1007912951 145
67 3300005354 Ga0070675_100058783 Ga0070675_1000587832 145
68 3300005354 Ga0070675_100196443 Ga0070675_1001964432 145
69 3300005354 Ga0070675_100312924 Ga0070675_1003129241 145
70 3300005354 Ga0070675_100465874 Ga0070675_1004658741 145
71 3300005355 Ga0070671_100524321 Ga0070671_1005243211 145
72 3300005364 Ga0070673_100473361 Ga0070673_1004733612 145
73 3300005364 Ga0070673_100507294 Ga0070673_1005072942 145
74 3300005365 Ga0070688_100037647 Ga0070688_1000376473 145
75 3300005365 Ga0070688_100520694 Ga0070688_1005206941 145
76 3300005365 Ga0070688_100535236 Ga0070688_1005352361 145
77 3300005438 Ga0070701_10093138 Ga0070701_100931381 145
78 3300005441 Ga0070700_100313962 Ga0070700_1003139622 145
79 3300005441 Ga0070700_101890379 Ga0070700_1018903791 145
80 3300005455 Ga0070663_101164556 Ga0070663_1011645562 145
81 3300005456 Ga0070678_100898597 Ga0070678_1008985971 145
82 3300005457 Ga0070662_100373228 Ga0070662_1003732282 145
83 3300005459 Ga0068867_100109891 Ga0068867_1001098914 145
84 3300005459 Ga0068867_100286940 Ga0068867_1002869401 145
85 3300005459 Ga0068867_101789663 Ga0068867_1017896631 145
86 3300005466 Ga0070685_10001005 Ga0070685_100010059 145
87 3300005466 Ga0070685_10017006 Ga0070685_100170062 145
88 3300005535 Ga0070684_100003161 Ga0070684_10000316113 145
89 3300005535 Ga0070684_100060198 Ga0070684_1000601985 145
90 3300005543 Ga0070672_100051211 Ga0070672_1000512112 145
91 3300005543 Ga0070672_100446929 Ga0070672_1004469292 145
92 3300005544 Ga0070686_100092835 Ga0070686_1000928351 145
93 3300005544 Ga0070686_100681230 Ga0070686_1006812301 145
94 3300005548 Ga0070665_101140835 Ga0070665_1011408351 145
95 3300005549 Ga0070704_101789684 Ga0070704_1017896841 145
96 3300005564 Ga0070664_100004752 Ga0070664_10000475212 145
97 3300005564 Ga0070664_100178404 Ga0070664_1001784042 145
98 3300005577 Ga0068857_100043340 Ga0068857_1000433404 145
99 3300005577 Ga0068857_100538467 Ga0068857_1005384672 145
100 3300005578 Ga0068854_100022030 Ga0068854_1000220304 145
101 3300005578 Ga0068854_100358120 Ga0068854_1003581202 145
102 3300005615 Ga0070702_100287899 Ga0070702_1002878992 145
103 3300005616 Ga0068852_100009564 Ga0068852_1000095644 145
104 3300005616 Ga0068852_100931209 Ga0068852_1009312092 145
105 3300005616 Ga0068852_101111434 Ga0068852_1011114342 145
106 3300005617 Ga0068859_100026172 Ga0068859_1000261725 145
107 3300005617 Ga0068859_100101399 Ga0068859_1001013994 145
108 3300005617 Ga0068859_100208163 Ga0068859_1002081632 145
109 3300005617 Ga0068859_100285508 Ga0068859_1002855082 145
110 3300005617 Ga0068859_100288780 Ga0068859_1002887802 145
111 3300005617 Ga0068859_101181098 Ga0068859_1011810982 145
112 3300005618 Ga0068864_100006576 Ga0068864_1000065766 145
113 3300005618 Ga0068864_100142616 Ga0068864_1001426161 145
114 3300005618 Ga0068864_100818999 Ga0068864_1008189992 145
115 3300005719 Ga0068861_100129546 Ga0068861_1001295463 145
116 3300005834 Ga0068851_10090336 Ga0068851_100903362 145
117 3300005841 Ga0068863_100004458 Ga0068863_10000445815 145
118 3300005841 Ga0068863_100601336 Ga0068863_1006013361 145
119 3300005841 Ga0068863_102741095 Ga0068863_1027410951 145
120 3300005842 Ga0068858_100829136 Ga0068858_1008291362 145
121 3300005843 Ga0068860_100190676 Ga0068860_1001906762 145
122 3300005844 Ga0068862_100533254 Ga0068862_1005332542 145
123 3300006237 Ga0097621_100409842 Ga0097621_1004098421 145
124 3300006358 Ga0068871_100870159 Ga0068871_1008701592 145
125 3300006881 Ga0068865_100166156 Ga0068865_1001661562 145
126 3300006881 Ga0068865_100802880 Ga0068865_1008028802 145
127 3300006881 Ga0068865_100858058 Ga0068865_1008580582 145
128 3300006931 Ga0097620_100026172 Ga0097620_1000261725 145
129 3300006931 Ga0097620_100101400 Ga0097620_1001014004 145
130 3300006931 Ga0097620_100208168 Ga0097620_1002081682 145
131 3300006931 Ga0097620_100285504 Ga0097620_1002855042 145
132 3300006931 Ga0097620_100288772 Ga0097620_1002887724 145
133 3300006931 Ga0097620_101181011 Ga0097620_1011810111 145
134 3300009101 Ga0105247_10756654 Ga0105247_107566541 145
135 3300009148 Ga0105243_10265205 Ga0105243_102652052 145
136 3300009174 Ga0105241_10206805 Ga0105241_102068052 145
137 3300009176 Ga0105242_10015276 Ga0105242_100152764 145
138 3300009176 Ga0105242_11378628 Ga0105242_113786281 145
139 3300009553 Ga0105249_10012772 Ga0105249_100127727 145
140 3300009553 Ga0105249_10122707 Ga0105249_101227072 145
141 3300009553 Ga0105249_10625090 Ga0105249_106250902 145
142 3300011119 Ga0105246_10107648 Ga0105246_101076482 145
143 3300011119 Ga0105246_12102551 Ga0105246_121025512 145
144 3300013100 Ga0157373_10028311 Ga0157373_100283113 145
145 3300013100 Ga0157373_10329526 Ga0157373_103295262 145
146 3300013100 Ga0157373_11300839 Ga0157373_113008392 145
147 3300013102 Ga0157371_10020401 Ga0157371_100204012 145
148 3300013102 Ga0157371_10154222 Ga0157371_101542222 145
149 3300013102 Ga0157371_10716348 Ga0157371_107163481 145
150 3300013104 Ga0157370_10006329 Ga0157370_1000632912 145
151 3300013104 Ga0157370_10568527 Ga0157370_105685271 145
152 3300013105 Ga0157369_10096676 Ga0157369_100966763 145
153 3300013296 Ga0157374_10004889 Ga0157374_100048897 145
154 3300013296 Ga0157374_10088801 Ga0157374_100888014 145
155 3300013296 Ga0157374_10843177 Ga0157374_108431772 145
156 3300013297 Ga0157378_10472492 Ga0157378_104724922 145
157 3300013306 Ga0163162_10018262 Ga0163162_100182629 145
158 3300013306 Ga0163162_10032210 Ga0163162_100322103 145
159 3300013306 Ga0163162_12264465 Ga0163162_122644651 145
160 3300013307 Ga0157372_10157403 Ga0157372_101574032 145
161 3300013307 Ga0157372_10429357 Ga0157372_104293573 145
162 3300013307 Ga0157372_10826451 Ga0157372_108264511 145
163 3300013307 Ga0157372_10869913 Ga0157372_108699132 145
164 3300013307 Ga0157372_11236326 Ga0157372_112363261 145
165 3300013308 Ga0157375_10000510 Ga0157375_1000051038 145
166 3300013308 Ga0157375_10071312 Ga0157375_100713123 145
167 3300013308 Ga0157375_10170224 Ga0157375_101702244 145
168 3300013308 Ga0157375_10444259 Ga0157375_104442592 145
169 3300013308 Ga0157375_11088862 Ga0157375_110888621 145
170 3300014325 Ga0163163_10073560 Ga0163163_100735603 145
171 3300014325 Ga0163163_10173429 Ga0163163_101734293 145
172 3300014325 Ga0163163_10295217 Ga0163163_102952172 145
173 3300014325 Ga0163163_10677861 Ga0163163_106778612 145
174 3300014325 Ga0163163_10758535 Ga0163163_107585351 145
175 3300014325 Ga0163163_12141941 Ga0163163_121419412 145
176 3300014326 Ga0157380_10136660 Ga0157380_101366601 145
177 3300014326 Ga0157380_10147692 Ga0157380_101476922 145
178 3300014326 Ga0157380_10762464 Ga0157380_107624642 145
179 3300014326 Ga0157380_12451271 Ga0157380_124512711 145
180 3300014745 Ga0157377_10090713 Ga0157377_100907133 145
181 3300014745 Ga0157377_10224136 Ga0157377_102241362 145
182 3300014745 Ga0157377_10262242 Ga0157377_102622422 145
183 3300014968 Ga0157379_10104818 Ga0157379_101048183 145
184 3300014968 Ga0157379_10319042 Ga0157379_103190421 145
185 3300014969 Ga0157376_10163873 Ga0157376_101638733 145
186 3300017792 Ga0163161_11626101 Ga0163161_116261011 145
187 3300025321 Ga0207656_10103728 Ga0207656_101037281 145
188 3300025321 Ga0207656_10383237 Ga0207656_103832371 145
189 3300025900 Ga0207710_10301747 Ga0207710_103017472 145
190 3300025901 Ga0207688_10319228 Ga0207688_103192281 145
191 3300025904 Ga0207647_10229008 Ga0207647_102290082 145
192 3300025907 Ga0207645_10001124 Ga0207645_1000112411 145
193 3300025907 Ga0207645_10228760 Ga0207645_102287602 145
194 3300025908 Ga0207643_10149595 Ga0207643_101495952 145
195 3300025909 Ga0207705_10695046 Ga0207705_106950461 145
196 3300025918 Ga0207662_10060973 Ga0207662_100609733 145
197 3300025918 Ga0207662_10300737 Ga0207662_103007372 145
198 3300025919 Ga0207657_10243965 Ga0207657_102439651 145
199 3300025920 Ga0207649_10023979 Ga0207649_100239792 145
200 3300025923 Ga0207681_10056770 Ga0207681_100567702 145
201 3300025923 Ga0207681_10501836 Ga0207681_105018362 145
202 3300025923 Ga0207681_11006067 Ga0207681_110060672 145
203 3300025925 Ga0207650_10033375 Ga0207650_100333753 145
204 3300025925 Ga0207650_10573450 Ga0207650_105734502 145
205 3300025925 Ga0207650_10915713 Ga0207650_109157131 145
206 3300025925 Ga0207650_11144807 Ga0207650_111448072 145
207 3300025926 Ga0207659_10050907 Ga0207659_100509072 145
208 3300025926 Ga0207659_10212777 Ga0207659_102127772 145
209 3300025926 Ga0207659_10296449 Ga0207659_102964491 145
210 3300025926 Ga0207659_10424614 Ga0207659_104246141 145
211 3300025931 Ga0207644_10926224 Ga0207644_109262241 145
212 3300025932 Ga0207690_10354241 Ga0207690_103542411 145
213 3300025933 Ga0207706_10107487 Ga0207706_101074873 145
214 3300025934 Ga0207686_10000655 Ga0207686_100006554 145
215 3300025936 Ga0207670_10022643 Ga0207670_100226433 145
216 3300025936 Ga0207670_10074566 Ga0207670_100745662 145
217 3300025936 Ga0207670_10140453 Ga0207670_101404531 145
218 3300025938 Ga0207704_10486386 Ga0207704_104863861 145
219 3300025940 Ga0207691_10076112 Ga0207691_100761123 145
220 3300025940 Ga0207691_10112559 Ga0207691_101125592 145
221 3300025941 Ga0207711_10552206 Ga0207711_105522062 145
222 3300025942 Ga0207689_10004698 Ga0207689_1000469814 145
223 3300025944 Ga0207661_11413028 Ga0207661_114130281 145
224 3300025945 Ga0207679_10013695 Ga0207679_100136952 145
225 3300025945 Ga0207679_10428857 Ga0207679_104288572 145
226 3300025945 Ga0207679_10622082 Ga0207679_106220821 145
227 3300025945 Ga0207679_10763248 Ga0207679_107632482 145
228 3300025945 Ga0207679_10786899 Ga0207679_107868992 145
229 3300025960 Ga0207651_10080222 Ga0207651_100802224 145
230 3300025960 Ga0207651_10298686 Ga0207651_102986862 145
231 3300025960 Ga0207651_10370041 Ga0207651_103700412 145
232 3300025961 Ga0207712_10008426 Ga0207712_100084263 145
233 3300025961 Ga0207712_10821842 Ga0207712_108218421 145
234 3300025972 Ga0207668_10310953 Ga0207668_103109532 145
235 3300025981 Ga0207640_10112504 Ga0207640_101125041 145
236 3300025981 Ga0207640_10984226 Ga0207640_109842261 145
237 3300025981 Ga0207640_11379194 Ga0207640_113791941 145
238 3300025986 Ga0207658_10740677 Ga0207658_107406771 145
239 3300026035 Ga0207703_11286490 Ga0207703_112864902 145
240 3300026041 Ga0207639_10305590 Ga0207639_103055902 145
241 3300026075 Ga0207708_10216134 Ga0207708_102161342 145
242 3300026075 Ga0207708_10484085 Ga0207708_104840852 145
243 3300026075 Ga0207708_10533995 Ga0207708_105339952 145
244 3300026088 Ga0207641_10000810 Ga0207641_1000081012 145
245 3300026088 Ga0207641_10393946 Ga0207641_103939462 145
246 3300026088 Ga0207641_10624269 Ga0207641_106242692 145
247 3300026088 Ga0207641_10639156 Ga0207641_106391561 145
248 3300026088 Ga0207641_11059295 Ga0207641_110592952 145
249 3300026088 Ga0207641_12341103 Ga0207641_123411031 145
250 3300026089 Ga0207648_10329592 Ga0207648_103295922 145
251 3300026089 Ga0207648_10370004 Ga0207648_103700042 145
252 3300026089 Ga0207648_10556624 Ga0207648_105566242 145
253 3300026095 Ga0207676_10048576 Ga0207676_100485762 145
254 3300026095 Ga0207676_10129029 Ga0207676_101290294 145
255 3300026095 Ga0207676_10259558 Ga0207676_102595582 145
256 3300026095 Ga0207676_11586765 Ga0207676_115867652 145
257 3300026116 Ga0207674_10030917 Ga0207674_100309172 145
258 3300026116 Ga0207674_10261667 Ga0207674_102616671 145
259 3300026116 Ga0207674_10323570 Ga0207674_103235702 145
260 3300026116 Ga0207674_10577663 Ga0207674_105776631 145
261 3300026116 Ga0207674_10583579 Ga0207674_105835792 145
262 3300026118 Ga0207675_100005780 Ga0207675_10000578012 145
263 3300026118 Ga0207675_100059885 Ga0207675_1000598854 145
264 3300026121 Ga0207683_10051591 Ga0207683_100515911 145
265 3300026142 Ga0207698_10490939 Ga0207698_104909392 145
266 3300026142 Ga0207698_10885955 Ga0207698_108859552 145
267 3300026142 Ga0207698_11147267 Ga0207698_111472671 145
268 3300026142 Ga0207698_12172764 Ga0207698_121727641 145
269 3300027876 Ga0209974_10023812 Ga0209974_100238121 145
270 3300028379 Ga0268266_10611441 Ga0268266_106114412 145
271 3300028381 Ga0268264_10326515 Ga0268264_103265152 145
272 3300028381 Ga0268264_10697675 Ga0268264_106976751 145
273 3300032004 Ga0307414_10445009 Ga0307414_104450092 145
274 3300032005 Ga0307411_10513243 Ga0307411_105132431 145
275 3300036401 Ga0373937_0605484 Ga0373937_0605484_448_888 145
276 3300041460 Ga0451802_0294214 Ga0451802_0294214_94_534 145
277 3300042876 Ga0451577_0070098 Ga0451577_0070098_923_1363 145
278 3300044693 Ga0466961_0504002 Ga0466961_0504002_88_534 145
279 3300044712 Ga0453684_0149220 Ga0453684_0149220_465_905 145
280 3300045049 Ga0466959_0667981 Ga0466959_0667981_78_527 145
281 3300046517 Ga0495630_0830436 Ga0495630_0830436_170_610 145
282 3300046537 Ga0495598_0078567 Ga0495598_0078567_88_528 145
283 3300046648 Ga0495611_0146345 Ga0495611_0146345_109_558 145
284 3300046674 Ga0495588_0417129 Ga0495588_0417129_134_574 145
285 3300049708 Ga0501245_137605 Ga0501245_137605_39_479 145
286 3300049765 Ga0501268_043914 Ga0501268_043914_67_507 145
287 3300050508 nmdc:mga09592_915407_c1 nmdc:mga09592_915407_c1_106_546 145
288 3300053098 Ga0500650_0110225 Ga0500650_0110225_436_876 145
289 3300053130 Ga0500642_0035883 Ga0500642_0035883_1455_1898 145
290 3300005289 Ga0065704_10172064 Ga0065704_101720642 146
291 3300005295 Ga0065707_10105951 Ga0065707_101059512 146
292 3300005327 Ga0070658_10500011 Ga0070658_105000111 146
293 3300005329 Ga0070683_100251795 Ga0070683_1002517953 146
294 3300005331 Ga0070670_101824445 Ga0070670_1018244451 146
295 3300005334 Ga0068869_100174721 Ga0068869_1001747212 146
296 3300005338 Ga0068868_100438878 Ga0068868_1004388782 146
297 3300005340 Ga0070689_100174360 Ga0070689_1001743602 146
298 3300005347 Ga0070668_100012840 Ga0070668_1000128407 146
299 3300005353 Ga0070669_100005547 Ga0070669_1000055478 146
300 3300005354 Ga0070675_100031508 Ga0070675_1000315082 146
301 3300005355 Ga0070671_100413357 Ga0070671_1004133572 146
302 3300005365 Ga0070688_100018068 Ga0070688_1000180683 146
303 3300005456 Ga0070678_100988301 Ga0070678_1009883012 146
304 3300005457 Ga0070662_100021381 Ga0070662_1000213814 146
305 3300005549 Ga0070704_101454080 Ga0070704_1014540801 146
306 3300005564 Ga0070664_101896830 Ga0070664_1018968301 146
307 3300005577 Ga0068857_100093730 Ga0068857_1000937302 146
308 3300005578 Ga0068854_100531353 Ga0068854_1005313532 146
309 3300005617 Ga0068859_100215263 Ga0068859_1002152632 146
310 3300005617 Ga0068859_100594499 Ga0068859_1005944992 146
311 3300005719 Ga0068861_100037117 Ga0068861_1000371172 146
312 3300005840 Ga0068870_10016854 Ga0068870_100168544 146
313 3300005841 Ga0068863_100154040 Ga0068863_1001540404 146
314 3300005844 Ga0068862_100010686 Ga0068862_1000106862 146
315 3300006195 Ga0075366_10028017 Ga0075366_100280174 146
316 3300006931 Ga0097620_100215241 Ga0097620_1002152412 146
317 3300006931 Ga0097620_100594426 Ga0097620_1005944262 146
318 3300009094 Ga0111539_10002347 Ga0111539_1000234718 146
319 3300009174 Ga0105241_11082383 Ga0105241_110823832 146
320 3300009545 Ga0105237_12122468 Ga0105237_121224681 146
321 3300009553 Ga0105249_10035993 Ga0105249_100359932 146
322 3300013102 Ga0157371_10169827 Ga0157371_101698272 146
323 3300013104 Ga0157370_10007394 Ga0157370_100073947 146
324 3300013105 Ga0157369_10023264 Ga0157369_100232648 146
325 3300013306 Ga0163162_10052641 Ga0163162_100526413 146
326 3300013306 Ga0163162_10386109 Ga0163162_103861093 146
327 3300013307 Ga0157372_10319980 Ga0157372_103199802 146
328 3300013308 Ga0157375_10193942 Ga0157375_101939422 146
329 3300025907 Ga0207645_10311993 Ga0207645_103119932 146
330 3300025908 Ga0207643_10008981 Ga0207643_100089814 146
331 3300025923 Ga0207681_10218063 Ga0207681_102180632 146
332 3300025931 Ga0207644_10342347 Ga0207644_103423472 146
333 3300025936 Ga0207670_10059572 Ga0207670_100595722 146
334 3300025940 Ga0207691_10017517 Ga0207691_100175174 146
335 3300025942 Ga0207689_10068922 Ga0207689_100689224 146
336 3300025945 Ga0207679_11143669 Ga0207679_111436692 146
337 3300025960 Ga0207651_10122850 Ga0207651_101228502 146
338 3300025961 Ga0207712_10179456 Ga0207712_101794562 146
339 3300025972 Ga0207668_10109903 Ga0207668_101099032 146
340 3300025981 Ga0207640_10103718 Ga0207640_101037182 146
341 3300026088 Ga0207641_10075354 Ga0207641_100753542 146
342 3300026089 Ga0207648_10403351 Ga0207648_104033512 146
343 3300026116 Ga0207674_10037862 Ga0207674_100378622 146
344 3300026118 Ga0207675_100001377 Ga0207675_10000137719 146
345 3300026121 Ga0207683_11533961 Ga0207683_115339612 146
346 3300027907 Ga0207428_10073029 Ga0207428_100730292 146
347 3300028380 Ga0268265_10017475 Ga0268265_100174752 146
348 3300035086 Ga0373934_0057539 Ga0373934_0057539_730_1176 146
349 3300035172 Ga0373955_0017654 Ga0373955_0017654_591_1037 146
350 3300035410 Ga0373924_0027850 Ga0373924_0027850_399_845 146
351 3300035692 Ga0373935_0701897 Ga0373935_0701897_24_470 146
352 3300035724 Ga0373933_0064323 Ga0373933_0064323_1581_2027 146
353 3300035725 Ga0373947_0442511 Ga0373947_0442511_207_653 146
354 3300036401 Ga0373937_0072976 Ga0373937_0072976_210_656 146
355 3300037068 Ga0373925_0445951 Ga0373925_0445951_427_873 146
356 3300037068 Ga0373925_0633303 Ga0373925_0633303_86_532 146
357 3300046454 Ga0495592_0035601 Ga0495592_0035601_838_1284 146
358 3300046511 Ga0495608_0092307 Ga0495608_0092307_1243_1689 146
359 3300046516 Ga0495628_0039159 Ga0495628_0039159_1164_1610 146
360 3300046517 Ga0495630_0004855 Ga0495630_0004855_6997_7443 146
361 3300046529 Ga0495652_0169766 Ga0495652_0169766_61_507 146
362 3300046533 Ga0495640_0216890 Ga0495640_0216890_534_980 146
363 3300046536 Ga0495587_0026062 Ga0495587_0026062_2658_3104 146
364 3300046642 Ga0495634_0030572 Ga0495634_0030572_2006_2452 146
365 3300046663 Ga0495635_0225923 Ga0495635_0225923_234_680 146
366 3300046675 Ga0495657_0054036 Ga0495657_0054036_1320_1766 146
367 3300046683 Ga0495658_0106191 Ga0495658_0106191_905_1351 146
368 3300046689 Ga0495613_0456463 Ga0495613_0456463_246_692 146
369 3300047317 Ga0495604_0195141 Ga0495604_0195141_75_521 146
370 3300047319 Ga0495674_0169128 Ga0495674_0169128_687_1133 146
371 3300047321 Ga0495676_0479327 Ga0495676_0479327_27_473 146
372 3300047322 Ga0495680_0062929 Ga0495680_0062929_97_543 146
373 3300047471 Ga0495684_0223883 Ga0495684_0223883_376_822 146
374 3300050496 nmdc:mga07m45_395442_c1 nmdc:mga07m45_395442_c1_241_684 146
375 3300053085 Ga0495619_0118942 Ga0495619_0118942_1246_1692 146
376 3300053142 Ga0500577_0113530 Ga0500577_0113530_122_568 146
377 3300003322 rootL2_10050041 rootL2_100500414 147
378 3300003323 rootH1_10148967 rootH1_101489674 147
379 3300005288 Ga0065714_10064592 Ga0065714_1006459220 147
380 3300046453 Ga0495627_000002 Ga0495627_000002_19082_19525 147
381 3300046530 Ga0495654_0000001 Ga0495654_0000001_1452969_1453412 147
382 3300046558 Ga0495633_0004790 Ga0495633_0004790_3805_4248 147
383 3300046660 Ga0495625_0010370 Ga0495625_0010370_3055_3498 147
384 3300047472 Ga0495686_0027830 Ga0495686_0027830_264_707 147
385 3300048920 Ga0496117_0239454 Ga0496117_0239454_149_592 147
386 3300048925 Ga0496122_0009109 Ga0496122_0009109_7434_7877 147
387 3300048926 Ga0496123_0047108 Ga0496123_0047108_2299_2742 147
388 2162886007 SwRhRL2b_contig_1805906 SwRhRL2b_0983.00000750 148
389 3300005289 Ga0065704_10087913 Ga0065704_100879134 148
390 3300009092 Ga0105250_10093842 Ga0105250_100938422 148
391 3300013100 Ga0157373_10335670 Ga0157373_103356702 148
392 3300017792 Ga0163161_10000975 Ga0163161_1000097517 148
393 3300025711 Ga0207696_1066228 Ga0207696_10662282 148
394 3300046522 Ga0495643_0232681 Ga0495643_0232681_172_618 148
395 3300046538 Ga0495609_0000058 Ga0495609_0000058_66358_66804 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13098

Thioredoxin_2

Thioredoxin-like domain

62

170

0.79

PF13899

Thioredoxin_7

Thioredoxin-like

50

146

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p05-assembly1.cif.gz_A bacterial arylsulfate sulfotransferase (asst) h436n mutant with 4-nitrophenyl sulfate (pns) in the active site 0.9727 110 125
2ju5-assembly1.cif.gz_A dsbh oxidoreductase 0.8814 20 144
4p04-assembly1.cif.gz_A apo form of bacterial arylsulfate sulfotransferase (asst) h436n mutant with mpo in the active site 0.8459 110 128
3d21-assembly2.cif.gz_B crystal structure of a poplar wild-type thioredoxin h, pttrxh4 0.763 22 142
8fgw-assembly1.cif.gz_C human ift-a complex structures provide molecular insights into ciliary transport 0.7589 110 126
ID Description Score Start End Superfamily
af_Q8NEZ3_15_360_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9478 110 125 2.130.10.10
af_A0A0R0E851_205_343_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.9312 109 125 2.120.10.80
af_A0A1D8PN56_49_337_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8957 110 125 2.130.10.10
af_F4J381_57_212_2.130.10.110 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Clathrin heavy-chain terminal domain 0.8834 109 125 2.130.10.110
af_Q9NEW7_1_162_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8817 110 125 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A2W6RM01-F1-model_v4 Thioredoxin family protein 0.9875 42 146
AF-A0A2W6RM01-F1-model_v4 Thioredoxin family protein 0.9692 42 146
AF-A0A444VT60-F1-model_v4 Putative thioredoxin disulfide isomerase 0.9653 24 146 GO:0016853
AF-A6E9E7-F1-model_v4 Putative thioredoxin disulfide isomerase 0.9597 21 145 GO:0016853
AF-G8R8H8-F1-model_v4 FAD:protein FMN transferase (EC 2.7.1.180) (Flavin transferase) 0.9542 35 142 GO:0016740
GO:0046872

Feature Viewer

pLDDT pTM Quality
89.89 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map