F433074

General Info

Members Datasets Scaffolds Average Seq Length
394 255 788 265

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2515154155|2515850736
Length 301
Sequence VRGRSRLNTGGDRGRPRLNTGGIRVGSRISAVLSARRRHRFAGAVVVMIALGAFGGAYALASPSSKASADAAQATQIEEGRKLFAVSCSSCHGLNAQGTNEGPTLIGVGAAAVDFQVGTGRMPAQQPGAQIPPKKVVFSDEEIAALSAYVASLGPGPSVPSKEQLNTSDLTDAEIAEGGELFRTNCASCHNVAGKGGALTWGKYAPNLTGSSPRHIYEAMLTGPQQMPVFSEAVITPDDKRKIIGYLEALKTEPSRGGFGLGGLGPVTEGLATWIVGIGSLVIITVWIASRGQKVKGVKGK

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
27 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
43 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
45 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
67 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
68 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
71 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
72 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
73 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
74 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
75 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
79 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
80 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
93 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
94 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
95 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
96 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
97 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
98 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
99 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
115 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
118 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
119 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
123 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
126 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
130 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
131 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
132 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
133 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
138 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
139 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
147 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
193 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
194 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
195 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
196 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
197 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
198 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
199 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
200 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
201 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
202 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
203 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
204 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
205 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
206 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
207 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
208 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
213 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
214 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
215 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
216 2643221548 Streptomyces sp. Root55 Isolate Unclassified
217 2643221578 Streptomyces sp. Root63 Isolate Unclassified
218 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
219 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
220 2643221670 Streptomyces sp. Root431 Isolate Unclassified
221 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
222 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
223 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
224 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
225 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
226 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
227 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
228 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
229 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
230 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
231 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
232 2862574272 Streptomyces sp. AcE210 Isolate Nodule
233 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
234 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
235 2867369537 Streptomyces sp. Z26 Isolate Unclassified
236 2867475112 Streptomyces sp. TM32 Isolate Unclassified
237 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
238 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
239 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
240 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
241 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
242 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
243 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
244 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
245 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
246 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
247 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
248 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
249 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
250 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
251 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
252 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
253 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
254 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
255 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.82
Metatranscriptomes 1.02
Isolates 11.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.09
Nodule 0.51
Rhizoplane 5.08
Rhizosphere 78.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007397 3300001979 Bacteria 4468
2 JGI24740J21852_10029183 3300001979 Bacteria 1814
3 JGI24739J22299_10001876 3300001989 Bacteria 8018
4 JGI24739J22299_10032070 3300001989 Bacteria 1811
5 JGI24737J22298_10005947 3300001990 Bacteria 4190
6 JGI24735J21928_10006849 3300002067 Bacteria 3731
7 JGI24735J21928_10023444 3300002067 Bacteria 1872
8 rootH2_10027946 3300003320 Bacteria 5035
9 JGI25160J50197_1018756 3300003354 Bacteria 2144
10 Ga0070658_10022385 3300005327 Bacteria 5071
11 Ga0070658_10027012 3300005327 Bacteria 4609
12 Ga0070658_10107119 3300005327 Bacteria 2313
13 Ga0070660_100161116 3300005339 Bacteria 1808
14 Ga0070661_100257492 3300005344 Bacteria 1348
15 Ga0070667_100037924 3300005367 Bacteria 4041
16 Ga0070663_100110395 3300005455 Bacteria 2065
17 Ga0070678_100239753 3300005456 Bacteria 1516
18 Ga0070679_100117348 3300005530 Bacteria 2646
19 Ga0068855_100035129 3300005563 Bacteria 5971
20 Ga0070664_100162979 3300005564 Bacteria 1974
21 Ga0068857_100079438 3300005577 Bacteria 2928
22 Ga0068854_100532585 3300005578 Bacteria 994
23 Ga0068856_100259860 3300005614 Bacteria 1752
24 Ga0081455_10050845 3300005937 Bacteria 3560
25 Ga0075365_10001112 3300006038 Bacteria 11733
26 Ga0075363_100096216 3300006048 Bacteria 1635
27 Ga0075428_100015256 3300006844 Bacteria 8522
28 Ga0075428_100032129 3300006844 Bacteria 5798
29 Ga0075430_100007182 3300006846 Bacteria 9398
30 Ga0075431_100009290 3300006847 Bacteria 9864
31 Ga0075431_100139946 3300006847 Bacteria 2495
32 Ga0075429_100017446 3300006880 Bacteria 6207
33 Ga0075429_100120948 3300006880 Bacteria 2289
34 Ga0105251_10009561 3300009011 Bacteria 5712
35 Ga0105250_10005086 3300009092 Bacteria 5942
36 Ga0105240_10018433 3300009093 Bacteria 9371
37 Ga0105247_10185217 3300009101 Bacteria 1391
38 Ga0114129_10010612 3300009147 Bacteria 13136
39 Ga0114129_10398849 3300009147 Bacteria 1813
40 Ga0105239_10015659 3300010375 Bacteria 8394
41 Ga0105246_10276392 3300011119 Bacteria 1345
42 Ga0157324_1002324 3300012506 Bacteria 1150
43 Ga0157370_10010581 3300013104 Bacteria 9712
44 Ga0157369_10016725 3300013105 Bacteria 8243
45 Ga0157369_10198053 3300013105 Bacteria 2108
46 Ga0163162_10862012 3300013306 Bacteria 1020
47 Ga0157372_10017015 3300013307 Bacteria 7804
48 Ga0157372_10063118 3300013307 Bacteria 4153
49 Ga0163161_10175169 3300017792 Bacteria 1642
50 Ga0206351_10060730 3300020077 Bacteria 1778
51 Ga0206350_11507032 3300020080 Bacteria 1648
52 Ga0206353_10055318 3300020082 Bacteria 1230
53 Ga0213875_10019416 3300021388 Bacteria 3269
54 Ga0224712_10026128 3300022467 Bacteria 2061
55 Ga0207426_1003049 3300025302 Bacteria 9666
56 Ga0207426_1003352 3300025302 Bacteria 8811
57 Ga0207713_1010515 3300025735 Bacteria 5115
58 Ga0207688_10242590 3300025901 Bacteria 1090
59 Ga0207647_10010970 3300025904 Bacteria 6374
60 Ga0207647_10041887 3300025904 Bacteria 2876
61 Ga0207705_10023556 3300025909 Bacteria 4392
62 Ga0207652_10090018 3300025921 Bacteria 2695
63 Ga0207694_10125623 3300025924 Bacteria 2052
64 Ga0207687_10122902 3300025927 Bacteria 1944
65 Ga0207644_10180316 3300025931 Bacteria 1655
66 Ga0207679_10479408 3300025945 Bacteria 1107
67 Ga0207667_10027201 3300025949 Bacteria 6232
68 Ga0207668_10241045 3300025972 Bacteria 1463
69 Ga0207658_10069700 3300025986 Bacteria 2658
70 Ga0207678_10106242 3300026067 Bacteria 2395
71 Ga0207708_10600367 3300026075 Bacteria 932
72 Ga0207702_10107210 3300026078 Bacteria 2477
73 Ga0207641_10152068 3300026088 Bacteria 2097
74 Ga0207674_10023458 3300026116 Bacteria 6609
75 Ga0207674_10057863 3300026116 Bacteria 3929
76 Ga0207683_10090181 3300026121 Bacteria 2729
77 Ga0268266_10383104 3300028379 Bacteria 1327
78 Ga0268265_10134877 3300028380 Bacteria 2058
79 Ga0268264_10762371 3300028381 Bacteria 965
80 Ga0265334_10000488 3300028573 Bacteria 20478
81 Ga0307517_10005571 3300028786 Bacteria 18920
82 Ga0307515_10408709 3300028794 Bacteria 981
83 Ga0265338_10132432 3300028800 Bacteria 1966
84 Ga0265338_10176532 3300028800 Bacteria 1632
85 Ga0307511_10018496 3300030521 Bacteria 6650
86 Ga0307512_10011088 3300030522 Bacteria 8554
87 Ga0307512_10083343 3300030522 Bacteria 2281
88 Ga0316181_1265471 3300030744 Bacteria 1346
89 Ga0265325_10021094 3300031241 Bacteria 3584
90 Ga0265340_10011466 3300031247 Bacteria 4708
91 Ga0265340_10017523 3300031247 Bacteria 3706
92 Ga0265339_10043931 3300031249 Bacteria 2468
93 Ga0265316_10070138 3300031344 Bacteria 2704
94 Ga0307513_10037315 3300031456 Bacteria 5410
95 Ga0307513_10081887 3300031456 Bacteria 3324
96 Ga0307513_10337078 3300031456 Bacteria 1260
97 Ga0307513_10400168 3300031456 Bacteria 1108
98 Ga0265313_10097874 3300031595 Bacteria 1306
99 Ga0307508_10002091 3300031616 Bacteria 21502
100 Ga0307508_10073775 3300031616 Bacteria 2988
101 Ga0307514_10049889 3300031649 Bacteria 3251
102 Ga0307514_10133622 3300031649 Bacteria 1703
103 Ga0265314_10074783 3300031711 Bacteria 2256
104 Ga0265342_10257941 3300031712 Bacteria 928
105 Ga0307516_10094336 3300031730 Bacteria 2817
106 Ga0307516_10191505 3300031730 Bacteria 1771
107 Ga0307516_10320140 3300031730 Bacteria 1222
108 Ga0307409_100309202 3300031995 Bacteria 1474
109 Ga0307416_100161966 3300032002 Bacteria 2069
110 Ga0307416_100331354 3300032002 Bacteria 1530
111 Ga0307415_100442477 3300032126 Bacteria 1121
112 Ga0373925_0258284 3300037068 Bacteria 1399
113 Ga0395900_0101969 3300037418 Bacteria 2948
114 Ga0395898_0012869 3300037466 Bacteria 8632
115 Ga0395898_0534869 3300037466 Bacteria 1114
116 Ga0436364_0575575 3300037853 Bacteria 25165
117 Ga0395901_0123523 3300038443 Bacteria 2720
118 Ga0439466_0112525 3300041411 Bacteria 844
119 Ga0451789_0898930 3300041443 Bacteria 1121
120 Ga0451797_0695606 3300041453 Bacteria 1032
121 Ga0451843_1228398 3300041509 Bacteria 991
122 Ga0451853_0845768 3300041512 Bacteria 5306
123 Ga0439464_0013133 3300042439 Bacteria 2214
124 Ga0466969_0003967 3300044656 Bacteria 7858
125 Ga0466972_0096114 3300044658 Bacteria 1403
126 Ga0466965_0022236 3300044683 Bacteria 3057
127 Ga0466966_0007113 3300044684 Bacteria 7417
128 Ga0466966_0018307 3300044684 Bacteria 4620
129 Ga0466966_0087243 3300044684 Bacteria 1939
130 Ga0466961_0098074 3300044693 Bacteria 1847
131 Ga0466963_0067952 3300044694 Bacteria 2392
132 Ga0466963_0210072 3300044694 Bacteria 1362
133 Ga0466971_0001221 3300044719 Bacteria 10681
134 Ga0466971_0114549 3300044719 Bacteria 1246
135 Ga0466970_0028481 3300044765 Bacteria 2935
136 Ga0466957_0091960 3300044842 Bacteria 1902
137 Ga0466957_0388112 3300044842 Bacteria 953
138 Ga0466959_0004207 3300045049 Bacteria 9589
139 Ga0466959_0008035 3300045049 Bacteria 7433
140 Ga0466958_0083728 3300045836 Bacteria 1966
141 Ga0466967_0033016 3300045976 Bacteria 4378
142 Ga0466967_0082240 3300045976 Bacteria 2910
143 Ga0466967_0268926 3300045976 Bacteria 1633
144 Ga0495592_0012860 3300046454 Bacteria 6363
145 Ga0495592_0013028 3300046454 Bacteria 6327
146 Ga0495629_0019095 3300046459 Bacteria 4901
147 Ga0495629_0122645 3300046459 Bacteria 1810
148 Ga0495662_0000153 3300046476 Bacteria 27091
149 Ga0495664_0001155 3300046477 Bacteria 13720
150 Ga0495585_0078661 3300046492 Bacteria 1789
151 Ga0495594_0160130 3300046499 Bacteria 1279
152 Ga0495628_0018734 3300046516 Bacteria 5729
153 Ga0495632_0081111 3300046519 Bacteria 1547
154 Ga0495643_0003395 3300046522 Bacteria 11705
155 Ga0495666_0000291 3300046526 Bacteria 21941
156 Ga0495652_0004810 3300046529 Bacteria 12849
157 Ga0495640_0008847 3300046533 Bacteria 7870
158 Ga0495586_0027715 3300046535 Bacteria 3031
159 Ga0495586_0097836 3300046535 Bacteria 1626
160 Ga0495597_0157096 3300046542 Bacteria 930
161 Ga0495645_0001733 3300046543 Bacteria 14799
162 Ga0495645_0068859 3300046543 Bacteria 2554
163 Ga0495667_0023730 3300046559 Bacteria 4131
164 Ga0495611_0096827 3300046648 Bacteria 1367
165 Ga0495625_0086383 3300046660 Bacteria 2176
166 Ga0495625_0151934 3300046660 Bacteria 1556
167 Ga0495635_0060718 3300046663 Bacteria 2597
168 Ga0495659_0120127 3300046664 Bacteria 1034
169 Ga0495588_0060157 3300046674 Bacteria 1966
170 Ga0495657_0022933 3300046675 Bacteria 4467
171 Ga0495657_0275109 3300046675 Bacteria 1009
172 Ga0495623_0012973 3300046679 Bacteria 5394
173 Ga0495623_0027809 3300046679 Bacteria 3640
174 Ga0495646_0008970 3300046680 Bacteria 6348
175 Ga0495658_0020807 3300046683 Bacteria 3450
176 Ga0495669_0010654 3300046684 Bacteria 3889
177 Ga0495613_0144481 3300046689 Bacteria 1698
178 Ga0495670_0006156 3300046691 Bacteria 5892
179 Ga0495589_0095090 3300046794 Bacteria 1445
180 Ga0495600_0048018 3300046809 Bacteria 2785
181 Ga0495604_0000757 3300047317 Bacteria 27189
182 Ga0495604_0022372 3300047317 Bacteria 5048
183 Ga0495636_0000692 3300047318 Bacteria 12368
184 Ga0495672_0006718 3300047320 Bacteria 8829
185 Ga0495676_0230562 3300047321 Bacteria 1272
186 Ga0495683_0035265 3300047323 Bacteria 2543
187 Ga0495675_0019097 3300047444 Bacteria 4354
188 Ga0495675_0087913 3300047444 Bacteria 1952
189 Ga0495685_000187 3300047447 Bacteria 20543
190 Ga0495685_034013 3300047447 Bacteria 1751
191 Ga0495681_0008967 3300047470 Bacteria 6208
192 Ga0495684_0047653 3300047471 Bacteria 3277
193 Ga0495593_0039844 3300047673 Bacteria 2531
194 Ga0496105_0065837 3300048908 Bacteria 2991
195 Ga0496108_0048397 3300048911 Bacteria 3555
196 Ga0496108_0248269 3300048911 Bacteria 1548
197 Ga0496108_0392305 3300048911 Bacteria 1212
198 Ga0496108_0403857 3300048911 Bacteria 1193
199 Ga0496109_0017055 3300048912 Bacteria 6356
200 Ga0496109_0045458 3300048912 Bacteria 3985
201 Ga0496109_0069385 3300048912 Bacteria 3232
202 Ga0496109_0111499 3300048912 Bacteria 2544
203 Ga0496110_0002225 3300048913 Bacteria 14501
204 Ga0496110_0187995 3300048913 Bacteria 1876
205 Ga0496110_0237109 3300048913 Bacteria 1660
206 Ga0496110_0388982 3300048913 Bacteria 1271
207 Ga0496111_0199786 3300048914 Bacteria 1486
208 Ga0496111_0241861 3300048914 Bacteria 1340
209 Ga0496114_0010997 3300048917 Bacteria 7216
210 Ga0496114_0108007 3300048917 Bacteria 2382
211 Ga0501031_0000940 3300049568 Bacteria 17600
212 Ga0501031_0004245 3300049568 Bacteria 9254
213 Ga0501031_0091186 3300049568 Bacteria 1987
214 Ga0501031_0138548 3300049568 Bacteria 1590
215 Ga0501031_0203471 3300049568 Bacteria 1291
216 Ga0501031_0307447 3300049568 Bacteria 1027
217 Ga0501032_0000349 3300049569 Bacteria 38615
218 Ga0501032_0004912 3300049569 Bacteria 10002
219 Ga0501032_0027416 3300049569 Bacteria 3914
220 Ga0501032_0053057 3300049569 Bacteria 2731
221 Ga0501032_0135827 3300049569 Bacteria 1621
222 Ga0501033_0007505 3300049570 Bacteria 8486
223 Ga0501033_0007761 3300049570 Bacteria 8313
224 Ga0501033_0009633 3300049570 Bacteria 7432
225 Ga0501033_0044516 3300049570 Bacteria 3304
226 Ga0501034_0004152 3300049571 Bacteria 16221
227 Ga0501034_0021387 3300049571 Bacteria 6594
228 Ga0501034_0075409 3300049571 Bacteria 3380
229 Ga0501036_0005495 3300049572 Bacteria 10276
230 Ga0501036_0005640 3300049572 Bacteria 10152
231 Ga0501036_0006306 3300049572 Bacteria 9624
232 Ga0501036_0018027 3300049572 Bacteria 5911
233 Ga0501036_0226962 3300049572 Bacteria 1567
234 Ga0501036_0309920 3300049572 Bacteria 1320
235 Ga0501037_0002432 3300049573 Bacteria 13465
236 Ga0501037_0014658 3300049573 Bacteria 5768
237 Ga0501037_0024335 3300049573 Bacteria 4478
238 Ga0501037_0035657 3300049573 Bacteria 3667
239 Ga0501037_0161698 3300049573 Bacteria 1596
240 Ga0501037_0230746 3300049573 Bacteria 1300
241 Ga0501038_0018060 3300049574 Bacteria 6372
242 Ga0501038_0024726 3300049574 Bacteria 5354
243 Ga0501038_0046230 3300049574 Bacteria 3774
244 Ga0501038_0057387 3300049574 Bacteria 3343
245 Ga0501038_0103567 3300049574 Bacteria 2366
246 Ga0501038_0143681 3300049574 Bacteria 1950
247 Ga0501039_0015672 3300049575 Bacteria 5799
248 Ga0501039_0021675 3300049575 Bacteria 4929
249 Ga0501039_0088787 3300049575 Bacteria 2408
250 Ga0501039_0105350 3300049575 Bacteria 2202
251 Ga0501039_0183301 3300049575 Bacteria 1646
252 Ga0501039_0243620 3300049575 Bacteria 1414
253 Ga0501040_0003905 3300049576 Bacteria 9672
254 Ga0501040_0013748 3300049576 Bacteria 5325
255 Ga0501040_0048113 3300049576 Bacteria 2914
256 Ga0501041_0001346 3300049577 Bacteria 13537
257 Ga0501041_0007852 3300049577 Bacteria 6269
258 Ga0501042_0085635 3300049578 Bacteria 2260
259 Ga0501043_0003089 3300049579 Bacteria 13812
260 Ga0501043_0016633 3300049579 Bacteria 5765
261 Ga0501043_0030115 3300049579 Bacteria 4263
262 Ga0501043_0035426 3300049579 Bacteria 3926
263 Ga0501046_0001475 3300049580 Bacteria 22584
264 Ga0501046_0009640 3300049580 Bacteria 8326
265 Ga0501046_0136545 3300049580 Bacteria 1857
266 Ga0501047_0000309 3300049581 Bacteria 56264
267 Ga0501047_0010510 3300049581 Bacteria 8755
268 Ga0501047_0051980 3300049581 Bacteria 3960
269 Ga0501048_0002495 3300049582 Bacteria 14051
270 Ga0501048_0015246 3300049582 Bacteria 5677
271 Ga0501048_0026258 3300049582 Bacteria 4240
272 Ga0501067_0003144 3300049583 Bacteria 9115
273 Ga0501068_0001398 3300049584 Bacteria 12830
274 Ga0501068_0015873 3300049584 Bacteria 4336
275 Ga0501068_0024136 3300049584 Bacteria 3569
276 Ga0501069_0003348 3300049585 Bacteria 8229
277 Ga0501069_0087849 3300049585 Bacteria 1756
278 Ga0501069_0126527 3300049585 Bacteria 1462
279 Ga0501070_0005719 3300049586 Bacteria 10601
280 Ga0501070_0026926 3300049586 Bacteria 4821
281 Ga0501070_0028556 3300049586 Bacteria 4679
282 Ga0501070_0137215 3300049586 Bacteria 2019
283 Ga0501070_0140287 3300049586 Bacteria 1995
284 Ga0501070_0155006 3300049586 Bacteria 1889
285 Ga0501071_0004780 3300049587 Bacteria 8624
286 Ga0501071_0054193 3300049587 Bacteria 2894
287 Ga0501071_0132438 3300049587 Bacteria 1853
288 Ga0501071_0175064 3300049587 Bacteria 1607
289 Ga0501071_0307624 3300049587 Bacteria 1202
290 Ga0501072_0000317 3300049588 Bacteria 34327
291 Ga0501072_0148110 3300049588 Bacteria 1872
292 Ga0501072_0348139 3300049588 Bacteria 1176
293 Ga0501073_0005694 3300049589 Bacteria 9320
294 Ga0501074_0003000 3300049590 Bacteria 11873
295 Ga0501074_0014933 3300049590 Bacteria 5651
296 Ga0501074_0110868 3300049590 Bacteria 1963
297 Ga0501076_0049356 3300049592 Bacteria 3328
298 Ga0501077_0014233 3300049593 Bacteria 4995
299 Ga0501077_0195597 3300049593 Bacteria 1284
300 Ga0501079_0010913 3300049741 Bacteria 6920
301 Ga0501080_0065277 3300049742 Bacteria 3386
302 Ga0501083_0002475 3300049744 Bacteria 12663
303 Ga0501035_0000922 3300049822 Bacteria 31150
304 Ga0501035_0005042 3300049822 Bacteria 12507
305 Ga0501035_0013337 3300049822 Bacteria 7583
306 Ga0501035_0045020 3300049822 Bacteria 3971
307 Ga0501035_0045435 3300049822 Bacteria 3951
308 Ga0501035_0046817 3300049822 Bacteria 3888
309 Ga0501044_0002906 3300049823 Bacteria 19500
310 Ga0501044_0017943 3300049823 Bacteria 7588
311 Ga0501045_0008843 3300049824 Bacteria 7034
312 Ga0501045_0034068 3300049824 Bacteria 3695
313 Ga0501045_0057043 3300049824 Bacteria 2857
314 Ga0501045_0300547 3300049824 Bacteria 1195
315 nmdc:mga05p37_103573_c1 3300050507 Bacteria 3502
316 nmdc:mga05p37_4705_c1 3300050507 Bacteria 15944
317 nmdc:mga09592_131709_c1 3300050508 Bacteria 2152
318 nmdc:mga09592_476620_c1 3300050508 Bacteria 1076
319 nmdc:mga06r32_130561_c1 3300050510 Bacteria 2484
320 nmdc:mga06r32_357531_c1 3300050510 Bacteria 1445
321 Ga0495601_0001737 3300053077 Bacteria 12050
322 Ga0495619_0119562 3300053085 Bacteria 1806
323 Ga0500578_0019861 3300053086 Bacteria 4316
324 Ga0500646_0039601 3300053090 Bacteria 1323
325 Ga0500553_054802 3300053101 Bacteria 1896
326 Ga0500556_0050665 3300053104 Bacteria 1501
327 Ga0500569_001171 3300053109 Bacteria 4850
328 Ga0500614_001404 3300053123 Bacteria 5772
329 Ga0500628_001386 3300053129 Bacteria 4160
330 Ga0500652_002999 3300053131 Bacteria 5093
331 Ga0500658_0028106 3300053134 Bacteria 2179
332 Ga0500561_0001626 3300053137 Bacteria 3677
333 Ga0500573_0003452 3300053140 Bacteria 8181
334 Ga0500573_0043669 3300053140 Bacteria 2586
335 Ga0500573_0067247 3300053140 Bacteria 2048
336 Ga0500600_0002462 3300053149 Bacteria 10412
337 Ga0500616_0046692 3300053153 Bacteria 2301
338 Ga0500633_0007872 3300053160 Bacteria 2712
339 Ga0500634_0000444 3300053161 Bacteria 13455
340 Ga0500656_000041 3300053732 Bacteria 9519
341 Ga0500587_007184 3300053739 Bacteria 1456
342 Ga0501084_0000784 3300054114 Bacteria 24228
343 Ga0501084_0012347 3300054114 Bacteria 7075
344 Ga0501084_0034605 3300054114 Bacteria 4223
345 Ga0501082_0009988 3300060353 Bacteria 8183
346 Ga0501082_0056348 3300060353 Bacteria 3385
347 Ga0466962_0000908 3300061719 Bacteria 13429
348 Ga0530510_0027218 3300061734 Bacteria 4097
349 Ga0530510_0087740 3300061734 Bacteria 2266
350 Ga0530510_0189984 3300061734 Bacteria 1524
351 2515850736 2515154155 Bacteria 7985436
352 2554258944 2554235005 Bacteria 6457341
353 2585314042 2582581314 Bacteria 11452267
354 2643759339 2643221548 Bacteria 8053412
355 2643897409 2643221578 Bacteria 9213798
356 2644015057 2643221601 Bacteria 7493239
357 2644176859 2643221631 Bacteria 8168043
358 2644387354 2643221670 Bacteria 6497041
359 2644463243 2643221682 Bacteria 6743283
360 2676476905 2675903058 Bacteria 6822861
361 2768644333 2767802112 Bacteria 6465194
362 2785344910 2784746763 Bacteria 9783172
363 2793981930 2791355406 Bacteria 11364898
364 2816425141 2816332119 Bacteria 8120218
365 2816428161 2816332119 Bacteria 8120218
366 2819694082 2818991463 Bacteria 7948711
367 2819743220 2818991472 Bacteria 10089953
368 2827630004 2827628540 Bacteria 6858585
369 2862182913 2862178590 Bacteria 8583590
370 2862384703 2862382967 Bacteria 10317375
371 2862582905 2862574272 Bacteria 10567477
372 2863406173 2863404153 Bacteria 9672205
373 2867351306 2867346516 Bacteria 7608576
374 2867370667 2867369537 Bacteria 6501581
375 2867477564 2867475112 Bacteria 6909112
376 2875393353 2875391855 Bacteria 7600475
377 2883825676 2883821847 Bacteria 5121194
378 2966603706 2966598605 Bacteria 7676064
379 2990063880 2990059506 Bacteria 9321252
380 2990088446 2990088156 Bacteria 6657676
381 2995464714 2995463766 Bacteria 8577691
382 2997458511 2997451912 Bacteria 8492419
383 2997606554 2997600082 Bacteria 9896405
384 3006322471 3006321560 Bacteria 8247479
385 3006427697 3006425503 Bacteria 6491253
386 8025485906 8025478263 Bacteria 8209203
387 8047899581 8047893842 Bacteria 11723082
388 8048136207 8048127548 Bacteria 11053136
389 8048359348 8048356638 Bacteria 11044339
390 8048376531 8048369669 Bacteria 11666822
391 8048385584 8048379754 Bacteria 11877923
392 8054167295 8054160619 Bacteria 7783213
393 8056449793 8056447290 Bacteria 7680491
394 8056672464 8056667051 Bacteria 6953971
395 JGI24740J21852_10007397
396 JGI24740J21852_10029183
397 JGI24739J22299_10001876
398 JGI24739J22299_10032070
399 JGI24737J22298_10005947
400 JGI24735J21928_10006849
401 JGI24735J21928_10023444
402 rootH2_10027946
403 JGI25160J50197_1018756
404 Ga0070658_10022385
405 Ga0070658_10027012
406 Ga0070658_10107119
407 Ga0070660_100161116
408 Ga0070661_100257492
409 Ga0070667_100037924
410 Ga0070663_100110395
411 Ga0070678_100239753
412 Ga0070679_100117348
413 Ga0068855_100035129
414 Ga0070664_100162979
415 Ga0068857_100079438
416 Ga0068854_100532585
417 Ga0068856_100259860
418 Ga0081455_10050845
419 Ga0075365_10001112
420 Ga0075363_100096216
421 Ga0075428_100015256
422 Ga0075428_100032129
423 Ga0075430_100007182
424 Ga0075431_100009290
425 Ga0075431_100139946
426 Ga0075429_100017446
427 Ga0075429_100120948
428 Ga0105251_10009561
429 Ga0105250_10005086
430 Ga0105240_10018433
431 Ga0105247_10185217
432 Ga0114129_10010612
433 Ga0114129_10398849
434 Ga0105239_10015659
435 Ga0105246_10276392
436 Ga0157324_1002324
437 Ga0157370_10010581
438 Ga0157369_10016725
439 Ga0157369_10198053
440 Ga0163162_10862012
441 Ga0157372_10017015
442 Ga0157372_10063118
443 Ga0163161_10175169
444 Ga0206351_10060730
445 Ga0206350_11507032
446 Ga0206353_10055318
447 Ga0213875_10019416
448 Ga0224712_10026128
449 Ga0207426_1003049
450 Ga0207426_1003352
451 Ga0207713_1010515
452 Ga0207688_10242590
453 Ga0207647_10010970
454 Ga0207647_10041887
455 Ga0207705_10023556
456 Ga0207652_10090018
457 Ga0207694_10125623
458 Ga0207687_10122902
459 Ga0207644_10180316
460 Ga0207679_10479408
461 Ga0207667_10027201
462 Ga0207668_10241045
463 Ga0207658_10069700
464 Ga0207678_10106242
465 Ga0207708_10600367
466 Ga0207702_10107210
467 Ga0207641_10152068
468 Ga0207674_10023458
469 Ga0207674_10057863
470 Ga0207683_10090181
471 Ga0268266_10383104
472 Ga0268265_10134877
473 Ga0268264_10762371
474 Ga0265334_10000488
475 Ga0307517_10005571
476 Ga0307515_10408709
477 Ga0265338_10132432
478 Ga0265338_10176532
479 Ga0307511_10018496
480 Ga0307512_10011088
481 Ga0307512_10083343
482 Ga0316181_1265471
483 Ga0265325_10021094
484 Ga0265340_10011466
485 Ga0265340_10017523
486 Ga0265339_10043931
487 Ga0265316_10070138
488 Ga0307513_10037315
489 Ga0307513_10081887
490 Ga0307513_10337078
491 Ga0307513_10400168
492 Ga0265313_10097874
493 Ga0307508_10002091
494 Ga0307508_10073775
495 Ga0307514_10049889
496 Ga0307514_10133622
497 Ga0265314_10074783
498 Ga0265342_10257941
499 Ga0307516_10094336
500 Ga0307516_10191505
501 Ga0307516_10320140
502 Ga0307409_100309202
503 Ga0307416_100161966
504 Ga0307416_100331354
505 Ga0307415_100442477
506 Ga0373925_0258284
507 Ga0395900_0101969
508 Ga0395898_0012869
509 Ga0395898_0534869
510 Ga0436364_0575575
511 Ga0395901_0123523
512 Ga0439466_0112525
513 Ga0451789_0898930
514 Ga0451797_0695606
515 Ga0451843_1228398
516 Ga0451853_0845768
517 Ga0439464_0013133
518 Ga0466969_0003967
519 Ga0466972_0096114
520 Ga0466965_0022236
521 Ga0466966_0007113
522 Ga0466966_0018307
523 Ga0466966_0087243
524 Ga0466961_0098074
525 Ga0466963_0067952
526 Ga0466963_0210072
527 Ga0466971_0001221
528 Ga0466971_0114549
529 Ga0466970_0028481
530 Ga0466957_0091960
531 Ga0466957_0388112
532 Ga0466959_0004207
533 Ga0466959_0008035
534 Ga0466958_0083728
535 Ga0466967_0033016
536 Ga0466967_0082240
537 Ga0466967_0268926
538 Ga0495592_0012860
539 Ga0495592_0013028
540 Ga0495629_0019095
541 Ga0495629_0122645
542 Ga0495662_0000153
543 Ga0495664_0001155
544 Ga0495585_0078661
545 Ga0495594_0160130
546 Ga0495628_0018734
547 Ga0495632_0081111
548 Ga0495643_0003395
549 Ga0495666_0000291
550 Ga0495652_0004810
551 Ga0495640_0008847
552 Ga0495586_0027715
553 Ga0495586_0097836
554 Ga0495597_0157096
555 Ga0495645_0001733
556 Ga0495645_0068859
557 Ga0495667_0023730
558 Ga0495611_0096827
559 Ga0495625_0086383
560 Ga0495625_0151934
561 Ga0495635_0060718
562 Ga0495659_0120127
563 Ga0495588_0060157
564 Ga0495657_0022933
565 Ga0495657_0275109
566 Ga0495623_0012973
567 Ga0495623_0027809
568 Ga0495646_0008970
569 Ga0495658_0020807
570 Ga0495669_0010654
571 Ga0495613_0144481
572 Ga0495670_0006156
573 Ga0495589_0095090
574 Ga0495600_0048018
575 Ga0495604_0000757
576 Ga0495604_0022372
577 Ga0495636_0000692
578 Ga0495672_0006718
579 Ga0495676_0230562
580 Ga0495683_0035265
581 Ga0495675_0019097
582 Ga0495675_0087913
583 Ga0495685_000187
584 Ga0495685_034013
585 Ga0495681_0008967
586 Ga0495684_0047653
587 Ga0495593_0039844
588 Ga0496105_0065837
589 Ga0496108_0048397
590 Ga0496108_0248269
591 Ga0496108_0392305
592 Ga0496108_0403857
593 Ga0496109_0017055
594 Ga0496109_0045458
595 Ga0496109_0069385
596 Ga0496109_0111499
597 Ga0496110_0002225
598 Ga0496110_0187995
599 Ga0496110_0237109
600 Ga0496110_0388982
601 Ga0496111_0199786
602 Ga0496111_0241861
603 Ga0496114_0010997
604 Ga0496114_0108007
605 Ga0501031_0000940
606 Ga0501031_0004245
607 Ga0501031_0091186
608 Ga0501031_0138548
609 Ga0501031_0203471
610 Ga0501031_0307447
611 Ga0501032_0000349
612 Ga0501032_0004912
613 Ga0501032_0027416
614 Ga0501032_0053057
615 Ga0501032_0135827
616 Ga0501033_0007505
617 Ga0501033_0007761
618 Ga0501033_0009633
619 Ga0501033_0044516
620 Ga0501034_0004152
621 Ga0501034_0021387
622 Ga0501034_0075409
623 Ga0501036_0005495
624 Ga0501036_0005640
625 Ga0501036_0006306
626 Ga0501036_0018027
627 Ga0501036_0226962
628 Ga0501036_0309920
629 Ga0501037_0002432
630 Ga0501037_0014658
631 Ga0501037_0024335
632 Ga0501037_0035657
633 Ga0501037_0161698
634 Ga0501037_0230746
635 Ga0501038_0018060
636 Ga0501038_0024726
637 Ga0501038_0046230
638 Ga0501038_0057387
639 Ga0501038_0103567
640 Ga0501038_0143681
641 Ga0501039_0015672
642 Ga0501039_0021675
643 Ga0501039_0088787
644 Ga0501039_0105350
645 Ga0501039_0183301
646 Ga0501039_0243620
647 Ga0501040_0003905
648 Ga0501040_0013748
649 Ga0501040_0048113
650 Ga0501041_0001346
651 Ga0501041_0007852
652 Ga0501042_0085635
653 Ga0501043_0003089
654 Ga0501043_0016633
655 Ga0501043_0030115
656 Ga0501043_0035426
657 Ga0501046_0001475
658 Ga0501046_0009640
659 Ga0501046_0136545
660 Ga0501047_0000309
661 Ga0501047_0010510
662 Ga0501047_0051980
663 Ga0501048_0002495
664 Ga0501048_0015246
665 Ga0501048_0026258
666 Ga0501067_0003144
667 Ga0501068_0001398
668 Ga0501068_0015873
669 Ga0501068_0024136
670 Ga0501069_0003348
671 Ga0501069_0087849
672 Ga0501069_0126527
673 Ga0501070_0005719
674 Ga0501070_0026926
675 Ga0501070_0028556
676 Ga0501070_0137215
677 Ga0501070_0140287
678 Ga0501070_0155006
679 Ga0501071_0004780
680 Ga0501071_0054193
681 Ga0501071_0132438
682 Ga0501071_0175064
683 Ga0501071_0307624
684 Ga0501072_0000317
685 Ga0501072_0148110
686 Ga0501072_0348139
687 Ga0501073_0005694
688 Ga0501074_0003000
689 Ga0501074_0014933
690 Ga0501074_0110868
691 Ga0501076_0049356
692 Ga0501077_0014233
693 Ga0501077_0195597
694 Ga0501079_0010913
695 Ga0501080_0065277
696 Ga0501083_0002475
697 Ga0501035_0000922
698 Ga0501035_0005042
699 Ga0501035_0013337
700 Ga0501035_0045020
701 Ga0501035_0045435
702 Ga0501035_0046817
703 Ga0501044_0002906
704 Ga0501044_0017943
705 Ga0501045_0008843
706 Ga0501045_0034068
707 Ga0501045_0057043
708 Ga0501045_0300547
709 nmdc:mga05p37_103573_c1
710 nmdc:mga05p37_4705_c1
711 nmdc:mga09592_131709_c1
712 nmdc:mga09592_476620_c1
713 nmdc:mga06r32_130561_c1
714 nmdc:mga06r32_357531_c1
715 Ga0495601_0001737
716 Ga0495619_0119562
717 Ga0500578_0019861
718 Ga0500646_0039601
719 Ga0500553_054802
720 Ga0500556_0050665
721 Ga0500569_001171
722 Ga0500614_001404
723 Ga0500628_001386
724 Ga0500652_002999
725 Ga0500658_0028106
726 Ga0500561_0001626
727 Ga0500573_0003452
728 Ga0500573_0043669
729 Ga0500573_0067247
730 Ga0500600_0002462
731 Ga0500616_0046692
732 Ga0500633_0007872
733 Ga0500634_0000444
734 Ga0500656_000041
735 Ga0500587_007184
736 Ga0501084_0000784
737 Ga0501084_0012347
738 Ga0501084_0034605
739 Ga0501082_0009988
740 Ga0501082_0056348
741 Ga0466962_0000908
742 Ga0530510_0027218
743 Ga0530510_0087740
744 Ga0530510_0189984
745 2515850736
746 2554258944
747 2585314042
748 2643759339
749 2643897409
750 2644015057
751 2644176859
752 2644387354
753 2644463243
754 2676476905
755 2768644333
756 2785344910
757 2793981930
758 2816425141
759 2816428161
760 2819694082
761 2819743220
762 2827630004
763 2862182913
764 2862384703
765 2862582905
766 2863406173
767 2867351306
768 2867370667
769 2867477564
770 2875393353
771 2883825676
772 2966603706
773 2990063880
774 2990088446
775 2995464714
776 2997458511
777 2997606554
778 3006322471
779 3006427697
780 8025485906
781 8047899581
782 8048136207
783 8048359348
784 8048376531
785 8048385584
786 8054167295
787 8056449793
788 8056672464

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

175

251

0.89

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

173

247

0.86

PF00034

Cytochrom_C

Cytochrome c

77

154

0.76

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

75

150

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lod-assembly1.cif.gz_E cryo-em structure of the air-oxidized photosynthetic alternative complex iii from roseiflexus castenholzii 0.8013 144 229
1e2r-assembly1.cif.gz_B cytochrome cd1 nitrite reductase, reduced and cyanide bound 0.7919 146 222
1h9x-assembly1.cif.gz_A cytochrome cd1 nitrite reductase, reduced form 0.7816 141 222
6loe-assembly1.cif.gz_E cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.7782 144 229
2v08-assembly1.cif.gz_A structure of wild-type phormidium laminosum cytochrome c6 0.7735 150 226
ID Description Score Start End Superfamily
af_P9WP35_148_241_1.10.760.10 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8861 143 228 1.10.760.10
af_P9WP35_148_241_1.10.760.10 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8044 143 228 1.10.760.10
1h9yB01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7941 146 222 1.10.760.10
1h9yA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7915 146 222 1.10.760.10
2zooA02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.728 147 229 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A2D6I075-F1-model_v4 Cystathionine beta-lyase 0.8893 49 215 GO:0009055
GO:0016829
GO:0020037
GO:0046872
AF-A0A2D6I075-F1-model_v4 Cystathionine beta-lyase 0.8589 49 215 GO:0009055
GO:0016829
GO:0020037
GO:0046872
AF-A0A4R4KTG3-F1-model_v4 C-type cytochrome 0.8488 66 203 GO:0009055
GO:0020037
GO:0046872
AF-A0A2V9QZY9-F1-model_v4 Cytochrome c domain-containing protein 0.8248 145 227 GO:0009055
GO:0020037
GO:0046872
AF-A0A2V2REQ2-F1-model_v4 deleted 0.8149 148 225

Map